BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780181|ref|YP_003064594.1| phosphopantetheine
adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62]
         (182 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|152987438|ref|YP_001345852.1| phosphopantetheine adenylyltransferase [Pseudomonas aeruginosa PA7]
 gi|150962596|gb|ABR84621.1| pantetheine-phosphate adenylyltransferase [Pseudomonas aeruginosa
           PA7]
          Length = 183

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 51/165 (30%), Positives = 89/165 (53%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D+I +A    + ++IA+  +  K   F S+++R  L ++   
Sbjct: 25  MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLF-SLEQRVALAQEVTK 83

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V+ F  L  +  K+  A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 84  HLPNVE-----VVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 138

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DI+ FV   V   L      
Sbjct: 139 MFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFKR 183


>gi|91791577|ref|YP_561228.1| phosphopantetheine adenylyltransferase [Shewanella denitrificans
           OS217]
 gi|123357225|sp|Q12SS1|COAD_SHEDO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|91713579|gb|ABE53505.1| Coenzyme A biosynthesis protein [Shewanella denitrificans OS217]
          Length = 168

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 57/168 (33%), Positives = 98/168 (58%), Gaps = 6/168 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R+A+Y G+FDP+TNGH D+I +A    + ++I I  N  K   F +++ER E +    
Sbjct: 1   MHRRAIYPGTFDPVTNGHADLIERAAKLFKHVIIGIAANPSKQPRF-TLEERVEQLTLVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ A+D  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHLDNVE-----VVGFSGLLVDFARDQKASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           ++ L   E + +++STL++ +     D++ FV   V + LK  + ++ 
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPQVALALKEKIAAMK 162


>gi|196231872|ref|ZP_03130728.1| pantetheine-phosphate adenylyltransferase [Chthoniobacter flavus
           Ellin428]
 gi|196223994|gb|EDY18508.1| pantetheine-phosphate adenylyltransferase [Chthoniobacter flavus
           Ellin428]
          Length = 162

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 57/164 (34%), Positives = 98/164 (59%), Gaps = 6/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+ +Y GSFDPITNGH+D+I +A +  +++V+A+  N  K   F S +ER  L++++  
Sbjct: 1   MRRVIYPGSFDPITNGHLDVINRAATLFDEVVVAVAFNDQKQGLF-SAEERVSLLQEAS- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   + +  F+GL ++ A+   A  +VRGLR ++DF++E +M  +NR L P+I T
Sbjct: 59  ----GTKPNIRIARFDGLLMDFARREQATAVVRGLRAVSDFEFEFQMALMNRKLEPQIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           I L   E   Y++S +++ +  +  D++SFVP  V   L+    
Sbjct: 115 IFLMPAEKYTYLSSRIVKEIARLGGDVSSFVPVSVAKALREKFA 158


>gi|254463334|ref|ZP_05076750.1| pantetheine-phosphate adenylyltransferase [Rhodobacterales
           bacterium HTCC2083]
 gi|206679923|gb|EDZ44410.1| pantetheine-phosphate adenylyltransferase [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 163

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 61/164 (37%), Positives = 97/164 (59%), Gaps = 1/164 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T GH+DII +A + V+ LVI +  N  K   F S++ER E+I+++  
Sbjct: 1   MRTGLYPGTFDPVTLGHIDIIRRACALVDKLVIGVAINRDKGPLF-SLEERVEMIERTCA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   + V  FE L ++ A+D+ AQ+IVRGLR + DF+YE +M  +NR L   I T
Sbjct: 60  ELSAQTGTEIVVHPFENLLIDCARDVGAQIIVRGLRAVADFEYEYQMVGMNRVLDDSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L A+   + + S L++ +  +  D++SFV   V   LK  + 
Sbjct: 120 VFLMAEAQHQAIASKLVKEIARLGGDVSSFVTPDVKAALKERLA 163


>gi|254428570|ref|ZP_05042277.1| pantetheine-phosphate adenylyltransferase [Alcanivorax sp. DG881]
 gi|196194739|gb|EDX89698.1| pantetheine-phosphate adenylyltransferase [Alcanivorax sp. DG881]
          Length = 163

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 52/169 (30%), Positives = 96/169 (56%), Gaps = 6/169 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDPITNGH+D++ +A    +++V+ I  +  K   F +++ER +L ++ +
Sbjct: 1   MTNRVIYPGTFDPITNGHLDLVERAAKMFDEVVVGIAASEKKGPLF-TLEERVDLTRRVL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V  F  L  +  ++    +++RGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 60  SHLPNVK-----VTGFSKLLAHFCREEGGNILLRGLRAVSDFEYEFQLANMNRQLAPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           T+ L   E   +++S+LIR +  +D D+ +FVP  V   L+    +  K
Sbjct: 115 TVFLTPAEHLSFISSSLIREIALLDGDVNNFVPPLVAEALEEKRKARQK 163


>gi|311696223|gb|ADP99096.1| phosphopantetheine adenylyltransferase [marine bacterium HP15]
          Length = 158

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 59/163 (36%), Positives = 92/163 (56%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M K +Y G+FDPITNGH D+I +A    +++V+AI  N  K      ++ER EL++Q+  
Sbjct: 1   MSKVIYPGTFDPITNGHTDLIERAGRMFDEIVVAIAYNPKKQPLL-DLEERCELVRQATA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H    +     V  F  L  +  ++  A VI+RGLR ++DF+YE ++  +NR L PE+ +
Sbjct: 60  HLPNVT-----VTGFSNLLADFVREQGATVILRGLRAVSDFEYEFQLADMNRRLAPEVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L       Y++STLIR + S+  D++ FV   V   LK   
Sbjct: 115 VFLTPANHLSYISSTLIREIASLGGDVSEFVDPAVEAALKKKF 157


>gi|146309205|ref|YP_001189670.1| phosphopantetheine adenylyltransferase [Pseudomonas mendocina ymp]
 gi|166216576|sp|A4Y022|COAD_PSEMY RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|145577406|gb|ABP86938.1| Phosphopantetheine adenylyltransferase [Pseudomonas mendocina ymp]
          Length = 160

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 50/165 (30%), Positives = 89/165 (53%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+  +  K   F  +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERAARLFDHVIIAVAASPKKNPLF-PLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V+ F  L  +  K+  A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VVGFSSLLAHFVKEQGANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DI+ FV   V   L      
Sbjct: 115 LFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALNARFQK 159


>gi|149378332|ref|ZP_01896039.1| phosphopantetheine adenylyltransferase [Marinobacter algicola
           DG893]
 gi|149357390|gb|EDM45905.1| phosphopantetheine adenylyltransferase [Marinobacter algicola
           DG893]
          Length = 160

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 60/165 (36%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M K +Y G+FDPITNGH D+I +A    +++V+AI  N  K+    +++ER EL++++  
Sbjct: 1   MPKVIYPGTFDPITNGHTDLIERAGRLFDEVVVAIAYNPKKSPLL-TLEERCELVEKATS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H    S     V  F  L  +  ++ +A VI+RGLR ++DF+YE ++  +NR L PE+ +
Sbjct: 60  HLPNVS-----VTGFSNLLADFVREQNATVIIRGLRAVSDFEYEFQLADMNRRLAPEVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L       Y++STLIR + S+  D++ FV   V   LK   I 
Sbjct: 115 VFLTPSNHLSYISSTLIREIASLGGDVSEFVDPAVEAALKRKFIK 159


>gi|15595560|ref|NP_249054.1| phosphopantetheine adenylyltransferase [Pseudomonas aeruginosa
           PAO1]
 gi|107099347|ref|ZP_01363265.1| hypothetical protein PaerPA_01000359 [Pseudomonas aeruginosa PACS2]
 gi|116054092|ref|YP_788535.1| phosphopantetheine adenylyltransferase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218889104|ref|YP_002437968.1| phosphopantetheine adenylyltransferase [Pseudomonas aeruginosa
           LESB58]
 gi|254237401|ref|ZP_04930724.1| phosphopantetheine adenylyltransferase [Pseudomonas aeruginosa
           C3719]
 gi|254243461|ref|ZP_04936783.1| phosphopantetheine adenylyltransferase [Pseudomonas aeruginosa
           2192]
 gi|296386860|ref|ZP_06876359.1| phosphopantetheine adenylyltransferase [Pseudomonas aeruginosa
           PAb1]
 gi|313112021|ref|ZP_07797806.1| phosphopantetheine adenylyltransferase [Pseudomonas aeruginosa
           39016]
 gi|14194513|sp|Q9I6D1|COAD_PSEAE RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|122261767|sp|Q02U51|COAD_PSEAB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226706702|sp|B7V2S6|COAD_PSEA8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|9946214|gb|AAG03752.1|AE004474_4 phosphopantetheine adenylyltransferase [Pseudomonas aeruginosa
           PAO1]
 gi|115589313|gb|ABJ15328.1| phosphopantetheine adenylyltransferase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126169332|gb|EAZ54843.1| phosphopantetheine adenylyltransferase [Pseudomonas aeruginosa
           C3719]
 gi|126196839|gb|EAZ60902.1| phosphopantetheine adenylyltransferase [Pseudomonas aeruginosa
           2192]
 gi|218769327|emb|CAW25087.1| phosphopantetheine adenylyltransferase [Pseudomonas aeruginosa
           LESB58]
 gi|310884308|gb|EFQ42902.1| phosphopantetheine adenylyltransferase [Pseudomonas aeruginosa
           39016]
          Length = 159

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 51/165 (30%), Positives = 89/165 (53%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D+I +A    + ++IA+  +  K   F S+++R  L ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLF-SLEQRVALAQEVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V+ F  L  +  K+  A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DI+ FV   V   L      
Sbjct: 115 MFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFKR 159


>gi|26991799|ref|NP_747224.1| phosphopantetheine adenylyltransferase [Pseudomonas putida KT2440]
 gi|31563014|sp|Q88CQ7|COAD_PSEPK RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|24986911|gb|AAN70688.1|AE016712_6 pantetheine-phosphate adenylyltransferase [Pseudomonas putida
           KT2440]
 gi|313501099|gb|ADR62465.1| CoaD [Pseudomonas putida BIRD-1]
          Length = 161

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 90/165 (54%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+  +  K   F  +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVIIAVAASPKKNPLF-PLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          VI F  L  + AK+  A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VIGFSSLLAHFAKEQGANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DI+ FV   V   L      
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDISKFVHPVVADALTERFKK 159


>gi|104779571|ref|YP_606069.1| phosphopantetheine adenylyltransferase [Pseudomonas entomophila
           L48]
 gi|166216575|sp|Q1IGF0|COAD_PSEE4 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|95108558|emb|CAK13252.1| phosphopantetheine adenylyltransferase [Pseudomonas entomophila
           L48]
          Length = 159

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 90/165 (54%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+  +  K   F  +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVIIAVAASPKKNPLF-PLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          VI F  L  + AK+  A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VIGFSSLLAHFAKEQGANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DI+ FV   V   L      
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDISKFVHPTVADALTERFRK 159


>gi|257482984|ref|ZP_05637025.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289624662|ref|ZP_06457616.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289648502|ref|ZP_06479845.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298485254|ref|ZP_07003347.1| Phosphopantetheine adenylyltransferase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298160242|gb|EFI01270.1| Phosphopantetheine adenylyltransferase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320326364|gb|EFW82417.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|330871126|gb|EGH05835.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330891345|gb|EGH24006.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           mori str. 301020]
 gi|330985916|gb|EGH84019.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011776|gb|EGH91832.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 159

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 91/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+  +  K   F  +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVVIAVAASPKKNPLF-PLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DIT FV   V   L      
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFVHPAVAQALTERFKR 159


>gi|71736330|ref|YP_276889.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71556883|gb|AAZ36094.1| pantetheine-phosphate adenylyltransferase [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 187

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 91/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+  +  K   F  +++R EL ++   
Sbjct: 29  MNRVLYPGTFDPITKGHGDLVERASRLFDHVVIAVAASPKKNPLF-PLEQRVELAREVTK 87

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 88  HLPNVE-----VVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 142

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DIT FV   V   L      
Sbjct: 143 LFLTPSERYSFISSTLVREIAALGGDITKFVHPAVAQALTERFKR 187


>gi|330872368|gb|EGH06517.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 159

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 91/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+  +  K   F  +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVVIAVAASPKKNPLF-PLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V+ F  L  + A++ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VVGFSTLLAHFAEEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DIT FV   V   L      
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFVHPAVAQALTERFKR 159


>gi|148550199|ref|YP_001270301.1| phosphopantetheine adenylyltransferase [Pseudomonas putida F1]
 gi|166216577|sp|A5WAF7|COAD_PSEP1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|148514257|gb|ABQ81117.1| Phosphopantetheine adenylyltransferase [Pseudomonas putida F1]
          Length = 159

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 90/165 (54%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+  +  K   F  +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVIIAVAASPKKNPLF-PLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          VI F  L  + AK+  A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VIGFSSLLAHFAKEQGANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DI+ FV   V   L      
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDISKFVHPVVADALTERFKK 159


>gi|320331645|gb|EFW87583.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 159

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 91/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+  +  K   F  +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVVIAVAASPKKKPLF-PLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V+ F  L  + A++ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VVGFSTLLAHFAEEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DIT FV   V   L      
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFVHPAVAQALTERFKR 159


>gi|56697063|ref|YP_167426.1| phosphopantetheine adenylyltransferase [Ruegeria pomeroyi DSS-3]
 gi|81558488|sp|Q5LRC9|COAD_SILPO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|56678800|gb|AAV95466.1| pantetheine-phosphate adenylyltransferase [Ruegeria pomeroyi DSS-3]
          Length = 165

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 59/165 (35%), Positives = 94/165 (56%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F +++ER  +I+    
Sbjct: 1   MRVALYPGTFDPITLGHVDIIRRAAALVDKLVIGVAINRDKGPLF-TLEERVAMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               ++   +    FE L ++ A+D+ AQ+IVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  ALSAETGTEIVAHPFENLLIDCARDVGAQIIVRGLRAVADFEYEFQMVGMNRALDDSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A    + + S L++ +  +  D++ FVP  V   LK  +  
Sbjct: 120 VFLMADARRQAIASKLVKEIARLGGDVSKFVPPRVNDALKERLGR 164


>gi|325273724|ref|ZP_08139924.1| phosphopantetheine adenylyltransferase [Pseudomonas sp. TJI-51]
 gi|324101144|gb|EGB98790.1| phosphopantetheine adenylyltransferase [Pseudomonas sp. TJI-51]
          Length = 161

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 51/165 (30%), Positives = 90/165 (54%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+  +  K   F  +++R  L ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVIIAVAASPKKNPLF-PLEQRVALAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          VI F  L  + AK+  A V++RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VIGFSSLLAHFAKEQGANVLLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DI+ FV   V   L      
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDISKFVHPAVAEALTERFKK 159


>gi|66047982|ref|YP_237823.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           syringae B728a]
 gi|289672460|ref|ZP_06493350.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           syringae FF5]
 gi|302188122|ref|ZP_07264795.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           syringae 642]
 gi|75500244|sp|Q4ZM37|COAD_PSEU2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|63258689|gb|AAY39785.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related
           [Pseudomonas syringae pv. syringae B728a]
 gi|330944156|gb|EGH46275.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           pisi str. 1704B]
 gi|330954988|gb|EGH55248.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae Cit 7]
 gi|330980016|gb|EGH78282.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 159

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 91/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+  +  K   F  +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDQVVIAVAASPKKNPLF-PLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DIT FV   V   L      
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFVHPAVAQALTERFKR 159


>gi|188991177|ref|YP_001903187.1| phosphopantetheine adenylyltransferase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|229541053|sp|B0RRP8|COAD_XANCB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|167732937|emb|CAP51133.1| Pantetheine-phosphate adenylyltransferase [Xanthomonas campestris
           pv. campestris]
          Length = 168

 Score =  174 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 54/160 (33%), Positives = 92/160 (57%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K      ++ R EL ++++  
Sbjct: 7   RIAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPAL-PLERRVELAQEALAA 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     V  F+ L  +  +D+ A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 66  HANVE-----VRGFDTLLAHFVRDMGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L   E   +++S+L+R +  +  D++ FVP  V   L+ 
Sbjct: 121 FLTPAEQYSFISSSLVREIARLGGDVSGFVPASVVDALRQ 160


>gi|126735622|ref|ZP_01751367.1| pantetheine-phosphate adenylyltransferase [Roseobacter sp. CCS2]
 gi|126714809|gb|EBA11675.1| pantetheine-phosphate adenylyltransferase [Roseobacter sp. CCS2]
          Length = 164

 Score =  174 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 60/164 (36%), Positives = 93/164 (56%), Gaps = 1/164 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T+GH+DII +A S V+ LVI +  N  K   F +++ER  +I+    
Sbjct: 1   MRVGLYPGTFDPVTHGHLDIIQRACSLVDRLVIGVAINRDKGPMF-TLEERVAMIEAETA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H    +   + V  FE L +N A+D+ A VI+RGLR + DF+YE +M  +NR L   I T
Sbjct: 60  HLGAQTGCIIDVHPFENLLINCARDVGASVIIRGLRAVADFEYEYQMVGMNRVLDNSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L A+   + + S L++ +  +  D++ FV   V   LK    
Sbjct: 120 VFLMAEAQHQAIASKLVKEIARLGGDVSKFVTPAVNTALKKRFA 163


