PSIBLAST alignment of GI: 254780181 and protein with PDB id: 1tfu

>gi|55669913|pdb|1TFU|A Chain A, Phosphopantetheine Adenylyltransferase From Mycobacterium Tuberculosis Length = 157
 Score =  147 bits (370), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 51/163 (31%), Positives = 88/163 (53%), Gaps = 7/163 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AV  GSFDP+T GH+DI  +A +  +++V+AI  N  KT  F  + ER  ++K+S  
Sbjct: 1   MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMF-DLDERIAMVKESTT 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H        + V    GL V+  +      IV+GLR  TDF+YE++M  +N+ +   + T
Sbjct: 60  HLPN-----LRVQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHIA-GVDT 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
             +       +V+S+L + +  +  D++  +P+PV   L++ +
Sbjct: 114 FFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL 156