HHsearch alignment for GI: 254780181 and conserved domain: PRK13671

>PRK13671 hypothetical protein; Provisional.
Probab=98.13  E-value=5.7e-05  Score=49.73  Aligned_cols=42  Identities=19%  Similarity=0.342  Sum_probs=31.5

Q ss_pred             CEEEEECCCCCCCCHHHHHHHHHHHHHC--CEEEEECCCCCCCCC
Q ss_conf             6599965899878489999999999748--979996455888766
Q gi|254780181|r    2 MRKAVYTGSFDPITNGHMDIIIQALSFV--EDLVIAIGCNSVKTK   44 (182)
Q Consensus         2 mkigifgGsFdPiH~GHL~ia~~a~~~~--D~vii~~~~~p~k~~   44 (182)
T Consensus         1 mavGIIa-EYNPFHnGH~Yhi~qar~~~~ad~iIavMSGnFvQRG   44 (298)
T PRK13671          1 MAIGIIA-EYNPFHNGHIYQINYIKNKFPNEKIIIILSGKYTQRG   44 (298)
T ss_pred             CCEEEEE-EECCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCC
T ss_conf             9347997-2079740189999999986599859999458852088