>gi|254498626|ref|ZP_05111345.1| truncated phosphopantetheine adenylyltransferase [Legionella
           drancourtii LLAP12]
 gi|254352166|gb|EET10982.1| truncated phosphopantetheine adenylyltransferase [Legionella
           drancourtii LLAP12]
          Length = 164

 Score =  174 bits (440), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 56/163 (34%), Positives = 100/163 (61%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+DII +A     +L++A+  N+ K   F S++ R   +++++
Sbjct: 1   MKTKAIYPGTFDPVTNGHVDIIGRAAKIFPELIVAVASNNAKRPLF-SLETRIRFLEEAV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F+ L ++  ++  A+VI+RGLR ++DF+YE ++  +NR L  ++ 
Sbjct: 60  AHLP-----GVRVMGFDNLLIDFVQEQKAEVILRGLRAVSDFEYEFQLAGMNRKLYKDVE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           T+ L   E+  +++STL+R +  ++ DI+ FVP  V   L+  
Sbjct: 115 TLFLTPSENLMFISSTLVREIALLNGDISQFVPPCVVKELEKR 157


>gi|226942511|ref|YP_002797584.1| phosphopantetheine adenylyltransferase [Azotobacter vinelandii DJ]
 gi|259491300|sp|C1DIB2|COAD_AZOVD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226717438|gb|ACO76609.1| phosphopantetheine adenylyltransferase [Azotobacter vinelandii DJ]
          Length = 159

 Score =  174 bits (440), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 51/165 (30%), Positives = 90/165 (54%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+  +  K   F S+ +R EL ++   
Sbjct: 1   MNRVIYPGTFDPITKGHGDLVERAAKLFDHVIIAVAASPKKNPLF-SLDKRVELAREVTR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V+ F  L    A++  A  ++RGLR ++DF+YE ++ ++NR L PE+ +
Sbjct: 60  HLPNVE-----VLGFSSLLAQFAREQKANALLRGLRAVSDFEYEFQLANMNRQLAPEVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   Y++STL+R + ++  +I  FV   V   L+    +
Sbjct: 115 LFLTPSEKYSYISSTLVREIAALGGNIEQFVHPAVADALRERFRA 159


>gi|110832942|ref|YP_691801.1| pantetheine-phosphate adenylyltransferase [Alcanivorax borkumensis
           SK2]
 gi|110646053|emb|CAL15529.1| pantetheine-phosphate adenylyltransferase [Alcanivorax borkumensis
           SK2]
          Length = 186

 Score =  174 bits (440), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 54/163 (33%), Positives = 93/163 (57%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDPITNGH+D++ +A    +++V+ I  +  K   F S+ ER EL +  +
Sbjct: 24  MTNRVIYPGTFDPITNGHLDLVERAAKMFDEVVVGIAASEKKGPLF-SLDERVELTQSVL 82

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V  F  L  +  ++    +++RGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 83  SHLPN-----VRVTGFSKLLAHFCREEGGNILLRGLRAVSDFEYEFQLANMNRKLAPELE 137

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           T+ L   E   +++S+LIR +  +D D+ +FVP  V   L+  
Sbjct: 138 TVFLTPAEHLSFISSSLIREIALLDGDVNNFVPPLVAEALEEK 180


>gi|330505427|ref|YP_004382296.1| phosphopantetheine adenylyltransferase [Pseudomonas mendocina
           NK-01]
 gi|328919713|gb|AEB60544.1| phosphopantetheine adenylyltransferase [Pseudomonas mendocina
           NK-01]
          Length = 160

 Score =  174 bits (440), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 50/163 (30%), Positives = 90/163 (55%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+  +  K   F  +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERAARLFDHVIIAVAASPKKNPLF-PLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V+ F  L  +  K+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VVGFSSLLAHFVKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L   E   +++STL+R + ++  DI+ FV   V   L    
Sbjct: 115 LFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALNARF 157


>gi|28867647|ref|NP_790266.1| pantetheine-phosphate adenylyltransferase [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213967809|ref|ZP_03395956.1| pantetheine-phosphate adenylyltransferase [Pseudomonas syringae pv.
           tomato T1]
 gi|301382446|ref|ZP_07230864.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           tomato Max13]
 gi|302061162|ref|ZP_07252703.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           tomato K40]
 gi|302132045|ref|ZP_07258035.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|31563013|sp|Q88AH3|COAD_PSESM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|28850882|gb|AAO53961.1| pantetheine-phosphate adenylyltransferase [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213927585|gb|EEB61133.1| pantetheine-phosphate adenylyltransferase [Pseudomonas syringae pv.
           tomato T1]
 gi|330874687|gb|EGH08836.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|331014960|gb|EGH95016.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 159

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 91/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+  +  K   F  +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDQVVIAVAASPKKNPLF-PLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DIT FV   V   L      
Sbjct: 115 LFLTPSERYSFISSTLVREIATLGGDITKFVHPAVAQALTERFKR 159


>gi|170719529|ref|YP_001747217.1| phosphopantetheine adenylyltransferase [Pseudomonas putida W619]
 gi|229500857|sp|B1J2E9|COAD_PSEPW RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|169757532|gb|ACA70848.1| pantetheine-phosphate adenylyltransferase [Pseudomonas putida W619]
          Length = 159

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 89/165 (53%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+  +  K   F  +++R  L ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVIIAVAASPKKNPLF-PLEQRVALAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          VI F  L  + AK+  A V +RGLR ++DF+YE ++ ++NR L PE+ +
Sbjct: 60  HLPNVE-----VIGFSTLLAHFAKEQGANVFLRGLRAVSDFEYEFQLANMNRQLAPEVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DIT FV   V   L      
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFVHPVVAEALTERFKK 159


>gi|237802344|ref|ZP_04590805.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331025201|gb|EGI05257.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 159

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 90/165 (54%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+  +  K   F  +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDQVVIAVAASPKKNPLF-PLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V+ F  L  + AK+ +  V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VVGFSTLLAHFAKEQNTNVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DIT FV   V   L      
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFVHPAVAEALTERFKR 159


>gi|120556480|ref|YP_960831.1| phosphopantetheine adenylyltransferase [Marinobacter aquaeolei VT8]
 gi|166216558|sp|A1U6M5|COAD_MARAV RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|120326329|gb|ABM20644.1| Phosphopantetheine adenylyltransferase [Marinobacter aquaeolei VT8]
          Length = 160

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 58/165 (35%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M K +Y G+FDPITNGH D+I +A    +++V+A+  N  K     +++ER EL++++  
Sbjct: 1   MPKVIYPGTFDPITNGHTDLIERAGRMFDEIVVAVAYNPKKQPLL-NLEERCELVRKATA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H    S     V  F  L  +  ++ +A VI+RGLR ++DF+YE ++  +NR L PE+ +
Sbjct: 60  HLPNVS-----VTGFSNLLADFVREQNASVILRGLRAVSDFEYEFQLADMNRRLAPEVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L       Y++STLIR + S+  DI+ FV   V   L+     
Sbjct: 115 VFLTPANHLSYISSTLIREIASLGGDISEFVDPAVTEALQQKFSE 159


>gi|167036162|ref|YP_001671393.1| phosphopantetheine adenylyltransferase [Pseudomonas putida GB-1]
 gi|189082580|sp|B0KN77|COAD_PSEPG RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166862650|gb|ABZ01058.1| pantetheine-phosphate adenylyltransferase [Pseudomonas putida GB-1]
          Length = 159

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 89/165 (53%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+  +  K   F  +++R  L ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVIIAVAASPKKNPLF-PLEQRVALAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          VI F  L  + AK+  A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VIGFSSLLAHFAKEQGANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DIT FV   V   L      
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFVHPVVADALTERFKK 159


>gi|325919644|ref|ZP_08181653.1| Phosphopantetheine adenylyltransferase [Xanthomonas gardneri ATCC
           19865]
 gi|325549892|gb|EGD20737.1| Phosphopantetheine adenylyltransferase [Xanthomonas gardneri ATCC
           19865]
          Length = 168

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 54/160 (33%), Positives = 92/160 (57%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K      ++ R EL ++++  
Sbjct: 7   RTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPAL-PLERRVELAQEALAA 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     V  F+ L  +  +D+ A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 66  HANVE-----VRGFDTLLAHFVRDMGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L   E   +++S+L+R +  +  D++ FVP  V   L+ 
Sbjct: 121 FLTPAEQYSFISSSLVREIARLGGDVSGFVPASVVEALRQ 160


>gi|289665569|ref|ZP_06487150.1| phosphopantetheine adenylyltransferase [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 168

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 92/160 (57%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K     S++ R  L ++++  
Sbjct: 7   RTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPAL-SLERRVALAQEALAA 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     V  F+ L  +  +++ A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 66  HTNVE-----VRGFDTLLAHFVREMGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L   E   +++S+L+R +  +  D++ FVP  V   L+ 
Sbjct: 121 FLTPAEQYSFISSSLVREIARLGGDVSGFVPASVVEALRQ 160


>gi|78048265|ref|YP_364440.1| phosphopantetheine adenylyltransferase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325927068|ref|ZP_08188338.1| Phosphopantetheine adenylyltransferase [Xanthomonas perforans
           91-118]
 gi|123584739|sp|Q3BS23|COAD_XANC5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|78036695|emb|CAJ24386.1| Pantetheine-phosphate adenylyltransferase [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|325542567|gb|EGD14039.1| Phosphopantetheine adenylyltransferase [Xanthomonas perforans
           91-118]
          Length = 168

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 92/160 (57%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K     S++ R  L ++++  
Sbjct: 7   RTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPAL-SLERRVALAQEALAA 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     V  F+ L  +  +++ A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 66  HTNVE-----VRGFDTLLAHFVREMGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L   E   +++S+L+R +  +  D++ FVP  V   L+ 
Sbjct: 121 FLTPAEQYSFISSSLVREIARLGGDVSGFVPASVVEALRQ 160


>gi|171912974|ref|ZP_02928444.1| Phosphopantetheine adenylyltransferase [Verrucomicrobium spinosum
           DSM 4136]
          Length = 171

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 93/165 (56%), Gaps = 4/165 (2%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRK +Y GSFDPITNGH+D++ +A    ++LV+A+  ++ K   F   +  + + + +  
Sbjct: 1   MRKGLYPGSFDPITNGHLDVLRRAARLFDELVVAVARDNQKQSLFTMDERVAMIEETAQA 60

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H        VSV  FEGL V  A    A  ++RGLR ++DF++E +M  +NR L   + T
Sbjct: 61  H----GLANVSVQPFEGLLVEFAAREGACAVIRGLRAVSDFEFEFQMALMNRKLDDRVET 116

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L  +E   Y++S +++ +  +  DI +FVP  V   LK  + +
Sbjct: 117 LFLTPQEELTYISSRIVKEIARLGGDIRAFVPAHVAEALKRKLGN 161


>gi|21243259|ref|NP_642841.1| phosphopantetheine adenylyltransferase [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|294624504|ref|ZP_06703185.1| phosphopantetheine adenylyltransferase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294664782|ref|ZP_06730107.1| phosphopantetheine adenylyltransferase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|29427841|sp|Q8PJK5|COAD_XANAC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|21108793|gb|AAM37377.1| lipopolysaccharide synthesis enzyme [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|292601197|gb|EFF45253.1| phosphopantetheine adenylyltransferase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292605439|gb|EFF48765.1| phosphopantetheine adenylyltransferase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 168

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 92/160 (57%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K     S++ R  L ++++  
Sbjct: 7   RTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPAL-SLERRVALAQEALAA 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     V  F+ L  +  +++ A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 66  HANVE-----VRGFDTLLAHFVREMGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L   E   +++S+L+R +  +  D++ FVP  V   L+ 
Sbjct: 121 FLTPAEQYSFISSSLVREIARLGGDVSGFVPASVVEALRQ 160


>gi|58582131|ref|YP_201147.1| phosphopantetheine adenylyltransferase [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|84624029|ref|YP_451401.1| phosphopantetheine adenylyltransferase [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|166711654|ref|ZP_02242861.1| phosphopantetheine adenylyltransferase [Xanthomonas oryzae pv.
           oryzicola BLS256]
 gi|188576261|ref|YP_001913190.1| phosphopantetheine adenylyltransferase [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|75435246|sp|Q5GZV9|COAD_XANOR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|123521901|sp|Q2P2V0|COAD_XANOM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541054|sp|B2SIL3|COAD_XANOP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|58426725|gb|AAW75762.1| lipopolysaccharide synthesis enzyme [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84367969|dbj|BAE69127.1| lipopolysaccharide synthesis enzyme [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|188520713|gb|ACD58658.1| pantetheine-phosphate adenylyltransferase [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 168

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 91/160 (56%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K     S++ R  L ++++  
Sbjct: 7   RTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPAL-SLERRVALAQEALAA 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     V  F+ L  +  + + A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 66  HANVE-----VRGFDTLLAHFVRQMGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L   E   +++S+L+R +  +  D++ FVP  V   L+ 
Sbjct: 121 FLTPSEQYSFISSSLVREIARLGGDVSGFVPASVVEALRQ 160


>gi|77461569|ref|YP_351076.1| phosphopantetheine adenylyltransferase [Pseudomonas fluorescens
           Pf0-1]
 gi|123602920|sp|Q3K569|COAD_PSEPF RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|77385572|gb|ABA77085.1| phosphopantetheine adenylyltransferase [Pseudomonas fluorescens
           Pf0-1]
          Length = 159

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 51/165 (30%), Positives = 91/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+  +  K   F  +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVIIAVAASPKKNPLF-PLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DI+ FV   V   L      
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDISKFVHPAVADALTLRFKK 159


>gi|308047859|ref|YP_003911425.1| pantetheine-phosphate adenylyltransferase [Ferrimonas balearica DSM
           9799]
 gi|307630049|gb|ADN74351.1| pantetheine-phosphate adenylyltransferase [Ferrimonas balearica DSM
           9799]
          Length = 161

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 51/167 (30%), Positives = 100/167 (59%), Gaps = 6/167 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y G+FDPITNGH+D+I +A    + +++ I  +  K   F ++++R EL+   +
Sbjct: 1   MSQTAIYPGTFDPITNGHLDLIQRASRMFDRVIVGIAASPSKRPLF-TLEQRVELVNAVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V+ F GL  + A++ +A+V++RGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 60  AELGNVE-----VVGFSGLLADFAREQNARVLIRGLRAVSDFEYEFQLANMNRRLNPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           ++ L   E + +++S+L++ +     ++T F+P+ V   LK+ +   
Sbjct: 115 SVFLTPSEENSFISSSLVKEVALHGGNVTEFLPEVVQNALKDALAKR 161


>gi|21231828|ref|NP_637745.1| phosphopantetheine adenylyltransferase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66768046|ref|YP_242808.1| phosphopantetheine adenylyltransferase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|29427840|sp|Q8P857|COAD_XANCP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|81305977|sp|Q4UVY5|COAD_XANC8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|21113543|gb|AAM41669.1| lipopolysaccharide synthesis enzyme [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573378|gb|AAY48788.1| lipopolysaccharide synthesis enzyme [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 168

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 54/160 (33%), Positives = 92/160 (57%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K      ++ R EL ++++  
Sbjct: 7   RTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPAL-PLERRVELAQEALAA 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     V  F+ L  +  +D+ A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 66  HANVE-----VRGFDTLLAHFVRDMGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L   E   +++S+L+R +  +  D++ FVP  V   L+ 
Sbjct: 121 FLTPAEQYSFISSSLVREIARLGGDVSGFVPASVVDALRQ 160


>gi|83952656|ref|ZP_00961386.1| pantetheine-phosphate adenylyltransferase [Roseovarius nubinhibens
           ISM]
 gi|83835791|gb|EAP75090.1| pantetheine-phosphate adenylyltransferase [Roseovarius nubinhibens
           ISM]
          Length = 163

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 60/163 (36%), Positives = 93/163 (57%), Gaps = 1/163 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A   V+ LVI +  N  K   F +++ER ++I++   
Sbjct: 1   MRIGLYPGTFDPITLGHIDIIRRAAVMVDRLVIGVAINRDKGPLF-TLEERVDMIERECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   + V  FE L ++ AKD+ AQVIVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  KLSEQTGAEIIVHPFENLLIDCAKDVGAQVIVRGLRAVADFEYEFQMVGMNRALDDSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L A    + + S L++ +  +  D+  FV  PV   L+  +
Sbjct: 120 VFLMADAGHQAIASKLVKEIARLGGDVRKFVTPPVNAALREKL 162


>gi|146294969|ref|YP_001185393.1| phosphopantetheine adenylyltransferase [Shewanella putrefaciens
           CN-32]
 gi|166216601|sp|A4YCB1|COAD_SHEPC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|145566659|gb|ABP77594.1| pantetheine-phosphate adenylyltransferase [Shewanella putrefaciens
           CN-32]
          Length = 163

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 58/168 (34%), Positives = 97/168 (57%), Gaps = 6/168 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH+D+I +A    + + I I  N  K   F +++ER EL+ +  
Sbjct: 1   MHTRAIYPGTFDPITNGHVDLIERAAKLFKHVTIGIAANPSKQPRF-TLEERVELVNRVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHLDNVD-----VVGFSGLLVDFAKEQKASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           ++ L   E + +++STL++ +     D++ FV   V   L   + S+ 
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPEVAAALAAKLTSIN 162


