HHsearch alignment for GI: 254780181 and conserved domain: PRK07152

>PRK07152 nadD putative nicotinate-nucleotide adenylyltransferase; Validated.
Probab=99.97  E-value=1.1e-30  Score=203.01  Aligned_cols=162  Identities=19%  Similarity=0.243  Sum_probs=119.3

Q ss_pred             CEEEEECCCCCCCCHHHHHHHHHHHHH--CCEEEEECCC-CCCCCCC-CCCHHHHHHHHHHHHHHHCCCCCCCCEEE---
Q ss_conf             659996589987848999999999974--8979996455-8887665-78989999999997642013355441242---
Q gi|254780181|r    2 MRKAVYTGSFDPITNGHMDIIIQALSF--VEDLVIAIGC-NSVKTKG-FLSIQERSELIKQSIFHFIPDSSNRVSVI---   74 (182)
Q Consensus         2 mkigifgGsFdPiH~GHL~ia~~a~~~--~D~vii~~~~-~p~k~~~-~~s~e~r~~m~~~a~~~~~~~~~~~~~~~---   74 (182)
T Consensus         1 MkIgifGGSFDPiH~GHl~ia~~~~~~~~lDkv~~vPt~~~P~K~~~~~~~~~~Rl~Ml~la~~~~~~~~v~d~Ei~~~~   80 (343)
T PRK07152          1 MKIAIFGGSFDPIHKGHINIAKKAIKKLKLDKLFFVPTYINPFKKKNKTSNGKDRLNMLKLALKNLPKIEVSDFEIKRQN   80 (343)
T ss_pred             CEEEEECCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEEHHHCCC
T ss_conf             97999631778767999999999999809898999987979999999999999999999999637997599702965799


Q ss_pred             -CCCCCCCCCC---CCCCCEEEEEECCCCCCHHHHHHHHHHHHHHC------C---C----CCEEEEECCCCCCCCCHHH
Q ss_conf             -0333332210---01497079994376520124677998987647------9---9----8689970685721132699
Q gi|254780181|r   75 -SFEGLAVNLA---KDISAQVIVRGLRDMTDFDYEMRMTSVNRCLC------P---E----IATIALFAKESSRYVTSTL  137 (182)
Q Consensus        75 -~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~------~---~----~~~i~l~~~~~~~~ISST~  137 (182)
T Consensus        81 ~sYTidTl~~lk~~yp~~~~~fIiG~D~l~~~~~W~~~e~I~~~~~~vV~~R~~~~~~~~~~ky~~~~l~~~~~~~SSt~  160 (343)
T PRK07152         81 VSYTIDTINYFKKKYPNDEIYFIIGSDNLENFKKWKNIEEILKKVQIVVFKRTKNINKINIKKYNFLLLKNKNLNISSTK  160 (343)
T ss_pred             CCHHHHHHHHHHHHCCCCCEEEEECHHHHHHCCCCCCHHHHHHHCCEEEEECCCCHHHHHHHCCCEEEECCCCCCCCHHH
T ss_conf             82599999999987899979999637865233133699999983979999899832221343178188568888876498


Q ss_pred             HHHHHHCCCCHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             9999985999558399999999999999865
Q gi|254780181|r  138 IRHLISIDADITSFVPDPVCVFLKNIVISLV  168 (182)
Q Consensus       138 IR~~i~~g~~i~~lVP~~V~~yIk~~~~~~~  168 (182)
T Consensus       161 iR~-----~~~~~~~~~~V~~YI~~n~LY~~  186 (343)
T PRK07152        161 IRN-----KGNLSLLDPKVLDYINENGLYAY  186 (343)
T ss_pred             HHC-----CCCCCCCCHHHHHHHHHCCCEEH
T ss_conf             866-----78702189899999974676101