RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780180|ref|YP_003064593.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Candidatus Liberibacter asiaticus str. psy62] (360 letters) >gnl|CDD|31151 COG0809, QueA, S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) [Translation, ribosomal structure and biogenesis]. Length = 348 Score = 422 bits (1087), Expect = e-119 Identities = 175/360 (48%), Positives = 227/360 (63%), Gaps = 16/360 (4%) Query: 1 MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60 M + +FDFDLP IA P PRDS+RL+V+ I DL +LN D +V Sbjct: 1 MRLSDFDFDLPEELIAQYPAEPRDSSRLLVLDRKTG---EIEHRTFYDLIDYLNPGDLLV 57 Query: 61 FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120 FN+T+VI A+L F + ++ L R+ N W +PSK +K GD ++F Sbjct: 58 FNDTRVIPARL----FGRKHESGGKVEVLLERRLDDNRWLALIKPSKRLKAGDEIYF--- 110 Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIE-LERQISLVGTIPLPPYIARKRPIDARDYVD 179 L+ATV+++ G LL F GI L + G +PLPPYI KR +D D Sbjct: 111 --GDGLKATVLERLEHGLRLLEFDYEGIFSLLELLEKYGEMPLPPYI--KRKLDELDRDR 166 Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239 YQT YAK GSVAAPTAGLHFT LL +L + G+++ FVTLHVGAGTF PVKVE+ ++H Sbjct: 167 YQTVYAKEPGSVAAPTAGLHFTEELLEKLKAKGVEIAFVTLHVGAGTFRPVKVENIEEHK 226 Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299 MHSE + TA A+N+ K+RGGRI++VGTTS+R LE+A E G + +SG+T+IFI P Sbjct: 227 MHSEYYEVPQETADAINAAKARGGRIIAVGTTSVRTLESAAREAG-LKAFSGWTDIFIYP 285 Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359 GYRF+ VD L++NFHLPKSTLLMLVSAF G EE Y+HAI YRF+SYGD L+ + Sbjct: 286 GYRFKVVDALITNFHLPKSTLLMLVSAFAGREELLAAYKHAIEQKYRFFSYGDAMLILRN 345 >gnl|CDD|145599 pfam02547, Queuosine_synth, Queuosine biosynthesis protein. Queuosine (Q) biosynthesis protein, or S-adenosylmethionine:tRNA -ribosyltransferase-isomerase, is required for the synthesis of the queuosine precursor (oQ). Q is a hypermodified nucleoside usually found at the first position of the anticodon of asparagine, aspartate, histidine, and tyrosine tRNAs. Length = 218 Score = 257 bits (658), Expect = 5e-69 Identities = 100/233 (42%), Positives = 131/233 (56%), Gaps = 16/233 (6%) Query: 1 MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60 M + +FD++LP IA P PRDS+RL+V+ I SDLP +L D +V Sbjct: 1 MKLSDFDYELPEELIAQYPAEPRDSSRLLVLDRETG---EIEHRRFSDLPDYLRPGDLLV 57 Query: 61 FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120 FN+T+VI A+L G + ++ L + W +PSK +K GD L F Sbjct: 58 FNDTRVIPARLFGRKET-----GGKVEVLLLRPLDDGRWLALVKPSKKLKPGDTLEF--- 109 Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIE-LERQISLVGTIPLPPYIARKRPIDARDYVD 179 L+A V+++ G L+ F G E L + G IPLPPYI KRP + D Sbjct: 110 --GDGLKAEVLERLEEGGRLVRFQFEGGEDLLELLERYGHIPLPPYI--KRPDEEEDRER 165 Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKV 232 YQT YAK GSVAAPTAGLHFT LL RL + G+++ FVTLHVGAGTF+PV+V Sbjct: 166 YQTVYAKKPGSVAAPTAGLHFTPELLERLKAKGVEIAFVTLHVGAGTFLPVRV 218 >gnl|CDD|145901 pfam02996, Prefoldin, Prefoldin subunit. This family comprises of several prefoldin subunits. The biogenesis of the cytoskeletal proteins actin and tubulin involves interaction of nascent chains of each of the two proteins with the oligomeric protein prefoldin (PFD) and their subsequent transfer to the cytosolic chaperonin CCT (chaperonin containing TCP-1). Electron microscopy shows that eukaryotic PFD, which has a similar structure to its archaeal counterpart, interacts with unfolded actin along the tips of its projecting arms. In its PFD-bound state, actin seems to acquire a conformation similar to that adopted when it is bound to CCT. Length = 120 Score = 31.5 bits (72), Expect = 0.40 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 218 VTLHVGAGTFMPVKVEDTDDHIMH 241 V + +GAG F+ +V DTD ++ Sbjct: 41 VLVPLGAGLFVKGEVIDTDKVLVD 64 >gnl|CDD|38799 KOG3592, KOG3592, KOG3592, Microtubule-associated proteins [Cytoskeleton]. Length = 934 Score = 29.7 bits (66), Expect = 1.