>gi|330965064|gb|EGH65324.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 159

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 92/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+  +  K   F  +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDQVVIAVAASPKKNPLF-PLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DIT FV   V   L  +   
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFVHPAVAQALTELFKR 159


>gi|192359123|ref|YP_001983956.1| pantetheine-phosphate adenylyltransferase [Cellvibrio japonicus
           Ueda107]
 gi|190685288|gb|ACE82966.1| pantetheine-phosphate adenylyltransferase [Cellvibrio japonicus
           Ueda107]
          Length = 176

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 51/165 (30%), Positives = 100/165 (60%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPITNGH+D++ +A    +++++A+  ++ K   F S+ +R +L ++++ 
Sbjct: 17  MRTVLYPGTFDPITNGHIDLVERACRLFDNVIVAVAASTRKNPLF-SLDQRVQLAQETLS 75

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H    +     V+ F+ L V+  K  +AQ ++RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 76  HLPNVT-----VVGFDILLVDFVKQQNAQAVLRGLRAVSDFEYEFQLANMNRALAPDMES 130

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           I L   E   +++S+++R +  +  D++ FV  PV   L+     
Sbjct: 131 IFLTPAEHLSFISSSIVREIAMLGGDVSKFVAPPVEAALRQRFDR 175


>gi|330957093|gb|EGH57353.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 159

 Score =  172 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 92/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+  +  K   F  +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDQVVIAVAASPKKNPLF-PLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++D DIT FV   V   L      
Sbjct: 115 LFLTPSERYSFISSTLVREIAALDGDITKFVHPAVADALTERFKR 159


>gi|323702701|ref|ZP_08114362.1| pantetheine-phosphate adenylyltransferase [Desulfotomaculum
           nigrificans DSM 574]
 gi|323532364|gb|EGB22242.1| pantetheine-phosphate adenylyltransferase [Desulfotomaculum
           nigrificans DSM 574]
          Length = 162

 Score =  172 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 61/167 (36%), Positives = 94/167 (56%), Gaps = 5/167 (2%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY GSFDPITNGH+DII +A    + L++A+  N  K     +I+ER ++++  + 
Sbjct: 1   MRIGVYPGSFDPITNGHLDIIERATVLFDRLIVAVAINPQKKAPLFTIEERMDMLENILS 60

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +       V V SF+GL VN A    A VIVRG+R +TDF+ E      N+ L PE+ T
Sbjct: 61  KYPN-----VIVDSFDGLTVNYALKQGACVIVRGIRAITDFEGEFVFALTNKKLAPELET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L  K    +++ST+++ + S +  +++ VPD V   LK     + 
Sbjct: 116 VYLMTKAEYSFISSTVVKEVASYNGCLSAMVPDLVAQRLKEKFGYVK 162


>gi|269467805|gb|EEZ79560.1| phosphopantetheine adenylyltransferase [uncultured SUP05 cluster
           bacterium]
          Length = 158

 Score =  172 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 61/162 (37%), Positives = 98/162 (60%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y GSFDPITNGH+D+I +A    + ++I I  NS K   FL+I +R    K ++
Sbjct: 1   MKKVAIYPGSFDPITNGHIDLIRRASKLFDKVIIGITQNSKK-PSFLNIDQRLVAAKTAL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       ++SF  L V+ A   +AQVI+RGLR ++DF+YE +++ +N+ L P I 
Sbjct: 60  KEIDNIE-----ILSFNTLLVDFASAQNAQVILRGLRAVSDFEYEFQLSGMNKHLNPNIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           T+ +   E    ++S+L+R ++S+  DI++FVP  V   LK+
Sbjct: 115 TLFMTPAEQYANISSSLVREILSLGGDISAFVPKSVEKLLKD 156


>gi|319424483|gb|ADV52557.1| pantetheine-phosphate adenylyltransferase [Shewanella putrefaciens
           200]
          Length = 163

 Score =  172 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 58/168 (34%), Positives = 97/168 (57%), Gaps = 6/168 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH+D+I +A    + + I I  N  K   F +++ER EL+ +  
Sbjct: 1   MHTRAIYPGTFDPITNGHVDLIERAAKLFKHVTIGIAANPSKQPRF-TLEERVELVNRIT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHLDNVD-----VVGFSGLLVDFAKEQKASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           ++ L   E + +++STL++ +     D++ FV   V   L   + S+ 
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPEVAAALAAKLTSIN 162


>gi|325915120|ref|ZP_08177446.1| Phosphopantetheine adenylyltransferase [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325538642|gb|EGD10312.1| Phosphopantetheine adenylyltransferase [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 168

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 93/160 (58%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K      +++R  L ++++  
Sbjct: 7   RTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPAL-PLEKRVALAQEALAA 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     V  F+ L  +  +D++A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 66  HTNVE-----VRGFDTLLAHFVRDMNAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L   E   +++S+L+R +  +  D++ FVP  V   L+ 
Sbjct: 121 FLTPAEQYSFISSSLVREIARLGGDVSGFVPASVVEALRQ 160


>gi|260433863|ref|ZP_05787834.1| pantetheine-phosphate adenylyltransferase [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417691|gb|EEX10950.1| pantetheine-phosphate adenylyltransferase [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 163

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 60/163 (36%), Positives = 93/163 (57%), Gaps = 1/163 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A   V+ LVI +  N  K   F S++ER  +I+    
Sbjct: 1   MRVGLYPGTFDPITLGHIDIIRRAAMLVDKLVIGVAINRDKGPLF-SLEERVAMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H    +   +    FE L ++ A+D+ AQ+IVRGLR + DF+YE +M  +NR L   I T
Sbjct: 60  HLTEQTGTEIVAHPFENLLIDCARDVGAQIIVRGLRAVADFEYEFQMVGMNRALDDSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L A+   + + S L++ +  +  D++ FV   V + LK  +
Sbjct: 120 VFLMAEARHQAIASKLVKEIARLGGDVSKFVTPQVNIALKERL 162


>gi|114565076|ref|YP_752590.1| phosphopantetheine adenylyltransferase [Shewanella frigidimarina
           NCIMB 400]
 gi|122298325|sp|Q07W63|COAD_SHEFN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|114336369|gb|ABI73751.1| pantetheine-phosphate adenylyltransferase [Shewanella frigidimarina
           NCIMB 400]
          Length = 168

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 56/168 (33%), Positives = 95/168 (56%), Gaps = 6/168 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R+A+Y G+FDP+TNGH D+I +A    + ++I I  N  K   F S++ER   +    
Sbjct: 1   MHRRAIYPGTFDPVTNGHADLIERAARLFKHVIIGIASNPSKQPRF-SLEERVAQVNLVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AK+  A V++RGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHLKNVE-----VVGFTGLLVDFAKEQHASVLIRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           ++ L   E + +++STL++ +     D++ FV   +   LK  V  + 
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPQIAAALKLKVAQIQ 162


>gi|260892043|ref|YP_003238140.1| pantetheine-phosphate adenylyltransferase [Ammonifex degensii KC4]
 gi|260864184|gb|ACX51290.1| pantetheine-phosphate adenylyltransferase [Ammonifex degensii KC4]
          Length = 166

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 57/168 (33%), Positives = 90/168 (53%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR AVY GSFDPITNGH+DII +A    + L++AI  N  K K   S++ER E++ + + 
Sbjct: 1   MRVAVYPGSFDPITNGHLDIIKRACQLFDTLIVAIAENPQK-KALFSLEERLEMLHEVLK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    V + ++ GL V  A+   A  I+RGLR ++DF+ E  M   N+ L PEI T
Sbjct: 60  DLPK-----VRIDAYRGLTVEYARRQGACAIIRGLRAISDFENEFVMALTNKKLAPEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + L  +    +++S+ ++ +      +   VP PV   L+     + +
Sbjct: 115 LFLMTEAKYSFISSSAVKEVAYYGGCLKDMVPPPVEARLRAKFREIKR 162


>gi|108763591|ref|YP_631582.1| phosphopantetheine adenylyltransferase [Myxococcus xanthus DK 1622]
 gi|108467471|gb|ABF92656.1| pantetheine-phosphate adenylyltransferase [Myxococcus xanthus DK
           1622]
          Length = 160

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 63/167 (37%), Positives = 97/167 (58%), Gaps = 7/167 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGH+ +I ++L   + L++AI  N  KT  F S +ER  LI++++ 
Sbjct: 1   MLVAIYPGSFDPLTNGHLSLIQRSLKMFDRLIVAIAVNPKKTPLF-SEEERLTLIREAVQ 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                   RV V +F GL V+  +  +A VIVRGLR ++DF+YE ++ ++NR L P++ T
Sbjct: 60  DD------RVEVDAFHGLLVDYVRRRNAGVIVRGLRAVSDFEYEFQLANMNRKLAPDVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + +   E   Y++S L+R + S   D+T  VP  V   LK       
Sbjct: 114 VFMMTGEDYFYISSNLVREVASFGGDVTGLVPPNVHEGLKAKFAGRK 160


>gi|70733153|ref|YP_262926.1| phosphopantetheine adenylyltransferase [Pseudomonas fluorescens
           Pf-5]
 gi|229593161|ref|YP_002875280.1| phosphopantetheine adenylyltransferase [Pseudomonas fluorescens
           SBW25]
 gi|312963649|ref|ZP_07778130.1| pantetheine-phosphate adenylyltransferase [Pseudomonas fluorescens
           WH6]
 gi|123652269|sp|Q4K4A7|COAD_PSEF5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|259491322|sp|C3K3N4|COAD_PSEFS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|68347452|gb|AAY95058.1| pantetheine-phosphate adenylyltransferase [Pseudomonas fluorescens
           Pf-5]
 gi|229365027|emb|CAY53190.1| phosphopantetheine adenylyltransferase [Pseudomonas fluorescens
           SBW25]
 gi|311282158|gb|EFQ60758.1| pantetheine-phosphate adenylyltransferase [Pseudomonas fluorescens
           WH6]
          Length = 159

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 91/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+  +  K   F  +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVIIAVAASPKKNPLF-PLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DIT FV   V   L      
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFVHPAVADALTLRFKK 159


>gi|330812392|ref|YP_004356854.1| putative phosphopantetheine adenylyltransferase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327380500|gb|AEA71850.1| putative phosphopantetheine adenylyltransferase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 159

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 91/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+  +  K   F  +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERAARLFDHVIIAVAASPKKNPLF-PLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VVGFSTLLAHFAKEKNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R + ++  DIT FV   V   L      
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFVHPAVADALTLRFKK 159


>gi|327482698|gb|AEA86008.1| phosphopantetheine adenylyltransferase [Pseudomonas stutzeri DSM
           4166]
          Length = 160

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 53/163 (32%), Positives = 92/163 (56%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    ++++IA+  N  K   F  +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITMGHADLVERASRLFDEVIIAVAANPKKNPLF-PLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          VI F  L  +  K+  A +++RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVK-----VIGFSTLLAHFVKEQQANILLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L   E   Y++STL+R + S+  D++ FV   V   LK   
Sbjct: 115 LFLTPSEKYSYISSTLVREIASLQGDVSKFVHPAVMQALKTRF 157


>gi|331007674|ref|ZP_08330810.1| Phosphopantetheine adenylyltransferase [gamma proteobacterium
           IMCC1989]
 gi|330418517|gb|EGG93047.1| Phosphopantetheine adenylyltransferase [gamma proteobacterium
           IMCC1989]
          Length = 159

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 59/165 (35%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+K VY G+FDPITNGH+D++ +A    + +VIA+  +S K   F  +QER +L +  + 
Sbjct: 1   MKKVVYPGTFDPITNGHVDLVERACRLFDHVVIAVADSSSKNPLF-DLQERVDLCRDVLQ 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V  F  L  +  ++  AQ ++RGLR ++DF+YE ++ ++NR L P + +
Sbjct: 60  HLDNVE-----VKGFNVLLAHFVEEQGAQAVIRGLRAVSDFEYEFQLANMNRALLPHMES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           I L   E   Y++S+LIR + S++ D+  FVP  V   LK     
Sbjct: 115 IFLTPAEHLSYLSSSLIREIASLNGDVKQFVPAAVEAALKEKFSR 159


>gi|146284314|ref|YP_001174467.1| phosphopantetheine adenylyltransferase [Pseudomonas stutzeri A1501]
 gi|145572519|gb|ABP81625.1| pantetheine-phosphate adenylyltransferase [Pseudomonas stutzeri
           A1501]
          Length = 203

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 53/163 (32%), Positives = 92/163 (56%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    ++++IA+  N  K   F  +++R EL ++   
Sbjct: 44  MNRVLYPGTFDPITMGHADLVERASRLFDEVIIAVAANPKKNPLF-PLEQRVELAREVTK 102

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          VI F  L  +  K+  A +++RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 103 HLPNVK-----VIGFSTLLAHFVKEQQANILLRGLRAVSDFEYEFQLANMNRQLAPDVES 157

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L   E   Y++STL+R + S+  D++ FV   V   LK   
Sbjct: 158 LFLTPSEKYSYISSTLVREIASLQGDVSKFVHPAVMQALKTRF 200


>gi|307546574|ref|YP_003899053.1| phosphopantetheine adenylyltransferase [Halomonas elongata DSM
           2581]
 gi|307218598|emb|CBV43868.1| phosphopantetheine adenylyltransferase [Halomonas elongata DSM
           2581]
          Length = 159

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 53/163 (32%), Positives = 88/163 (53%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDPITNGH D+I +A    + +V+AI  +  K      I  R  L ++ + 
Sbjct: 1   MNTAVYPGTFDPITNGHYDLIERAARLFDHIVVAIASSPGKAPTL-DIDARIALARKVVE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V+ F GL     +   A++++RGLR ++DF+YE+++ ++NR   PE+ T
Sbjct: 60  QHDNVE-----VVGFSGLLTEFMRQRQARILLRGLRAVSDFEYELQLANMNRAQMPELET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L  +  + Y++STL+R +  +  D++  V   V   LKN  
Sbjct: 115 VFLTPEVENSYISSTLVREIARLGGDVSQHVHPEVAEALKNRY 157


>gi|260427164|ref|ZP_05781143.1| pantetheine-phosphate adenylyltransferase [Citreicella sp. SE45]
 gi|260421656|gb|EEX14907.1| pantetheine-phosphate adenylyltransferase [Citreicella sp. SE45]
          Length = 163

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 57/163 (34%), Positives = 91/163 (55%), Gaps = 1/163 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F  +++R  +I+    
Sbjct: 1   MRIGLYPGTFDPITLGHIDIIRRAAALVDRLVIGVAINRDKGPLF-PLEDRVAMIEAECR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L ++ A D+ AQ+IVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  ELSEQTGTEIVPHPFENLLIDCAHDVGAQIIVRGLRAVADFEYEFQMVGMNRVLDDSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L A+   + + S L++ +  +  D+++FV  PV   LK   
Sbjct: 120 VFLMAEARHQAIASKLVKEIARLGGDVSNFVTPPVHEALKARF 162


>gi|254475347|ref|ZP_05088733.1| pantetheine-phosphate adenylyltransferase [Ruegeria sp. R11]
 gi|214029590|gb|EEB70425.1| pantetheine-phosphate adenylyltransferase [Ruegeria sp. R11]
          Length = 164

 Score =  170 bits (431), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 57/163 (34%), Positives = 92/163 (56%), Gaps = 1/163 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F S++ER  +I+    
Sbjct: 1   MRIGLYPGTFDPITLGHIDIIRRASALVDKLVIGVAINRDKGPLF-SLEERVAMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L ++ A+D+ AQ+IVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  KLSEQTGTEIVAHPFENLLIDCARDVGAQIIVRGLRAVADFEYEFQMVGMNRALDSSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L A+   + + S L++ +  +  D+++FV   V   L   +
Sbjct: 120 VFLMAEARHQAIASKLVKEIARLGGDVSNFVTPLVEEELSKRL 162


>gi|84515565|ref|ZP_01002927.1| pantetheine-phosphate adenylyltransferase [Loktanella vestfoldensis
           SKA53]
 gi|84510848|gb|EAQ07303.1| pantetheine-phosphate adenylyltransferase [Loktanella vestfoldensis
           SKA53]
          Length = 164

 Score =  170 bits (431), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 56/164 (34%), Positives = 89/164 (54%), Gaps = 1/164 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T GH+DI+ +A S V+ LVI +  N  K   F +++ER  +++    
Sbjct: 1   MRVGLYPGTFDPVTLGHLDIVRRAASLVDRLVIGVAINRDKGPMF-TLEERVAMVEAECV 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               D    + V  FE L +  A D+ A VI+RGLR + DF+YE +M  +NR L   I T
Sbjct: 60  PLGRDVGCEIIVHPFENLLITCAHDVGANVIIRGLRAVADFEYEYQMVGMNRILDDSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L A+   + + S L++ +  +  D++ FV   V   L   + 
Sbjct: 120 VFLMAEAEHQAIASKLVKEIARLGGDVSKFVTPAVNDALIARLR 163


>gi|89071162|ref|ZP_01158355.1| pantetheine-phosphate adenylyltransferase [Oceanicola granulosus
           HTCC2516]
 gi|89043288|gb|EAR49513.1| pantetheine-phosphate adenylyltransferase [Oceanicola granulosus
           HTCC2516]
          Length = 164

