PSIBLAST alignment of GI: 254780181 and protein with PDB id: 1vlh

>gi|52696203|pdb|1VLH|A Chain A, Crystal Structure Of Phosphopantetheine Adenylyltransferase (Tm0741) From Thermotoga Maritima At 2.20 A Resolution Length = 173
>gi|52696204|pdb|1VLH|B Chain B, Crystal Structure Of Phosphopantetheine Adenylyltransferase (Tm0741) From Thermotoga Maritima At 2.20 A Resolution Length = 173
 Score =  162 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 59/168 (35%), Positives = 97/168 (57%), Gaps = 7/168 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDPIT GH+DII +ALS  ++LV+ +  N  K   F +++ER +LI++ + 
Sbjct: 13  MK-AVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKKCMF-TLEERKKLIEEVLS 70

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                  + V V    GL V+  K    +V+VRGLR +TD++YE++M   N+ L  ++ T
Sbjct: 71  -----DLDGVKVDVHHGLLVDYLKKHGIKVLVRGLRAVTDYEYELQMALANKKLYSDLET 125

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + L A E   +++S+L++ +     D+T +VP  V   L   +    +
Sbjct: 126 VFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLKEGKR 173