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Query: 17 LRPVFPRDSARLMVVHPNLSCPLVISDHLVS 47 L PV D A L P+ S PLV S+H + Sbjct: 546 LDPVELTDEAELKPPTPDPSAPLVPSEHDII 576 >gnl|CDD|29840 cd00584, Prefoldin_alpha, Prefoldin alpha subunit; Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly. The complex contains two alpha and four beta subunits, the two subunits being evolutionarily related. In archaea, there is usually only one gene for each subunit while in eukaryotes there two or more paralogous genes encoding each subunit adding heterogeneity to the structure of the hexamer. The structure of the complex consists of a double beta barrel assembly with six protruding coiled-coils.. Length = 129 Score = 29.4 bits (66), Expect = 1.5 Identities = 11/43 (25%), Positives = 24/43 (55%), Gaps = 5/43 (11%) Query: 222 VGAGTFMPVKVEDTDDHIMHSEIG---FIDAPTAQALNSVKSR 261 +GAG F+ KV+DTD ++ +G +++ +A+ + + Sbjct: 55 LGAGVFVKAKVKDTDKVLVD--LGTGYYVEKDLEEAIEFLDKK 95 >gnl|CDD|119347 cd06555, ASCH_PF0470_like, ASC-1 homology domain, subfamily similar to Pyrococcus furiosus Pf0470. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to function as an RNA-binding domain during coactivation, RNA-processing and the regulation of prokaryotic translation.. Length = 109 Score = 29.5 bits (67), Expect = 1.7 Identities = 9/24 (37%), Positives = 12/24 (50%) Query: 109 IKKGDILHFFSQDGQSRLEATVID 132 IK GD + F D +L V+D Sbjct: 32 IKVGDKILFNDLDTGQQLLVKVVD 55 >gnl|CDD|31916 COG1730, GIM5, Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones]. Length = 145 Score = 29.1 bits (65), Expect = 1.9 Identities = 11/24 (45%), Positives = 15/24 (62%) Query: 218 VTLHVGAGTFMPVKVEDTDDHIMH 241 V + VGAG F+ KV+D D I+ Sbjct: 58 VLVPVGAGLFVKAKVKDMDKVIVS 81 >gnl|CDD|37262 KOG2051, KOG2051, KOG2051, Nonsense-mediated mRNA decay 2 protein [RNA processing and modification]. Length = 1128 Score = 27.7 bits (61), Expect = 5.5 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Query: 8 FDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAI 59 F +P +R+ L P + R A L P+++ LV L + + L+ I Sbjct: 468 FVVPRTRLDLLPYYSRLVATLSKCMPDVATELV--TMLRKEFRSHLHKKAQI 517 >gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members. This group contains enzymes of the zinc-dependent alcohol dehydrogenase family, including members (aka MDR) identified as 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase and N-benzyl-3-pyrrolidinol dehydrogenase. 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase catalyzes the conversion of 6-Hydroxycyclohex-1-enecarbonyl-CoA and NAD+ to 6-Ketoxycyclohex-1-ene-1-carboxyl-CoA,NADH, and H+. This group displays the characteristic catalytic and structural zinc sites of the zinc-dependent alcohol dehydrogenases. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 338 Score = 27.6 bits (62), Expect = 5.5 Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Query: 251 TAQALNSVKSRGGRIVSVGTTSLRL 275 A +VK GGRIV VG +L Sbjct: 246 FEDAQKAVK-PGGRIVVVGLGRDKL 269 >gnl|CDD|37265 KOG2054, KOG2054, KOG2054, Nucleolar RNA-associated protein (NRAP) [Function unknown]. Length = 1121 Score = 26.9 bits (59), Expect = 9.3 Identities = 24/103 (23%), Positives = 38/103 (36%), Gaps = 11/103 (10%) Query: 229 PVKVEDTDDHIMHSEIGFIDAPTAQAL--NSVKSRGGRIVSVGTTSLRLLETATTEDGII 286 + D + FID+ L N S ++ +L LL++ + Sbjct: 384 SPSLPALADFHEGQLVTFIDSSGHLNLCANMTASTYEQVQEEARLTLMLLDSRADD---- 439 Query: 287 NPWSGFTNIFITPGYRFRAVD-ILMSNFHLPKSTLLMLVSAFC 328 GF+ IF+T FRA D +L + L+S FC Sbjct: 440 ----GFSLIFMTKIPVFRAYDHVLHLSPLSRLQAAEHLLSGFC 478 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.138 0.409 Gapped Lambda K H 0.267 0.0758 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,420,236 Number of extensions: 233039 Number of successful extensions: 532 Number of sequences better than 10.0: 1 Number of HSP's gapped: 521 Number of HSP's successfully gapped: 12 Length of query: 360 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 265 Effective length of database: 4,210,882 Effective search space: 1115883730 Effective search space used: 1115883730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 58 (26.1 bits)