 Score =  170 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 55/163 (33%), Positives = 89/163 (54%), Gaps = 1/163 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T GH+DII +A   V+ LVI +  N  K   F  ++ R  +I+    
Sbjct: 1   MRIGLYPGTFDPVTLGHLDIIRRACGLVDRLVIGVAINRDKGPAF-DLETRVAMIEAECR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                ++  + V  FE L ++ A D+ AQ+I+RGLR + DF+YE +M  +NR L   + T
Sbjct: 60  ALSEAAATEIVVYPFENLLIDCAHDVGAQLIIRGLRAVADFEYEYQMVGMNRQLDDSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L A+   + + S L++ +  +  D+T FV   V   L+   
Sbjct: 120 VFLMAEAQHQAIASKLVKEIARLGGDVTKFVTPAVAEALRGRY 162


>gi|83954349|ref|ZP_00963069.1| pantetheine-phosphate adenylyltransferase [Sulfitobacter sp.
           NAS-14.1]
 gi|83841386|gb|EAP80556.1| pantetheine-phosphate adenylyltransferase [Sulfitobacter sp.
           NAS-14.1]
          Length = 164

 Score =  170 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 90/165 (54%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F  ++ER   I++   
Sbjct: 1   MRVGLYPGTFDPITLGHIDIIRRAATLVDKLVIGVAINRDKGPLFE-LEERVAQIEEECG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               ++   + V  FE L ++ A D+ AQ+I+RGLR + DF+YE +M  +NR L   + T
Sbjct: 60  KLNQETGTEIVVHPFENLLIDCAHDVGAQMIIRGLRAVADFEYEYQMVGMNRKLDDSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A+   + + S L++ +  +  D++ FV   V   L      
Sbjct: 120 VFLMAEAEHQAIASRLVKEIARLGGDVSKFVTPAVNAELLKRFSQ 164


>gi|330719523|gb|EGG98129.1| Phosphopantetheine adenylyltransferase [gamma proteobacterium
           IMCC2047]
          Length = 161

 Score =  170 bits (430), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 55/162 (33%), Positives = 88/162 (54%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y G+FDPITNGH D++ +A    + +++AI  N+ K             ++ ++
Sbjct: 1   MKRTAIYPGTFDPITNGHTDLVERAARLFDHVIVAIAANTKKGPMLD------LDVRIAL 54

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +      V V  F  L    A+   A +I+RGLR ++DF+YE ++ ++NR   P+I 
Sbjct: 55  ASKVLGHLENVEVCGFACLLTKFAEKRGANIIIRGLRAVSDFEYEFQLANMNRAQSPDIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           +I L   E   +V+STLIR + S+D D++ FV   V   LK 
Sbjct: 115 SIFLTPSEQYSFVSSTLIREIASLDGDVSKFVHPAVNDALKK 156


>gi|110680184|ref|YP_683191.1| phosphopantetheine adenylyltransferase [Roseobacter denitrificans
           OCh 114]
 gi|123361772|sp|Q164T8|COAD_ROSDO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|109456300|gb|ABG32505.1| pantetheine-phosphate adenylyltransferase [Roseobacter
           denitrificans OCh 114]
          Length = 166

 Score =  170 bits (430), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 57/165 (34%), Positives = 89/165 (53%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + ++ LVI +  N  K   F  ++ER  +++    
Sbjct: 1   MRVGLYPGTFDPITLGHLDIIRRASALLDKLVIGVAINRDKGPLFC-LEERVAMVEAESI 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L ++ A+D+ A VIVRGLR + DF+YE +M  +NR L   I T
Sbjct: 60  KIAAMTGLEIVTHPFENLLIDCARDVGATVIVRGLRAVADFEYEYQMVGMNRQLDDTIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A+   + + S L++ +  +  DI  FV   V   L N +  
Sbjct: 120 VFLMAEAEHQAIASKLVKEIARLGGDIEKFVTPEVNAALLNKIGR 164


>gi|89054407|ref|YP_509858.1| phosphopantetheine adenylyltransferase [Jannaschia sp. CCS1]
 gi|88863956|gb|ABD54833.1| Coenzyme A biosynthesis protein [Jannaschia sp. CCS1]
          Length = 165

 Score =  170 bits (430), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 55/166 (33%), Positives = 88/166 (53%), Gaps = 1/166 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R  +Y G+FDPIT GH+D+I +A   V+ LVI +  N  K   F +++ER   ++   
Sbjct: 1   MTRTGLYPGTFDPITLGHVDVIKRACKLVDRLVIGVAINRDKGPLF-TLEERVAQVEHEC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     +    FE L ++ A+D+ AQ I+RGLR + DF+YE +M  +NR L   I 
Sbjct: 60  AKMTDAFGTEIIAHPFENLLIDCARDVGAQTIIRGLRAVADFEYEFQMVGMNRKLDDSIT 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+ L A+   + + S L++ +  +  D++SFV   V   L+     
Sbjct: 120 TVFLMAEAEHQAIASKLVKEIARLGGDVSSFVTPSVNTALREKYPR 165


>gi|90023239|ref|YP_529066.1| CheW protein [Saccharophagus degradans 2-40]
 gi|89952839|gb|ABD82854.1| CheW protein [Saccharophagus degradans 2-40]
          Length = 181

 Score =  170 bits (430), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 58/175 (33%), Positives = 96/175 (54%), Gaps = 8/175 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++ VY G+FDPITNGH+D++ +A    + +V+AI  +  K   F   +      + ++ 
Sbjct: 13  MKRVVYPGTFDPITNGHIDLVERAAHLFDYVVVAIAESRKKNPLFTMSE------RVALT 66

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +      + V  F+ L  +L ++  A  +VRGLR ++DF+YE ++ ++NR L P + +
Sbjct: 67  EDVLSHLPNIEVCGFDCLLKDLVEEKQAYGVVRGLRAVSDFEYEFQLANMNRALAPAMES 126

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL--VKYDSIK 174
           + L   E   Y++STL+R + S+  D+T FVP  V   L    ISL  VK D   
Sbjct: 127 LFLTPAEHLSYISSTLVREIASLGGDVTKFVPKQVKEALDQKYISLGIVKTDKES 181


>gi|83943214|ref|ZP_00955674.1| pantetheine-phosphate adenylyltransferase [Sulfitobacter sp. EE-36]
 gi|83846222|gb|EAP84099.1| pantetheine-phosphate adenylyltransferase [Sulfitobacter sp. EE-36]
          Length = 164

 Score =  170 bits (430), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 90/165 (54%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F  ++ER   I++   
Sbjct: 1   MRVGLYPGTFDPITLGHIDIIRRAATLVDKLVIGVAINRDKGPLFE-LEERVAQIEEECR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               ++   + V  FE L ++ A D+ AQ+I+RGLR + DF+YE +M  +NR L   + T
Sbjct: 60  KLNQETGTEIVVHPFENLLIDCAHDVGAQMIIRGLRAVADFEYEYQMVGMNRKLDDSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A+   + + S L++ +  +  D++ FV   V   L      
Sbjct: 120 VFLMAEAEHQAIASRLVKEIARLGGDVSKFVTPAVNAELLKRFSQ 164


>gi|117922522|ref|YP_871714.1| phosphopantetheine adenylyltransferase [Shewanella sp. ANA-3]
 gi|166216602|sp|A0L2N9|COAD_SHESA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|117614854|gb|ABK50308.1| pantetheine-phosphate adenylyltransferase [Shewanella sp. ANA-3]
          Length = 163

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 57/164 (34%), Positives = 95/164 (57%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH D+I +A    + ++I I  N  K   F +++ER EL+ +  
Sbjct: 1   MHTRAIYPGTFDPITNGHADLIERAAKLFKHVIIGIAANPSKQPRF-TLEERVELVNRVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHLDNVE-----VVGFSGLLVDFAKEQRASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           ++ L   E + +++STL++ +     D++ FV   V   L   +
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPEVASALTAKL 158


>gi|294677104|ref|YP_003577719.1| pantetheine-phosphate adenylyltransferase [Rhodobacter capsulatus
           SB 1003]
 gi|294475924|gb|ADE85312.1| pantetheine-phosphate adenylyltransferase [Rhodobacter capsulatus
           SB 1003]
          Length = 164

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 59/165 (35%), Positives = 91/165 (55%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T GH+DII +AL+ V+ LVI +  N  K   F S++ER E++K    
Sbjct: 1   MRIGLYPGTFDPVTLGHIDIIERALALVDRLVIGVAINRDKGPLF-SLEERVEMLKAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    + V  FE L ++ A+D+ A VIVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  PITARRGGEIVVHPFENLLIDCARDVGAGVIVRGLRAVADFEYEFQMVGMNRALDASVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A    + + S L++ +  +  D++ FV   V   L   +  
Sbjct: 120 VFLMADARRQAIASKLVKEIARLGGDVSKFVTPTVAERLAARLSR 164


>gi|296133585|ref|YP_003640832.1| pantetheine-phosphate adenylyltransferase [Thermincola sp. JR]
 gi|296032163|gb|ADG82931.1| pantetheine-phosphate adenylyltransferase [Thermincola potens JR]
          Length = 159

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 91/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y GSFDPIT GHMDII +A  F + +++A+  NS K   F +I+ER +++   + 
Sbjct: 1   MKIGIYPGSFDPITYGHMDIIERASRFFDKVIVAVSKNSRKQPLF-TIEERVDMLNTVLH 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +         V SF GL V+ A+   A  I+RGLR ++DF+ E +M   N+ L P I T
Sbjct: 60  GYANVE-----VDSFYGLTVDYAERKGAHAIIRGLRAISDFENEFQMALTNKKLKPGIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L  + +  +++S+++R L +    +  FVP  V   L+     
Sbjct: 115 VFLMTQPNFSFLSSSVVRELAAYGGCVRDFVPPFVEKRLREKFTR 159


>gi|113972215|ref|YP_736008.1| phosphopantetheine adenylyltransferase [Shewanella sp. MR-4]
 gi|114049467|ref|YP_740017.1| phosphopantetheine adenylyltransferase [Shewanella sp. MR-7]
 gi|123129979|sp|Q0HDB6|COAD_SHESM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|123130914|sp|Q0HPJ5|COAD_SHESR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|113886899|gb|ABI40951.1| pantetheine-phosphate adenylyltransferase [Shewanella sp. MR-4]
 gi|113890909|gb|ABI44960.1| pantetheine-phosphate adenylyltransferase [Shewanella sp. MR-7]
          Length = 163

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 57/164 (34%), Positives = 95/164 (57%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH D+I +A    + ++I I  N  K   F +++ER EL+ +  
Sbjct: 1   MHTRAIYPGTFDPITNGHADLIERAAKLFKHVIIGIAANPSKQPRF-TLEERVELVNRVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHLDNVE-----VVGFSGLLVDFAKEQRASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           ++ L   E + +++STL++ +     D++ FV   V   L   +
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPEVASALAAKL 158


>gi|127514620|ref|YP_001095817.1| phosphopantetheine adenylyltransferase [Shewanella loihica PV-4]
 gi|166216600|sp|A3QJB0|COAD_SHELP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|126639915|gb|ABO25558.1| pantetheine-phosphate adenylyltransferase [Shewanella loihica PV-4]
          Length = 158

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 58/163 (35%), Positives = 97/163 (59%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH D+I +A    + +VI I  N  K   F S++ER +L+K+  
Sbjct: 1   MHTKAIYPGTFDPVTNGHTDLIERAAKLFKQVVIGIAANPSKQPRF-SLEERVKLVKRVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AK+ +A V+VRGLR ++DF+YE ++ ++NR L  ++ 
Sbjct: 60  EHLDNVE-----VVGFSGLLVDFAKEQNASVLVRGLRAVSDFEYEFQLANMNRRLSADLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           ++ L   E + +++STL++ +     D++ FV + V   L+  
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHEEVAKALQKK 157


>gi|285018710|ref|YP_003376421.1| phosphopantetheine adenylyltransferase (pantetheine-phosphate
           adenylyltransferase) (ppat) (dephospho-CoA
           pyrophosphorylase) protein [Xanthomonas albilineans GPE
           PC73]
 gi|76150322|emb|CAJ01857.1| hypothetical protein [Xanthomonas albilineans]
 gi|283473928|emb|CBA16429.1| putative phosphopantetheine adenylyltransferase
           (pantetheine-phosphate adenylyltransferase) (ppat)
           (dephospho-coa pyrophosphorylase) protein [Xanthomonas
           albilineans]
          Length = 168

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 53/158 (33%), Positives = 90/158 (56%), Gaps = 6/158 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K     S++ R  L ++++  
Sbjct: 7   RIAVYPGTFDPITNGHIDLVNRAAPLFEQVVVGVAQSPSKGPTL-SLELRVALAREALAG 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     VI F+ L  +  + +   V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 66  HRNVE-----VIGFDTLLAHFVRSVGGGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
            L   E   +++S+L+R +  +  D++ FVP  V   L
Sbjct: 121 FLTPAEQHSFISSSLVREIARLGGDVSGFVPPSVLQAL 158


>gi|86138811|ref|ZP_01057383.1| pantetheine-phosphate adenylyltransferase [Roseobacter sp. MED193]
 gi|85824458|gb|EAQ44661.1| pantetheine-phosphate adenylyltransferase [Roseobacter sp. MED193]
          Length = 165

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 61/165 (36%), Positives = 94/165 (56%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F S++ER  +I+    
Sbjct: 1   MRIGLYPGTFDPITLGHIDIIRRASALVDKLVIGVAINRDKGPMF-SLEERVAMIEVECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   + V  FE L +N A D+ AQ+IVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  KLTEQTGTEIVVHPFENLLINCAHDVGAQIIVRGLRAVADFEYEYQMVGMNRVLDSSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A+   + + S L++ +  +D D++SFV   V   L+  +  
Sbjct: 120 VFLMAEARHQAIASKLVKEIARLDGDVSSFVTPRVLEELRKRLGK 164


>gi|194365328|ref|YP_002027938.1| phosphopantetheine adenylyltransferase [Stenotrophomonas
           maltophilia R551-3]
 gi|254523528|ref|ZP_05135583.1| pantetheine-phosphate adenylyltransferase [Stenotrophomonas sp.
           SKA14]
 gi|229541063|sp|B4SS16|COAD_STRM5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|194348132|gb|ACF51255.1| pantetheine-phosphate adenylyltransferase [Stenotrophomonas
           maltophilia R551-3]
 gi|219721119|gb|EED39644.1| pantetheine-phosphate adenylyltransferase [Stenotrophomonas sp.
           SKA14]
          Length = 169

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 92/160 (57%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K      +++R +L + ++ H
Sbjct: 7   RIAVYPGTFDPITNGHIDLVSRAAPLFEKVVVGVAQSPSKGPAL-PLEQRVQLARGALGH 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     VI F+ L  +  + +   V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 66  HSNVE-----VIGFDTLLAHFVRSVQGGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L   E   +++S+L+R +  +  D++ FVP  V   L+ 
Sbjct: 121 FLTPAEQHSFISSSLVREIARLGGDVSGFVPAAVLEALRK 160


>gi|332037894|gb|EGI74343.1| phosphopantetheine adenylyltransferase [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 163

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 54/164 (32%), Positives = 96/164 (58%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+Y G+FDP+TNGH D+I +A    + +++A+  N  K   F +++ER EL    +
Sbjct: 1   MKVIAIYPGTFDPLTNGHTDLIQRAAKMFDTVLVAVANNPSKKPCF-NLEERVELANSIL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          VI F GL  +LA+  +A V++RG+R ++DFDYE ++ ++NR L P++ 
Sbjct: 60  SHLDNVK-----VIGFSGLLADLARVHNANVLIRGIRAVSDFDYEFQLANMNRRLNPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           ++ L   E + +++STL++ +   + D++ FV   +   LK  +
Sbjct: 115 SVFLTPAERNSFISSTLVKEVARHNGDVSEFVDPVIVKALKTKL 158


>gi|190573791|ref|YP_001971636.1| phosphopantetheine adenylyltransferase [Stenotrophomonas
           maltophilia K279a]
 gi|229541064|sp|B2FLW4|COAD_STRMK RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|190011713|emb|CAQ45332.1| putative phosphopantetheine adenylyltransferase [Stenotrophomonas
           maltophilia K279a]
          Length = 169

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 92/160 (57%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K      +++R +L + ++ H
Sbjct: 7   RIAVYPGTFDPITNGHIDLVSRAAPLFEKVVVGVAQSPSKGPAL-PLEQRVQLARGALGH 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     VI F+ L  +  + +   V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 66  HGNVE-----VIGFDTLLAHFVRSVQGGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L   E   +++S+L+R +  +  D++ FVP  V   L+ 
Sbjct: 121 FLTPAEQHSFISSSLVREIARLGGDVSGFVPAAVLEALRK 160


>gi|295399694|ref|ZP_06809675.1| pantetheine-phosphate adenylyltransferase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312111787|ref|YP_003990103.1| pantetheine-phosphate adenylyltransferase [Geobacillus sp. Y4.1MC1]
 gi|294978097|gb|EFG53694.1| pantetheine-phosphate adenylyltransferase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311216888|gb|ADP75492.1| pantetheine-phosphate adenylyltransferase [Geobacillus sp. Y4.1MC1]
          Length = 176

 Score =  169 bits (428), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 59/168 (35%), Positives = 94/168 (55%), Gaps = 6/168 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDP+T GH+DII +     + + +A+  NS K   F S++ER EL+++  
Sbjct: 1   MASIAVCPGSFDPVTYGHLDIIRRGAKVFDRVYVAVLNNSSKKPLF-SVEERIELLREVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F       V V SF GL V+ A+  +A  I+RGLR ++DF+YEM++TS+NR L   I 
Sbjct: 60  RPFPN-----VFVESFHGLLVDYARSKNANAILRGLRAVSDFEYEMQITSMNRVLDENIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           T  +       +++S++++ +   + +I+  VP  V   L+    SL 
Sbjct: 115 TFFMMTNSQYAFLSSSIVKEVAKYNGNISDLVPPVVEEALRKKFASLA 162


>gi|229918536|ref|YP_002887182.1| phosphopantetheine adenylyltransferase [Exiguobacterium sp. AT1b]
 gi|259491313|sp|C4L5T1|COAD_EXISA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229469965|gb|ACQ71737.1| pantetheine-phosphate adenylyltransferase [Exiguobacterium sp.
           AT1b]
          Length = 164

 Score =  169 bits (428), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+  GSFDPITNGH+DII +A +  +++++A+  NS K   F  ++ER  LI+   
Sbjct: 1   MKRIAICPGSFDPITNGHLDIIERAAAIFDEVIVAVLENSSKAPLF-DVEERLGLIRDVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H    S++      F GL V  A +  A  IVRGLR ++DF+YE+++ S+N+ L   + 
Sbjct: 60  THLPNVSADA-----FGGLLVEYAAEREAATIVRGLRAVSDFEYELQIASINKKLNENVE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T+ +       +++S++++ +    A ++  VP+ V + L+    
Sbjct: 115 TLFMMTNSQYSFLSSSIVKEVAKYGASVSELVPEQVEIALRKKYQ 159


>gi|117620670|ref|YP_854699.1| phosphopantetheine adenylyltransferase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|166216052|sp|A0KEN4|COAD_AERHH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|117562077|gb|ABK39025.1| pantetheine-phosphate adenylyltransferase [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 160

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 54/163 (33%), Positives = 92/163 (56%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  K +Y G+FDP+TNGH D+I +A    +++V+ +  +  K   F  + ER +L +Q  
Sbjct: 1   MTNKVIYPGTFDPVTNGHTDLIGRAAKLFDEVVVGVANSPSKRPLF-DLDERVQLARQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ A++  A V++RGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 60  AHLPNVK-----VVGFSGLLVDFAREQQANVLIRGLRAVSDFEYEFQLANMNRRLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           ++ L   E + +++STL++ +     DI  FV   V   +K  
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDIRQFVDPAVAAAIKAK 157


>gi|169830817|ref|YP_001716799.1| pantetheine-phosphate adenylyltransferase [Candidatus Desulforudis
           audaxviator MP104C]
 gi|229488137|sp|B1I2E4|COAD_DESAP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|169637661|gb|ACA59167.1| pantetheine-phosphate adenylyltransferase [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 163

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 55/163 (33%), Positives = 92/163 (56%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDPITNGH+D+I +A    + +V+A+  +S K   F SI+ER ++++  + 
Sbjct: 1   MKIAVYPGSFDPITNGHLDVIQRAAQVFDQVVVAVAHSSTKEPLF-SIEERLDMLRVVLQ 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    V V ++ GL V  A++  A+ ++RGLR ++DF+YE  M   N+ L PEI T
Sbjct: 60  KLPN-----VRVDAYRGLTVRYAREQGARALIRGLRAVSDFEYEFTMALTNKKLAPEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L  +    +++S  ++ +      +   VP PV   L++  
Sbjct: 115 VFLMTEAKYSFISSGSVKEVARYGGCLEDMVPVPVERILRDKF 157


>gi|126732616|ref|ZP_01748413.1| pantetheine-phosphate adenylyltransferase [Sagittula stellata E-37]
 gi|126706900|gb|EBA05969.1| pantetheine-phosphate adenylyltransferase [Sagittula stellata E-37]
          Length = 163

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 56/164 (34%), Positives = 92/164 (56%), Gaps = 1/164 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +  + V+ LVI +  N  K   F +++ER  +++    
Sbjct: 1   MRTGLYPGTFDPITLGHIDIIRRGATLVDRLVIGVAINRDKGPLF-TLEERVAMVEAECI 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               ++   + V  FE L ++ A+D+ A VIVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  DIARETGCEILVHPFENLLIDCARDVGASVIVRGLRAVADFEYEYQMVGMNRTLDDSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L A+   + + S L++ +  +  D++ FV  PV   L+    
Sbjct: 120 VFLMAEARHQAIASKLVKEIARLGGDVSKFVTPPVRDALEARFD 163


>gi|163736597|ref|ZP_02144016.1| Coenzyme A biosynthesis protein [Phaeobacter gallaeciensis BS107]
 gi|163742757|ref|ZP_02150142.1| pantetheine-phosphate adenylyltransferase [Phaeobacter
           gallaeciensis 2.10]
 gi|161384012|gb|EDQ08396.1| pantetheine-phosphate adenylyltransferase [Phaeobacter
           gallaeciensis 2.10]
 gi|161390467|gb|EDQ14817.1| Coenzyme A biosynthesis protein [Phaeobacter gallaeciensis BS107]
          Length = 164

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 57/165 (34%), Positives = 92/165 (55%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F S++ER  +I+    
Sbjct: 1   MRIGLYPGTFDPITLGHIDIIRRASALVDKLVIGVAINRDKGPLF-SLEERVAMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L ++ A+D+ AQ+IVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  KLSEQTGTEIVAHPFENLLIDCARDVGAQIIVRGLRAVADFEYEFQMVGMNRALDSSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A+   + + S L++ +  +  D++ FV   V   L+  +  
Sbjct: 120 VFLMAEARHQAIASKLVKEIARLGGDVSKFVTPLVESELRRQLAK 164


>gi|271498732|ref|YP_003331757.1| pantetheine-phosphate adenylyltransferase [Dickeya dadantii Ech586]
 gi|270342287|gb|ACZ75052.1| pantetheine-phosphate adenylyltransferase [Dickeya dadantii Ech586]
          Length = 159

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 50/165 (30%), Positives = 93/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDP+TNGH+D++ +A S  + L++AI  +  K   F +++ER  L K++ 
Sbjct: 1   MKTRAIYPGTFDPMTNGHLDLLTRATSMFDHLILAIASSPSKNTLF-TLEERVALAKEAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V  F  L    A+   A ++VRGLR ++DF+YE+++  +N  L P + 
Sbjct: 60  RHLPNVE-----VEGFTDLMATFARQRKATILVRGLRAVSDFEYELQLAKMNHHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E   +++S+L++ +     D++ F+P P+   L+  + 
Sbjct: 115 SVFLMPSEQWSFISSSLVKEVARHGGDVSHFLPPPIAAALQEKLA 159


>gi|114766364|ref|ZP_01445346.1| pantetheine-phosphate adenylyltransferase [Pelagibaca bermudensis
           HTCC2601]
 gi|114541397|gb|EAU44444.1| pantetheine-phosphate adenylyltransferase [Roseovarius sp.
           HTCC2601]
          Length = 165

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 56/164 (34%), Positives = 89/164 (54%), Gaps = 1/164 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F  ++ R  +I+    
Sbjct: 1   MRIGLYPGTFDPITLGHIDIIRRAAALVDRLVIGVAINRDKGPLF-DLETRVAMIESECR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               ++   +    FE L ++ A D+ AQ+IVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  ALSEETGTEIVAHPFENLLIDCAHDVGAQIIVRGLRAVADFEYEFQMVGMNRSLDDSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L A+   + + S L++ +  +  D++ FV  PV   L     
Sbjct: 120 VFLMAEARHQAIASKLVKEIARLGGDVSKFVTPPVHEALVKRFD 163


>gi|167622076|ref|YP_001672370.1| phosphopantetheine adenylyltransferase [Shewanella halifaxensis
           HAW-EB4]
 gi|189082589|sp|B0TMZ9|COAD_SHEHH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|167352098|gb|ABZ74711.1| pantetheine-phosphate adenylyltransferase [Shewanella halifaxensis
           HAW-EB4]
          Length = 159

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 58/163 (35%), Positives = 96/163 (58%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDP+TNGH D+I +A +  E ++I I  N  K   F ++ ER EL+K   
Sbjct: 1   MHKRAIYPGTFDPVTNGHADLIERAANLFEHVIIGIAANPSKQPRF-TLAERVELLKTVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AK+ +A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHLDNVE-----VVGFSGLLVDFAKEQNASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           ++ L   E + +++STL++ +     D++ FV   V   L   
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHAEVANALTKK 157


>gi|163748881|ref|ZP_02156133.1| phosphopantetheine adenylyltransferase [Shewanella benthica KT99]
 gi|161331655|gb|EDQ02460.1| phosphopantetheine adenylyltransferase [Shewanella benthica KT99]
          Length = 159

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 60/163 (36%), Positives = 94/163 (57%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH D+I +A    + +VI I  N  K   F S+++R ELIK   
Sbjct: 1   MHTKAIYPGTFDPVTNGHTDLIERAARLFKHVVIGIAANPSKQPLF-SLEQRVELIKLVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHLDNVE-----VVGFTGLLVDFAKEQQASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           ++ L   E + +++STL++ +     D++ FV   V   L   
Sbjct: 115 SVFLTPAEENSFISSTLVKEVAHHGGDVSQFVHPAVSKALLKK 157


>gi|293374735|ref|ZP_06621043.1| pantetheine-phosphate adenylyltransferase [Turicibacter sanguinis
           PC909]
 gi|292646649|gb|EFF64651.1| pantetheine-phosphate adenylyltransferase [Turicibacter sanguinis
           PC909]
          Length = 161

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 93/166 (56%), Gaps = 5/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +  +Y G+FDP+TNGH+DII +     + L IA+  N  K   F +++ER +++K++ 
Sbjct: 1   MKKIGIYPGTFDPVTNGHLDIIGRGYELFDYLYIAVAENINKKTLF-TVEERVDMLKKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+  + L V+ A  + A+ I+RGLR +TDF+YE ++ + N+ L P I 
Sbjct: 60  KHL----ERVEVVVCADALVVDFANQLGAKTILRGLRAVTDFEYEFQIATTNKRLQPNIE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+ L  +  + +++S+  + +     D++SFVP+ V   LK     
Sbjct: 116 TVFLMTRAENMFLSSSTTKEVARFGGDVSSFVPEFVQEALKKKFNK 161


>gi|254784498|ref|YP_003071926.1| pantetheine-phosphate adenylyltransferase [Teredinibacter turnerae
           T7901]
 gi|259491324|sp|C5BLM4|COAD_TERTT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|237686408|gb|ACR13672.1| pantetheine-phosphate adenylyltransferase [Teredinibacter turnerae
           T7901]
          Length = 162

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 54/167 (32%), Positives = 98/167 (58%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++ VY G+FDPITNGH+D++ +A    + +VIA+  ++ K   F +++ER  L ++++ 
Sbjct: 1   MKRVVYPGTFDPITNGHIDLVQRASKLFDSVVIAVAASNRKGPLF-TLEERVSLAQKALS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V  F+ L  +L ++  A  +VRGLR ++DF+YE ++ ++NR L P + +
Sbjct: 60  HLSNIE-----VCGFDCLLKDLVEEKQAYGVVRGLRAVSDFEYEFQLANMNRALAPSMES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L   E   Y++S+L++ + S+  D++ FVP  V   L +    L 
Sbjct: 115 LFLTPAEHLSYISSSLVKEIASLGGDVSKFVPKLVQSALTDKYNELK 161


>gi|187927352|ref|YP_001897839.1| phosphopantetheine adenylyltransferase [Ralstonia pickettii 12J]
 gi|241661891|ref|YP_002980251.1| phosphopantetheine adenylyltransferase [Ralstonia pickettii 12D]
 gi|309779947|ref|ZP_07674701.1| pantetheine-phosphate adenylyltransferase [Ralstonia sp. 5_7_47FAA]
 gi|229500858|sp|B2UER1|COAD_RALPJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|187724242|gb|ACD25407.1| pantetheine-phosphate adenylyltransferase [Ralstonia pickettii 12J]
 gi|240863918|gb|ACS61579.1| pantetheine-phosphate adenylyltransferase [Ralstonia pickettii 12D]
 gi|308921306|gb|EFP66949.1| pantetheine-phosphate adenylyltransferase [Ralstonia sp. 5_7_47FAA]
          Length = 167

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 52/162 (32%), Positives = 92/162 (56%), Gaps = 6/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP T GH D++ +A +  ++L++ +  +  K   F  ++ER E+ ++ + 
Sbjct: 1   MVIAVYPGTFDPFTRGHEDLVRRASNIFDELIVGVAQSPNKRPFFA-LEERIEIAREVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+       V V  F GL  +  +   A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPN-----VRVEGFSGLLKDFVRKNGARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           + L   +  ++++ T +R +  +  D++ FV   V  +LK  
Sbjct: 115 MFLTPSDQYQFISGTFVREIAVLGGDVSKFVFPSVEKWLKEK 156


>gi|289578490|ref|YP_003477117.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           italicus Ab9]
 gi|297544766|ref|YP_003677068.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
 gi|289528203|gb|ADD02555.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           italicus Ab9]
 gi|296842541|gb|ADH61057.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
          Length = 159

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 92/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+T GH+DII +  +  + L++A+  N  K   F S++ER EL+K   +
Sbjct: 1   MKTAIYPGSFDPVTYGHIDIIKRGANLFDKLIVAVLLNPSKKPLF-SVEERIELLKAVTY 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      +  F+GL V  AK ++A  I++GLR ++DF+YE +M  +N+ L P + T
Sbjct: 60  DIPNVE-----IDYFDGLLVEYAKRVNANAIIKGLRMVSDFEYEFQMALINKKLNPSVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L       Y++S++++ +      ++ FVP+ V   LK     
Sbjct: 115 VFLMTSAKYGYLSSSVVKEIAQFGGCLSEFVPEIVAQKLKEKFSR 159


>gi|261823578|ref|YP_003261684.1| phosphopantetheine adenylyltransferase [Pectobacterium wasabiae
           WPP163]
 gi|261607591|gb|ACX90077.1| pantetheine-phosphate adenylyltransferase [Pectobacterium wasabiae
           WPP163]
          Length = 163

 Score =  168 bits (426), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 50/165 (30%), Positives = 91/165 (55%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+D++ +A    + +V+AI  +  K   F ++ ER  L K + 
Sbjct: 1   MTTKAIYPGTFDPLTNGHLDLLTRASRLFDHVVLAIAASPSKHTLF-TLDERVALAKGAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  + A+   A ++VRGLR + DF+YE+++  +N  L P + 
Sbjct: 60  QHLSNVE-----VVGFSDLMAHFAQQQKANILVRGLRAVADFEYELQLAKMNHHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E   +++S+L++ +     D++ F+PD +   L+  + 
Sbjct: 115 SVFLMPSEEWSFISSSLVKEVARHGGDVSHFLPDAIVSALEEKLK 159


>gi|30248971|ref|NP_841041.1| coenzyme A biosynthesis protein:cytidylyltransferase [Nitrosomonas
           europaea ATCC 19718]
 gi|61212746|sp|Q820N3|COAD_NITEU RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|30138588|emb|CAD84879.1| Coenzyme A biosynthesis protein:Cytidylyltransferase [Nitrosomonas
           europaea ATCC 19718]
          Length = 159

 Score =  168 bits (426), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 55/162 (33%), Positives = 89/162 (54%), Gaps = 6/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M K +Y G+FDPIT GH D+I +A    + +V+A+  NS K+  F S++ER E+ +  + 
Sbjct: 1   MDKVIYPGTFDPITRGHEDLIQRASRLFDQVVVAVAANSGKSPCF-SLEERVEMARAVLA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +         V  F GL +   +   A VIVRGLR ++DF+YE ++  +NR L P++ T
Sbjct: 60  EYANVE-----VTGFSGLLMEFTRQQQAHVIVRGLRAVSDFEYEFQLAGMNRSLYPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           I L   E   ++++T++R +  +  D + FV   V   L   
Sbjct: 115 IFLTPSEQYMFISATIVREIARLGGDASKFVHPLVAERLYEK 156


>gi|120596893|ref|YP_961467.1| phosphopantetheine adenylyltransferase [Shewanella sp. W3-18-1]
 gi|166216603|sp|A1RE18|COAD_SHESW RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|120556986|gb|ABM22913.1| pantetheine-phosphate adenylyltransferase [Shewanella sp. W3-18-1]
          Length = 163

 Score =  168 bits (426), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 57/165 (34%), Positives = 95/165 (57%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH+D+I +A    + + I I  N  K   F +++ER EL+ +  
Sbjct: 1   MHTRAIYPGTFDPITNGHVDLIERAAKLFKHVTIGIAANPSKQPRF-TLEERVELVNRVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHLDNVE-----VVGFSGLLVDFAKEQKASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E + +++STL++ +     D++ FV   V   L   + 
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPEVTAALAAKLK 159


>gi|307609351|emb|CBW98837.1| hypothetical protein LPW_06271 [Legionella pneumophila 130b]
          Length = 163

 Score =  168 bits (426), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 58/163 (35%), Positives = 99/163 (60%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KA+Y G+FDP+TNGH+DII +A +   +L++A+  N  K     S + R  L+++S+
Sbjct: 1   MKQKAIYPGTFDPVTNGHIDIITRASTIFPELIVAVASNKNKRPYL-SWESRISLLEESV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F+ L ++   + +A +I+RGLR ++DF+YE ++  +NR L  ++ 
Sbjct: 60  GHLT-----GVRVVGFDNLLIDFVLEQNAGIILRGLRAVSDFEYEFQLAGMNRKLSKKVE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           T+ L   E   Y++STL+R + +++ DI+ FVP  V   LK  
Sbjct: 115 TLFLTPAEHLMYISSTLVREIAALNGDISQFVPPNVVRELKKR 157


>gi|149201937|ref|ZP_01878911.1| Coenzyme A biosynthesis protein [Roseovarius sp. TM1035]
 gi|149144985|gb|EDM33014.1| Coenzyme A biosynthesis protein [Roseovarius sp. TM1035]
          Length = 163

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 61/164 (37%), Positives = 90/164 (54%), Gaps = 1/164 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A   V+ LV+ +  N  K   F S++ER E+I+    
Sbjct: 1   MRIGLYPGTFDPITLGHIDIIRRAAVLVDRLVLGVAINRDKGPLF-SLEERVEMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L +N A D+ AQVIVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  KLSAQTGTEIVAHPFENLLINCAHDVGAQVIVRGLRAVADFEYEFQMVGMNRALDNSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L A  + + + S L++ +  +  D+T FV  PV   L     
Sbjct: 120 VFLMADANHQAIASKLVKEIARLGGDVTKFVTPPVREALLAKFS 163


>gi|29427862|sp|Q8VW75|COAD_PASPI RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|16945743|dbj|BAB72023.1| phosphopantetheine adenylyltransferase [Photobacterium damselae
           subsp. piscicida]
          Length = 160

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 54/164 (32%), Positives = 95/164 (57%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDPITNGH+D+I +A +  + +++ +  N  K   F  + ER  L +   
Sbjct: 1   MTTRVIYPGTFDPITNGHLDLIERAAAMFDTVIVGVAYNPTKKPLF-DLNERVALAQSVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          ++ F GL VN AK+ +A V+VRGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 60  QHLPNVE-----IVGFSGLLVNFAKEHNANVLVRGLRAVSDFEYEFQLANMNRRLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           T+ L   E + +++ST+++ +     D++ FVP+ +   L   +
Sbjct: 115 TVFLTPAEENSFISSTIVKEVALHKGDVSQFVPNQISQALNKKL 158


>gi|251791514|ref|YP_003006235.1| phosphopantetheine adenylyltransferase [Dickeya zeae Ech1591]
 gi|247540135|gb|ACT08756.1| pantetheine-phosphate adenylyltransferase [Dickeya zeae Ech1591]
          Length = 159

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 49/164 (29%), Positives = 93/164 (56%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDP+TNGH+D++ +A    + L++AI  +  K   F +++ER  L K++ 
Sbjct: 1   MKTRAIYPGTFDPLTNGHLDLLTRATRMFDHLILAIAASPGKNTLF-TLEERVALAKEAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L    A+   A ++VRGLR ++DF+YE+++  +N  L P + 
Sbjct: 60  RHLPNVE-----VVGFTELMATFARQQQATILVRGLRAVSDFEYELQLAKMNHHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           ++ L   E   +++S+L++ +     D++ F+P P+   L+  +
Sbjct: 115 SVFLMPSEQWSFISSSLVKEVARHGGDVSHFLPPPISAALQKKL 158


>gi|307822857|ref|ZP_07653088.1| pantetheine-phosphate adenylyltransferase [Methylobacter
           tundripaludum SV96]
 gi|307736461|gb|EFO07307.1| pantetheine-phosphate adenylyltransferase [Methylobacter
           tundripaludum SV96]
          Length = 161

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 64/166 (38%), Positives = 96/166 (57%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+Y G+FDPITNGH+D+I +A      +V+A+  N  KT  F S+ ER +L++   
Sbjct: 1   MQTTAIYPGTFDPITNGHLDLIARASRLYHKVVVAVAVNRGKTPLF-SLDERVDLVRAVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F         VI F+ L V  AK   A VI+RGLR ++DF+YE ++  +NR L PE+ 
Sbjct: 60  SDFSNVE-----VIGFDNLLVECAKQQGANVILRGLRAVSDFEYEFQLAGMNRRLAPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+ L   E   +++S++IR +  ++ D++ FVPD V   L N   S
Sbjct: 115 TVFLTPAEQYEFISSSMIREIAQLNGDVSCFVPDIVHQCLINKFRS 160


>gi|206889787|ref|YP_002248644.1| pantetheine-phosphate adenylyltransferase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|226706704|sp|B5YK79|COAD_THEYD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|206741725|gb|ACI20782.1| pantetheine-phosphate adenylyltransferase [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 161

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 55/166 (33%), Positives = 91/166 (54%), Gaps = 5/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +  VY G+FDPITNGH+D+I +AL   ++L++A+  +S K     +++ER   I Q+ 
Sbjct: 1   MTKTGVYPGTFDPITNGHLDVIKRALKIFDELIVAVAMSSYKKTPIFTVEERVHFIAQTT 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V  F+GL VN  K+  A  IVRGLR ++D+++E+++   NR L  +I 
Sbjct: 61  KDLKNLK-----VEVFDGLLVNFIKEKKAVAIVRGLRAVSDYEFELQLAHANRRLFRDIE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+ L   E   +++S+L++ +      + S VP  V   L+N    
Sbjct: 116 TVFLMPSEEYSFLSSSLVKEIAYFGGSVKSLVPPIVEKALRNKFKK 161


>gi|238918040|ref|YP_002931554.1| pantetheine-phosphate adenylyltransferase, putative [Edwardsiella
           ictaluri 93-146]
 gi|259491310|sp|C5B9D9|COAD_EDWI9 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|238867607|gb|ACR67318.1| pantetheine-phosphate adenylyltransferase, putative [Edwardsiella
           ictaluri 93-146]
          Length = 161

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 49/165 (29%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y G+FDP+TNGH+DI+ +A    + +++AI  +  K   F +++ER  + ++  
Sbjct: 1   MSRTAIYPGTFDPLTNGHLDIVTRAAHMFDSVILAIAASPGKQPLF-TLEERVAMAREVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V  F  L  + A+   A ++VRGLR ++DF+YE+++ ++NR L P + 
Sbjct: 60  AHLTNVE-----VHGFSELMAHFAQRQGANILVRGLRAVSDFEYELQLANMNRHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E+  +++S+L++ +     D+ +F+P+ V   L   + 
Sbjct: 115 SVFLMPAEAWSFISSSLVKEVARHGGDVDAFLPEQVARALMTRLR 159


>gi|300313427|ref|YP_003777519.1| phosphopantetheine adenylyltransferase [Herbaspirillum seropedicae
           SmR1]
 gi|124483606|emb|CAM32676.1| Phosphopantetheine adenylyltransferase (pantetheine-Phosphate
           adenylyltransferase) protein [Herbaspirillum
           seropedicae]
 gi|300076212|gb|ADJ65611.1| phosphopantetheine adenylyltransferase (pantetheine-Phosphate
           adenylyltransferase) protein [Herbaspirillum seropedicae
           SmR1]
          Length = 160

 Score =  168 bits (425), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A    + LV+ +  +  K   F S++ER  +  + + 
Sbjct: 1   MVTAVYPGTFDPLTRGHEDLVRRASGLFDKLVVGVADSKNKKPFF-SLEERLSIANEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+       V V SF GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPN-----VQVESFSGLLKDFVRQNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   +  ++++ T++R +  +  D++ FV   V  +LK  +  
Sbjct: 115 LFLTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLKEKIAK 159


>gi|78044695|ref|YP_360291.1| phosphopantetheine adenylyltransferase [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|123576151|sp|Q3AC43|COAD_CARHZ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|77996810|gb|ABB15709.1| pantetheine-phosphate adenylyltransferase [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 162

 Score =  168 bits (425), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 59/165 (35%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR AVY GSFDPITNGH+DII +A    + L++AI  N +K   F +++ER +++++++ 
Sbjct: 1   MRIAVYPGSFDPITNGHLDIIERAAELFDRLIVAIAKNPMKKPLF-TLEERLDMLRETLK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           ++         + SFEGL VN  K  +AQVI+RGLR ++DF+ E  M   N+ L P + T
Sbjct: 60  YYPNIE-----IDSFEGLTVNYLKAKNAQVIIRGLRAISDFENEFMMALTNKKLVPWVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           I L  K    +++S+ ++ +      +   VP+ V + L+     
Sbjct: 115 IFLMTKAEYSFISSSAVKEVAMYGGCLKGLVPEYVELKLREKFQK 159


>gi|158320476|ref|YP_001512983.1| pantetheine-phosphate adenylyltransferase [Alkaliphilus oremlandii
           OhILAs]
 gi|167009039|sp|A8MHA0|COAD_ALKOO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|158140675|gb|ABW18987.1| pantetheine-phosphate adenylyltransferase [Alkaliphilus oremlandii
           OhILAs]
          Length = 157

 Score =  168 bits (425), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 58/163 (35%), Positives = 91/163 (55%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDPITNGH+DII +A    + L++++  N  K   F S++ER  LI++ I 
Sbjct: 1   MKVAIYPGSFDPITNGHLDIIERASKMCDHLIVSVIHNPNKNPLF-SLEERKLLIEECIG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +   +     V  F GL +  AK   A  I++GLR ++DF+YE++M  +N+ LCP I T
Sbjct: 60  KYANVT-----VDCFSGLLMEYAKGKEATAIIKGLRAISDFEYELQMALMNQRLCPSIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L       +++S+LI+ +      I   VP  V   + N  
Sbjct: 115 VFLMTSTEYSFLSSSLIKEVAKFGGSIHGMVPANVYKAITNRF 157


>gi|325678313|ref|ZP_08157939.1| pantetheine-phosphate adenylyltransferase [Ruminococcus albus 8]
 gi|324109993|gb|EGC04183.1| pantetheine-phosphate adenylyltransferase [Ruminococcus albus 8]
          Length = 164

 Score =  168 bits (425), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 54/163 (33%), Positives = 88/163 (53%), Gaps = 5/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR AV  GSFDP+T GH+DII +A    + +++ +  N  K K   S  ER E+I     
Sbjct: 1   MRIAVCPGSFDPVTLGHLDIIERASKLFDKVIVLVSFNRNKNKAVFSTNERMEMIIAVTE 60

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                  + V V  ++GL  +  K   A+VIV+GLR ++DF+YE +M   N+ L     T
Sbjct: 61  -----GLDNVVVDCYDGLLADYLKMTGAEVIVKGLRAVSDFEYEFQMALANKRLFGGAET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L     + +++S++++ + S   DI+ FVP  +   +KN +
Sbjct: 116 VFLTTAGENMFLSSSVVKEIASFGGDISGFVPPEILEMIKNRL 158


>gi|85703686|ref|ZP_01034790.1| pantetheine-phosphate adenylyltransferase [Roseovarius sp. 217]
 gi|85672614|gb|EAQ27471.1| pantetheine-phosphate adenylyltransferase [Roseovarius sp. 217]
          Length = 167

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 61/164 (37%), Positives = 90/164 (54%), Gaps = 1/164 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A   V+ LV+ +  N  K   F S++ER E+I+    
Sbjct: 5   MRIGLYPGTFDPITLGHIDIIRRAAVLVDRLVLGVAINRDKGPLF-SLEERVEMIETECA 63

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L +N A D+ AQVIVRGLR + DF+YE +M  +NR L   + T
Sbjct: 64  KLSAQTGTEIVAHPFENLLINCAHDVGAQVIVRGLRAVADFEYEFQMVGMNRALDNSVET 123

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L A  + + + S L++ +  +  D+T FV  PV   L     
Sbjct: 124 VFLMADANHQAIASKLVKEIARLGGDVTKFVTPPVRAALLAKFS 167


>gi|328950854|ref|YP_004368189.1| Phosphopantetheine adenylyltransferase [Marinithermus
           hydrothermalis DSM 14884]
 gi|328451178|gb|AEB12079.1| Phosphopantetheine adenylyltransferase [Marinithermus
           hydrothermalis DSM 14884]
          Length = 163

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 55/161 (34%), Positives = 91/161 (56%), Gaps = 6/161 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGF-LSIQERSELIKQSIFHF 63
           AVY GSFDP TNGH+D++ +A    + + +A+  N  K   F  S++ER  +I+++  H 
Sbjct: 3   AVYPGSFDPFTNGHLDVVQRASRLFDRVTVAVLVNPRKENRFLFSVEERLAIIREATQHL 62

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V SF GL  +  +   A+VIV+GLR ++DF+YE++M  +NR L PE+ T+ 
Sbjct: 63  NNVE-----VESFSGLLADYMRHKGARVIVKGLRAVSDFEYELQMAHLNRQLNPEVETLF 117

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + A     Y++ST+++ +     D++ FVP      L+   
Sbjct: 118 VMAATRWSYISSTMVKEIARYGGDVSRFVPKATAEALERKF 158


>gi|260575235|ref|ZP_05843235.1| pantetheine-phosphate adenylyltransferase [Rhodobacter sp. SW2]
 gi|259022495|gb|EEW25791.1| pantetheine-phosphate adenylyltransferase [Rhodobacter sp. SW2]
          Length = 163

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 55/164 (33%), Positives = 91/164 (55%), Gaps = 1/164 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T GH+DII +A+  V+ LVI +  N  K   F S++ER  +++    
Sbjct: 1   MRIGLYPGTFDPVTLGHVDIIQRAMQLVDRLVIGVAINRDKAPLF-SLEERVAMVQAECQ 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             I  +   + V  FE L ++ A+D+ A +I+RGLR + DF+YE +M  +NR L   I T
Sbjct: 60  GIIAKTGGEILVHPFENLLIDCARDVGAGIIIRGLRAVADFEYEFQMVGMNRALDSSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + + A    + + S L++ +  +  D++ FV   V   L+    
Sbjct: 120 VFMMADARRQAIASKLVKEIARLGGDVSKFVTPAVQEVLRAKFA 163


>gi|115375421|ref|ZP_01462682.1| pantetheine-phosphate adenylyltransferase [Stigmatella aurantiaca
           DW4/3-1]
 gi|310821113|ref|YP_003953471.1| pantetheine-phosphate adenylyltransferase [Stigmatella aurantiaca
           DW4/3-1]
 gi|115367548|gb|EAU66522.1| pantetheine-phosphate adenylyltransferase [Stigmatella aurantiaca
           DW4/3-1]
 gi|309394185|gb|ADO71644.1| Pantetheine-phosphate adenylyltransferase [Stigmatella aurantiaca
           DW4/3-1]
          Length = 163

 Score =  167 bits (424), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 61/164 (37%), Positives = 97/164 (59%), Gaps = 7/164 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGH+ +I + L   + L++AI  N  KT  F S++ER +LI+++  
Sbjct: 1   MPVAIYPGSFDPLTNGHLSLIQRGLKMFDRLIVAIAVNPKKTPLF-SLEERKQLIREACQ 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                   RV V SF+GL V  A+     V++RGLR ++DF++E ++ ++NR L P+I T
Sbjct: 60  D------PRVEVDSFQGLLVQYAQRRQVNVLIRGLRAVSDFEFEFQLANMNRKLEPDIET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + +   E   Y++S L+R + S+  D+T  VP  V   L+    
Sbjct: 114 VFMMTGEDYFYISSQLVREVASLGGDVTGLVPANVNAKLQEKFA 157


>gi|154253490|ref|YP_001414314.1| pantetheine-phosphate adenylyltransferase [Parvibaculum
           lavamentivorans DS-1]
 gi|171769668|sp|A7HXM4|COAD_PARL1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|154157440|gb|ABS64657.1| pantetheine-phosphate adenylyltransferase [Parvibaculum
           lavamentivorans DS-1]
          Length = 170

 Score =  167 bits (424), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 67/169 (39%), Positives = 103/169 (60%), Gaps = 1/169 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R  +Y G+FDP+TNGH+DII + L  V+ L++AIG N+ KT    +++ER +LI+Q  
Sbjct: 1   MARIGLYPGTFDPMTNGHLDIIRRGLKLVDHLIVAIGVNATKTPLL-TLEERFQLIEQEA 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                +  +++S  SF GL VN A +  A VI+RGLR   DF+YE +M  +NR + P + 
Sbjct: 60  GPIAKELGSKISTASFSGLVVNAADEHGATVILRGLRGAVDFEYETQMVGMNRVMNPHVE 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           T+ L A   +++++STL+R +  +D DI+ FVP  V   +   V    K
Sbjct: 120 TVFLAASPDTQFISSTLVRQIAGMDGDISPFVPPHVKAKVLARVAEQKK 168


>gi|118602386|ref|YP_903601.1| phosphopantetheine adenylyltransferase [Candidatus Ruthia magnifica
           str. Cm (Calyptogena magnifica)]
 gi|118567325|gb|ABL02130.1| Phosphopantetheine adenylyltransferase [Candidatus Ruthia magnifica
           str. Cm (Calyptogena magnifica)]
          Length = 159

 Score =  167 bits (424), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 62/164 (37%), Positives = 99/164 (60%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y GSFDPITNGH+D+I +A    ++++I I  NS K K FLSI +R      ++
Sbjct: 2   MKKIAIYPGSFDPITNGHIDLIKRASKLFDEIIIGITQNSKK-KAFLSIDDRINAANTTL 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V+SF  L V+     +AQVI+RGLR ++DF+YE +++S+N+ L P I 
Sbjct: 61  KDIGNIK-----VLSFNTLLVDFVAKQNAQVILRGLRAVSDFEYEFQLSSMNKHLNPNIE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           T+ + + E    ++S+L+R ++++  DI+ FVP  V   LK  +
Sbjct: 116 TLFMTSAEKYANISSSLVREILTLGGDISIFVPTSVEALLKQRL 159


>gi|294637899|ref|ZP_06716168.1| pantetheine-phosphate adenylyltransferase [Edwardsiella tarda ATCC
           23685]
 gi|291088925|gb|EFE21486.1| pantetheine-phosphate adenylyltransferase [Edwardsiella tarda ATCC
           23685]
          Length = 161

 Score =  167 bits (424), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 51/164 (31%), Positives = 93/164 (56%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y G+FDP+TNGH+DI+ +A    E +++AI  +  K   F +++ER  + +   
Sbjct: 1   MSRTAIYPGTFDPLTNGHLDIVTRAAHMFERVILAIAASPSKHPLF-TLEERVAMARDVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V  F  L  + A+   A ++VRGLR ++DF+YE+++ ++NR L P + 
Sbjct: 60  AHLPNVE-----VQGFSELMAHFAQRQQADILVRGLRAVSDFEYELQLANMNRHLMPSLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           ++ L   E+  +++S+L++ +     D+ +F+P PV   L   +
Sbjct: 115 SVFLMPAEAWSFISSSLVKEVARHGGDVDAFLPPPVAQALLARL 158


>gi|92115051|ref|YP_574979.1| phosphopantetheine adenylyltransferase [Chromohalobacter salexigens
           DSM 3043]
 gi|122419223|sp|Q1QTC8|COAD_CHRSD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|91798141|gb|ABE60280.1| Phosphopantetheine adenylyltransferase [Chromohalobacter salexigens
           DSM 3043]
          Length = 167

 Score =  167 bits (424), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 47/165 (28%), Positives = 87/165 (52%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M   VY G+FDP+TNGH D+I +A    + +V+A+  +  K     S++ R  LI++   
Sbjct: 1   MNIVVYPGTFDPVTNGHYDLIERASRMFDKVVVAVAASPRKQPTL-SLETRVALIEEVTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +     V  F  L   L    +A++I+RGLR ++DF+YE+++ ++NR   P++ +
Sbjct: 60  DLDNVT-----VTGFSCLLTQLLAQQNARIILRGLRAVSDFEYELQLANMNRAQAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L  +  + Y++ST++R +  +  D++  V   V   L      
Sbjct: 115 LFLTPEVENSYISSTIVREIARLGGDVSKLVHPCVVDALSRHFAQ 159


>gi|325837596|ref|ZP_08166443.1| pantetheine-phosphate adenylyltransferase [Turicibacter sp. HGF1]
 gi|325490898|gb|EGC93197.1| pantetheine-phosphate adenylyltransferase [Turicibacter sp. HGF1]
          Length = 161

 Score =  167 bits (424), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 93/166 (56%), Gaps = 5/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +  +Y G+FDP+TNGH+DII +     + L IA+  N  K   F +++ER +++K++ 
Sbjct: 1   MKKIGIYPGTFDPVTNGHLDIIGRGYELFDYLYIAVAENINKKTLF-TVEERVDMLKKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+  + L V+ A  + A+ I+RGLR +TDF+YE ++ + N+ L P I 
Sbjct: 60  KHL----ERVEVVVCADALVVDFANQLGAKTILRGLRAVTDFEYEFQIATTNKRLQPSIE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+ L  +  + +++S+  + +     D++SFVP+ V   LK     
Sbjct: 116 TVFLMTRAENMFLSSSTTKEVARFGGDVSSFVPEFVQEALKKKFNK 161


>gi|319788721|ref|YP_004090036.1| pantetheine-phosphate adenylyltransferase [Ruminococcus albus 7]
 gi|315450588|gb|ADU24150.1| pantetheine-phosphate adenylyltransferase [Ruminococcus albus 7]
          Length = 171

 Score =  167 bits (424), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 53/163 (32%), Positives = 89/163 (54%), Gaps = 5/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AV  GSFDP+T GH+DII +A    + +++ +  N  K K   S +ER E+I     
Sbjct: 1   MKIAVCPGSFDPVTLGHLDIIERASKLFDKVIVLVSFNKNKNKAVFSTKERIEMIIAVTK 60

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                  + V V  F+GL  +  K   A+VIV+GLR ++DF+YE +M   N+ L  +  T
Sbjct: 61  -----DLDNVVVDCFDGLLADYLKMTGAEVIVKGLRAVSDFEYEFQMALANKKLYNDAET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L     + +++S++++ + S   DI+ FV   +   +KN +
Sbjct: 116 VFLTTAGENMFLSSSVVKEIASFGGDISGFVSPAILEKIKNRL 158


>gi|260599931|ref|YP_003212502.1| phosphopantetheine adenylyltransferase [Cronobacter turicensis
           z3032]
 gi|260219108|emb|CBA34463.1| Phosphopantetheine adenylyltransferase [Cronobacter turicensis
           z3032]
          Length = 159

 Score =  167 bits (424), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 57/165 (34%), Positives = 93/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH+DII +A S  ++L++A+  +  K   F S+ ER +L +Q+ 
Sbjct: 1   MTTRAIYPGTFDPITNGHLDIITRAASMFDELILAVAASPHKKTMF-SLDERVDLAQQAA 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H    S     V  F  L  N A+   A V+VRGLR   DF+YEM++  +NR L P + 
Sbjct: 60  AHLPNVS-----VTGFSDLMANFAQAQQANVLVRGLRTAGDFEYEMQLAHMNRHLMPSLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D++ F+P  V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHKGDVSHFMPAHVHQALLEKLR 159


>gi|304310179|ref|YP_003809777.1| Coenzyme A biosynthesis protein, phosphopantetheine
           adenylyltransferase [gamma proteobacterium HdN1]
 gi|301795912|emb|CBL44113.1| Coenzyme A biosynthesis protein, phosphopantetheine
           adenylyltransferase [gamma proteobacterium HdN1]
          Length = 163

 Score =  167 bits (424), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 50/163 (30%), Positives = 90/163 (55%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDP+TNGH+D+I +A    + +++A+  +  K   F S++ER +L++  +
Sbjct: 1   MATRVLYPGTFDPLTNGHLDLIERASRLFDHIIVAVADSRKKGPLF-SLEERVQLVEGVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V  F  L     +   A V++RGLR ++DF+YE ++ ++NR +   I 
Sbjct: 60  SHLPNVE-----VAGFNTLLAIFCQQKGANVLLRGLRAVSDFEYEFQLANMNRAIDKNIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           T+ L   E + Y++S+L+R +   + DI  FVP  + + L   
Sbjct: 115 TVFLTPSEHNSYISSSLVREISFFNGDIRPFVPPSIALALDKK 157


>gi|289667747|ref|ZP_06488822.1| phosphopantetheine adenylyltransferase [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 168

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 51/158 (32%), Positives = 91/158 (57%), Gaps = 6/158 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDPITNGH+D++ +A    E +V+ +  +  K     S++ R  L ++++    
Sbjct: 9   AVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPAL-SLERRVALAQEALAAHT 67

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                   V  F+ L  +  +++ A V++RGLR ++DF+YE +M S++R L PE+ T+ L
Sbjct: 68  NVE-----VRGFDTLLAHFVREMGAGVLLRGLRAVSDFEYEFQMASMHRHLIPEVETLFL 122

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
              E   +++S+L+R +  +  D++ FVP  V   L+ 
Sbjct: 123 TPAEQYSFISSSLVREIARLGGDVSGFVPASVVEALRQ 160


>gi|254453363|ref|ZP_05066800.1| pantetheine-phosphate adenylyltransferase [Octadecabacter
           antarcticus 238]
 gi|198267769|gb|EDY92039.1| pantetheine-phosphate adenylyltransferase [Octadecabacter
           antarcticus 238]
          Length = 164

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 57/159 (35%), Positives = 90/159 (56%), Gaps = 1/159 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T GH+DII +A S V+ LVI +  N  K   F S++ER  +I+    
Sbjct: 1   MRVGLYPGTFDPVTLGHLDIIKRACSLVDKLVIGVAINRDKGPLF-SLEERVAMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L ++ AKD+ A +I+RGLR + DF+YE +M  +NR L   + T
Sbjct: 60  DLSAQTGCEIVAHPFENLLIHCAKDVGATIIIRGLRAVADFEYEYQMVGMNRQLDNTVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           + L A+   + + S L++ +  +D D++ FV   V   L
Sbjct: 120 VFLMAEAQHQAIASKLVKEIARLDGDVSKFVTPEVQEAL 158


>gi|163746628|ref|ZP_02153985.1| Coenzyme A biosynthesis protein [Oceanibulbus indolifex HEL-45]
 gi|161379742|gb|EDQ04154.1| Coenzyme A biosynthesis protein [Oceanibulbus indolifex HEL-45]
          Length = 165

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 62/166 (37%), Positives = 94/166 (56%), Gaps = 1/166 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y G+FDPIT GH+DII +A   V+ LVI +  N  K   F S++ER  LI+    
Sbjct: 1   MRIALYPGTFDPITLGHIDIIRRAARMVDRLVIGVAINRDKGPLF-SLEERVALIEAECV 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               ++   + V  FE L ++ A+D+ AQ IVRGLR ++DF+YE +M  +NR L   I T
Sbjct: 60  QLAKETGVEIIVHPFENLLIDCARDVGAQTIVRGLRAVSDFEYEFQMVGMNRQLDDTIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + L A+ + + + S L++ +  +D D++ FV   V   L       
Sbjct: 120 VFLMAEATHQAIASKLVKEIARLDGDVSKFVTPAVNEVLIKRFAQR 165


>gi|83643885|ref|YP_432320.1| phosphopantetheine adenylyltransferase [Hahella chejuensis KCTC
           2396]
 gi|123534648|sp|Q2SN79|COAD_HAHCH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|83631928|gb|ABC27895.1| pantetheine-phosphate adenylyltransferase [Hahella chejuensis KCTC
           2396]
          Length = 161

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 54/164 (32%), Positives = 89/164 (54%), Gaps = 6/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M   +Y G+FDPITNGH D+I +A    + +V+A+  +  K   F S++ER +L++Q + 
Sbjct: 1   MNTVIYPGTFDPITNGHKDLIARASRIFDKVVVAVAASPKKNPLF-SLEERVDLVRQVVK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F         V  F  L  +  +   A +I+RGLR ++DF+YE ++  +NR L P + +
Sbjct: 60  PFPNVD-----VKGFSNLLADFVQQNQANIILRGLRAVSDFEYEFQLADMNRKLAPNVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L       Y++STLIR + ++  D+T FV   V   L+    
Sbjct: 115 LFLTPANHLSYISSTLIREIAALGGDVTEFVDPIVSKALQQQFA 158


>gi|114327882|ref|YP_745039.1| phosphopantetheine adenylyltransferase [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316056|gb|ABI62116.1| phosphopantetheine adenylyltransferase [Granulibacter bethesdensis
           CGDNIH1]
          Length = 183

 Score =  167 bits (423), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 55/159 (34%), Positives = 91/159 (57%), Gaps = 1/159 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+R  VY G+FDP+TNGH+D+I +A    + LVI +  N  K   F  ++ER +L++   
Sbjct: 9   MLRTGVYPGTFDPVTNGHLDVITRAARMFDRLVIGVAANIGKNPVF-PLEERVDLVRAET 67

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +   + V+ F  L ++ A+   A +IVRGLR ++DFDYE++M   N  L P+I 
Sbjct: 68  VTLGGKTGTIIEVVPFSSLLIDFARQHGASIIVRGLRAVSDFDYEVQMAGTNYRLAPDIE 127

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVF 159
           T+ L A E  ++++S  ++ +  +  DI++FVP      
Sbjct: 128 TVFLMASERHQFISSRFVKEIARLGGDISTFVPPLTLQR 166


>gi|288942582|ref|YP_003444822.1| pantetheine-phosphate adenylyltransferase [Allochromatium vinosum
           DSM 180]
 gi|298286794|sp|P71154|COAD_ALLVD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|288897954|gb|ADC63790.1| pantetheine-phosphate adenylyltransferase [Allochromatium vinosum
           DSM 180]
          Length = 158

 Score =  167 bits (423), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 60/163 (36%), Positives = 98/163 (60%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY G+FDPITNGH+D+I +A    + +V+A+  ++ KT  F S +ER EL++ S+ 
Sbjct: 1   MRTVVYPGTFDPITNGHVDLIHRAARLFDRVVVAVAADTGKTPVF-STEERVELVRGSVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      ++ FEGL VN A+ +   VI+RGLR ++DF+YE ++  +NR + P+I T
Sbjct: 60  GDPNVE-----ILPFEGLLVNFARTLGVSVIMRGLRAVSDFEYEFQLAGMNRRMAPDIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L   E   Y++S+L+R +  +  D+++FV   V   L+   
Sbjct: 115 LFLTPAEQYAYISSSLVREIARLRGDVSTFVTPTVQAALRARF 157


>gi|239826502|ref|YP_002949126.1| phosphopantetheine adenylyltransferase [Geobacillus sp. WCH70]
 gi|259491315|sp|C5D8K3|COAD_GEOSW RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|239806795|gb|ACS23860.1| pantetheine-phosphate adenylyltransferase [Geobacillus sp. WCH70]
          Length = 169

 Score =  167 bits (423), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 59/167 (35%), Positives = 94/167 (56%), Gaps = 6/167 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDP+T GH+DII +     + + +A+  NS K   F S++ER EL+++  
Sbjct: 1   MASIAVCPGSFDPVTYGHLDIIRRGAKVFDQVYVAVLNNSSKKPLF-SVEERIELLREVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F       V V SF GL V+ A+  +A  I+RGLR ++DF+YEM++TS+NR L   I 
Sbjct: 60  RPFPN-----VIVESFHGLLVDYARSKNASAILRGLRAVSDFEYEMQITSMNRVLDENIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           T  +       +++S++++ +   + +I+  VP  V   L+    SL
Sbjct: 115 TFFMMTNSQYAFLSSSIVKEVAKYNGNISDLVPPVVEEALRKKFASL 161


>gi|88705465|ref|ZP_01103176.1| Phosphopantetheine adenylyltransferase [Congregibacter litoralis
           KT71]
 gi|88700555|gb|EAQ97663.1| Phosphopantetheine adenylyltransferase [Congregibacter litoralis
           KT71]
          Length = 161

 Score =  167 bits (423), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 54/164 (32%), Positives = 93/164 (56%), Gaps = 6/164 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R  +Y G+FDPIT GH+D++ +A    + +V+AI  +  KT  F S++ER  L  +++  
Sbjct: 4   RTIIYPGTFDPITIGHVDLVERASKLFDRVVVAIAFSEKKTPLF-SLEERVALCSEALA- 61

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                 + V V  F  L  +     +A+ ++RGLR + DF+YE ++ ++NR L PE  +I
Sbjct: 62  ----GIDGVEVKGFSNLLTDFVISENARCVLRGLRAVADFEYEFQLANMNRALYPEFESI 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            L   E   Y++S+L+R + +++ +IT FVP+ V   L+     
Sbjct: 118 FLTPSEHLSYISSSLVREIAALNGNITPFVPENVSKALEEKFQQ 161


>gi|147678088|ref|YP_001212303.1| phosphopantetheine adenylyltransferase [Pelotomaculum
           thermopropionicum SI]
 gi|146274185|dbj|BAF59934.1| phosphopantetheine adenylyltransferase [Pelotomaculum
           thermopropionicum SI]
          Length = 177

 Score =  167 bits (423), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 63/176 (35%), Positives = 94/176 (53%), Gaps = 9/176 (5%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+  GSFDP+T GH+DII +A    + +++A+  N  K   F SI+ER E++K+ + 
Sbjct: 1   MRIAICPGSFDPVTYGHLDIIGRASILFDKIIVAVSRNPTKNPIF-SIEERVEMLKEVLK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +         V SFEGL VN A +  A+ IVRGLR ++DF+ E RM   N+ L   I T
Sbjct: 60  SYNNVE-----VDSFEGLTVNYAIERKAKAIVRGLRVISDFENEFRMALTNKKLACHIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV---ISLVKYDSIK 174
           + L  +    Y++ST ++ + S    + S VP  V   LK         V+ D  +
Sbjct: 115 VFLMTRAEFSYISSTTVKEVASFGGSVRSLVPPLVEERLKEKFKNASYKVRRDIEQ 170


>gi|56419634|ref|YP_146952.1| phosphopantetheine adenylyltransferase [Geobacillus kaustophilus
           HTA426]
 gi|261419296|ref|YP_003252978.1| phosphopantetheine adenylyltransferase [Geobacillus sp. Y412MC61]
 gi|319766112|ref|YP_004131613.1| pantetheine-phosphate adenylyltransferase [Geobacillus sp.
           Y412MC52]
 gi|61212477|sp|Q5L0Z6|COAD_GEOKA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|56379476|dbj|BAD75384.1| lipopolysaccharide core biosynthesis (pantetheine-phosphate
           adenylyltransferase) (dephospho-CoA pyrophosphorylase)
           [Geobacillus kaustophilus HTA426]
 gi|261375753|gb|ACX78496.1| pantetheine-phosphate adenylyltransferase [Geobacillus sp.
           Y412MC61]
 gi|317110978|gb|ADU93470.1| pantetheine-phosphate adenylyltransferase [Geobacillus sp.
           Y412MC52]
          Length = 164

 Score =  167 bits (423), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 57/166 (34%), Positives = 91/166 (54%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDP+T GH+DII +     + + +A+  NS K   F +++ER EL+++  
Sbjct: 1   MASIAVCPGSFDPVTYGHLDIIKRGAKVFDQVYVAVLNNSSKKPLF-TVEERIELLREVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     V V +F GL V+ A+   A  I+RGLR ++DF+YEM++TS+NR L   I 
Sbjct: 60  RTLPN-----VHVEAFHGLLVDYARSKKANAILRGLRAVSDFEYEMQITSMNRVLDENIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T  +       +++S++++ +   + DI+  VP  V   LK    S
Sbjct: 115 TFFMMTNSQYAFLSSSIVKEVAKYNGDISELVPPVVEQALKRKFAS 160


>gi|172057984|ref|YP_001814444.1| phosphopantetheine adenylyltransferase [Exiguobacterium sibiricum
           255-15]
 gi|229500790|sp|B1YIV1|COAD_EXIS2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|171990505|gb|ACB61427.1| pantetheine-phosphate adenylyltransferase [Exiguobacterium
           sibiricum 255-15]
          Length = 164

 Score =  167 bits (423), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 59/166 (35%), Positives = 94/166 (56%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+  GSFDPITNGH+DII +A    +++++A+  NS K   F S+QER ELI +  
Sbjct: 1   MKRIAICPGSFDPITNGHLDIIERAAPIFDEIIVAVLNNSSKQPLF-SVQERMELISEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V +F GL V+ A  + A VIVRGLR ++DF+YEM++ S+N+ +  +I 
Sbjct: 60  EHLPHIK-----VDAFNGLLVDYASTVGADVIVRGLRAVSDFEYEMQVASINKKMNDQIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+ +       +++S++++      A +   VP  V   L++    
Sbjct: 115 TLFMMTNNQYSFLSSSIVKEAAKYGASVAGLVPPAVEEALRHKYSE 160


>gi|281180680|dbj|BAI57010.1| phosphopantetheine adenylyltransferase [Escherichia coli SE15]
          Length = 159

 Score =  167 bits (423), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 97/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F +++ER EL +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRASQMFDHVILAIAASPSKKPMF-TLEERVELAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHLENVE-----VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA 159


>gi|297530734|ref|YP_003672009.1| pantetheine-phosphate adenylyltransferase [Geobacillus sp. C56-T3]
 gi|297253986|gb|ADI27432.1| pantetheine-phosphate adenylyltransferase [Geobacillus sp. C56-T3]
          Length = 164

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 57/166 (34%), Positives = 92/166 (55%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDP+T GH+DII +     + + +A+  NS K   F +++ER EL+++  
Sbjct: 1   MASIAVCPGSFDPVTYGHLDIIKRGAKVFDQVYVAVLNNSSKKPLF-TVEERIELLREVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     V V +F GL V+ A++  A  I+RGLR ++DF+YEM++TS+NR L   I 
Sbjct: 60  RTLPN-----VHVEAFHGLLVDYARNKKANAILRGLRAVSDFEYEMQITSMNRVLDENIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T  +       +++S++++ +   + DI+  VP  V   LK    S
Sbjct: 115 TFFMMTNSQYAFLSSSIVKEVAKYNGDISELVPPVVEQALKRKFAS 160


>gi|254490545|ref|ZP_05103731.1| pantetheine-phosphate adenylyltransferase [Methylophaga thiooxidans
           DMS010]
 gi|224464289|gb|EEF80552.1| pantetheine-phosphate adenylyltransferase [Methylophaga thiooxydans
           DMS010]
          Length = 162

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 59/164 (35%), Positives = 100/164 (60%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+Y G+FDPIT GH+D+I +A +  + +++AI  N  K   F S+ ER  L KQ++
Sbjct: 1   MSTTAIYPGTFDPITYGHIDLINRAATLFDKVIVAIAINPGKQPMF-SLDERVTLAKQTV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V  FEGL VN A ++ A VI+RGLR ++DF+YE+++ ++NR + P++ 
Sbjct: 60  DELTNVE-----VRGFEGLLVNEALNMGANVIIRGLRAVSDFEYELQLATMNRRMQPKVE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           T+ L   E+  +V+S+L++ +  +  D++ FV   V + LK+ +
Sbjct: 115 TLFLTPAENLSFVSSSLVKEIAVLGGDVSEFVAPCVQMALKHKL 158


>gi|99080950|ref|YP_613104.1| phosphopantetheine adenylyltransferase [Ruegeria sp. TM1040]
 gi|123378978|sp|Q1GHM4|COAD_SILST RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|99037230|gb|ABF63842.1| Coenzyme A biosynthesis protein [Ruegeria sp. TM1040]
          Length = 165

 Score =  167 bits (422), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 59/166 (35%), Positives = 90/166 (54%), Gaps = 1/166 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A   V+ LVI +  N  K   F  ++ER  +I+    
Sbjct: 1   MRIGLYPGTFDPITLGHIDIIRRATLLVDRLVIGVAINRDKGPLF-DLEERVAMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   + V  FE L ++ A+D+ AQVIVRGLR + DF+YE +M  +NR L   I T
Sbjct: 60  KLTEQTGTEIVVHPFENLLIDCARDVGAQVIVRGLRAVADFEYEFQMVGMNRALDDSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + L A+   + + S L++ +  +  D++ FV   V   L   +   
Sbjct: 120 VFLMAEARHQAIASKLVKEISRLGGDVSKFVTPLVRERLAERLGQR 165


>gi|237728931|ref|ZP_04559412.1| phosphopantetheine adenylyltransferase [Citrobacter sp. 30_2]
 gi|283836013|ref|ZP_06355754.1| pantetheine-phosphate adenylyltransferase [Citrobacter youngae ATCC
           29220]
 gi|226909553|gb|EEH95471.1| phosphopantetheine adenylyltransferase [Citrobacter sp. 30_2]
 gi|291068195|gb|EFE06304.1| pantetheine-phosphate adenylyltransferase [Citrobacter youngae ATCC
           29220]
          Length = 159

 Score =  167 bits (422), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 99/165 (60%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A S  + +++AI  +  K   F +++ER EL +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHLDIVTRATSMFDHVILAIAASPSKKPMF-TLEERVELAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A+D  A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHLGNVE-----VLGFSDLMANFARDNQANILIRGLRAVADFEYEMQLAHMNRHLMPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L + + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMSKLK 159


>gi|254437496|ref|ZP_05050990.1| pantetheine-phosphate adenylyltransferase [Octadecabacter
           antarcticus 307]
 gi|198252942|gb|EDY77256.1| pantetheine-phosphate adenylyltransferase [Octadecabacter
           antarcticus 307]
          Length = 164

 Score =  167 bits (422), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 57/164 (34%), Positives = 91/164 (55%), Gaps = 1/164 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T GH+DII++A S V+ LVI +  N  K   F S++ER  +I+    
Sbjct: 1   MRIGLYPGTFDPLTLGHLDIILRACSLVDKLVIGVAINRDKGPLF-SLEERVAMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L ++ AKD+ A +I+RGLR + DF+YE +M  +NR L   + T
Sbjct: 60  DLSAQTGCEIVAHPFENLLIHCAKDVGATIIIRGLRAVADFEYEYQMVGMNRQLDNTVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L A+   + + S L++ +  +D D++ FV   V   L     
Sbjct: 120 VFLMAEAQHQAIASKLVKEIARLDGDVSKFVTPAVNKALAARFQ 163


>gi|307133076|ref|YP_003885092.1| phosphopantetheine adenylyltransferase [Dickeya dadantii 3937]
 gi|306530605|gb|ADN00536.1| Phosphopantetheine adenylyltransferase [Dickeya dadantii 3937]
          Length = 159

 Score =  167 bits (422), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 52/164 (31%), Positives = 95/164 (57%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDP+TNGH+D++ +A    + L++AI  +  K   F +++ER  L K++ 
Sbjct: 1   MKTRAIYPGTFDPLTNGHLDLLTRAARMFDHLILAIAASPGKKTLF-TLEERVALAKEAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          VI F  L  N A+   A ++VRGLR ++DF+YE+++  +N  L P + 
Sbjct: 60  QHLPNVE-----VIGFTDLMANFARQQQATILVRGLRAVSDFEYELQLAKMNHHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           +I L   E   +++S+L++ +     D++ F+P P+ + L+  +
Sbjct: 115 SIFLMPSEQWSFISSSLVKEVARHGGDVSHFLPAPIALALQQKL 158


>gi|268315831|ref|YP_003289550.1| pantetheine-phosphate adenylyltransferase [Rhodothermus marinus DSM
           4252]
 gi|262333365|gb|ACY47162.1| pantetheine-phosphate adenylyltransferase [Rhodothermus marinus DSM
           4252]
          Length = 162

 Score =  167 bits (422), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 65/161 (40%), Positives = 95/161 (59%), Gaps = 6/161 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y GSFDP T GH+DI+ +AL   + + + +  N  K   F SI+ER ELI+Q   H
Sbjct: 4   RLALYPGSFDPFTYGHLDIVERALRIFDRVEVTVAVNIGKEPLF-SIEERCELIRQCTAH 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                 +RV V++FEGL V+ A+   A  +VRGLR ++DF+YE RM   NR L PE+ T+
Sbjct: 63  L-----DRVEVVAFEGLLVDHARARGATALVRGLRQVSDFEYEFRMAFANRRLYPELETV 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            L   E    ++S+++R +     D++ FVP PV   L+  
Sbjct: 118 FLMTSEEYAMISSSIVREIHRWGGDVSLFVPPPVVEALRKK 158


>gi|170766565|ref|ZP_02901018.1| pantetheine-phosphate adenylyltransferase [Escherichia albertii
           TW07627]
 gi|170124003|gb|EDS92934.1| pantetheine-phosphate adenylyltransferase [Escherichia albertii
           TW07627]
          Length = 159

 Score =  167 bits (422), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 95/165 (57%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F S++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMF-SLEERVALAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A+   A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHLSNVE-----VVGFSDLMANFARKQQATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA 159


>gi|157963918|ref|YP_001503952.1| phosphopantetheine adenylyltransferase [Shewanella pealeana ATCC
           700345]
 gi|189082590|sp|A8HA30|COAD_SHEPA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|157848918|gb|ABV89417.1| pantetheine-phosphate adenylyltransferase [Shewanella pealeana ATCC
           700345]
          Length = 159

 Score =  167 bits (422), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 59/163 (36%), Positives = 96/163 (58%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDP+TNGH D+I +A +  E ++I I  N  K   F ++ ER EL+K   
Sbjct: 1   MHKRAIYPGTFDPVTNGHADLIERAANLFEHVIIGIAANPSKQPRF-TLAERVELLKTVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AKD +A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHLDNVE-----VVGFSGLLVDFAKDQNASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           ++ L   E + +++STL++ +     D++ FV   V   L   
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHIEVANALTKK 157


>gi|253690456|ref|YP_003019646.1| pantetheine-phosphate adenylyltransferase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|259491321|sp|C6DIB6|COAD_PECCP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|251757034|gb|ACT15110.1| pantetheine-phosphate adenylyltransferase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 159

 Score =  167 bits (422), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 51/165 (30%), Positives = 91/165 (55%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+D++ +A    + +V+AI  +  K   F ++ ER  L K + 
Sbjct: 1   MTTKAIYPGTFDPLTNGHLDLLTRASRLFDHVVLAIAASPSKQTLF-TLDERVALAKGAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          VI F  L  + A+  +A ++VRGLR + DF+YE+++  +N  L P + 
Sbjct: 60  EHLSNVD-----VIGFSDLMAHFAQQQNANILVRGLRAVADFEYELQLAKMNHHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E   +++S+L++ +     D++ F+PD +   L   + 
Sbjct: 115 SVFLMPSEEWSFISSSLVKEVARHGGDVSHFLPDAIVSALMEKLR 159


>gi|323189458|gb|EFZ74739.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           RN587/1]
          Length = 159

 Score =  166 bits (421), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 97/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F +++ER EL +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRASQMFDHVILAIAASPSKKPMF-TLEERVELAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  SHLENVE-----VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA 159


>gi|91781708|ref|YP_556914.1| phosphopantetheine adenylyltransferase [Burkholderia xenovorans
           LB400]
 gi|296161523|ref|ZP_06844328.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp. Ch1-1]
 gi|122970735|sp|Q145X7|COAD_BURXL RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|91685662|gb|ABE28862.1| Coenzyme A biosynthesis protein, Cytidyltransferase-related protein
           [Burkholderia xenovorans LB400]
 gi|295888167|gb|EFG67980.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp. Ch1-1]
          Length = 171

 Score =  166 bits (421), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 55/167 (32%), Positives = 100/167 (59%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F +++ER ++  + + 
Sbjct: 1   MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRNKKPFF-TLEERLDIAHEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+       V V+SF+GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPN-----VQVMSFKGLLKDFVRSNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + +   +  ++++ T++R +  +  D++ FV   V  +LK  V +L 
Sbjct: 115 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEQWLKEKVAALD 161


>gi|311277445|ref|YP_003939676.1| pantetheine-phosphate adenylyltransferase [Enterobacter cloacae
           SCF1]
 gi|308746640|gb|ADO46392.1| pantetheine-phosphate adenylyltransferase [Enterobacter cloacae
           SCF1]
          Length = 159

 Score =  166 bits (421), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 51/165 (30%), Positives = 90/165 (54%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F   + R  L +Q+ 
Sbjct: 1   MSTKAIYPGTFDPITNGHLDIVTRASCMFDSVILAIAASPSKKPMFDLAE-RVALAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A+   A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHLGNVE-----VVGFSDLMANFARAQQANILIRGLRAVADFEYEMQLAHMNRHLMPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+  F+P  V   L + + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHGGDVAHFLPPAVHQALLDKLK 159


>gi|254444286|ref|ZP_05057762.1| pantetheine-phosphate adenylyltransferase [Verrucomicrobiae
           bacterium DG1235]
 gi|198258594|gb|EDY82902.1| pantetheine-phosphate adenylyltransferase [Verrucomicrobiae
           bacterium DG1235]
          Length = 189

 Score =  166 bits (421), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 93/165 (56%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT+GH+D++ +A    + +++ I  N  K   F + +      + S+ 
Sbjct: 31  MRICIYPGTFDPITHGHLDVLQRACRMFDKVIVGIADNPGKQPFFNTQE------RVSLL 84

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                 +   S+ +F GL V+ AK+  A  ++RGLR ++DF+YE +M  +NR L P+I T
Sbjct: 85  EANLGQTPNASIATFSGLLVDFAKEQQATAVIRGLRAVSDFEYEFQMALMNRHLQPDIET 144

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           I +  KE   Y +S+L++ + +  ADI+ FVP  V   LK  +  
Sbjct: 145 ILVMTKEGYNYTSSSLVKQVATYGADISHFVPANVDQALKAKLAR 189


>gi|54293539|ref|YP_125954.1| hypothetical protein lpl0590 [Legionella pneumophila str. Lens]
 gi|296106136|ref|YP_003617836.1| pantetheine-phosphate adenylyltransferase [Legionella pneumophila
           2300/99 Alcoy]
 gi|61212501|sp|Q5WYZ4|COAD_LEGPL RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|61212514|sp|Q5ZY26|COAD_LEGPH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|53753371|emb|CAH14821.1| hypothetical protein lpl0590 [Legionella pneumophila str. Lens]
 gi|295648037|gb|ADG23884.1| pantetheine-phosphate adenylyltransferase [Legionella pneumophila
           2300/99 Alcoy]
          Length = 170

 Score =  166 bits (421), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 58/163 (35%), Positives = 99/163 (60%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KA+Y G+FDP+TNGH+DII +A +   +L++A+  N  K     S + R  L+++S+
Sbjct: 8   MKQKAIYPGTFDPVTNGHIDIITRASTIFPELIVAVASNKNKRPYL-SWESRISLLEESV 66

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F+ L ++   + +A +I+RGLR ++DF+YE ++  +NR L  ++ 
Sbjct: 67  GHLT-----GVRVVGFDNLLIDFVLEQNAGIILRGLRAVSDFEYEFQLAGMNRKLSKKVE 121

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           T+ L   E   Y++STL+R + +++ DI+ FVP  V   LK  
Sbjct: 122 TLFLTPAEHLMYISSTLVREIAALNGDISQFVPPNVVRELKKR 164


>gi|26250280|ref|NP_756320.1| phosphopantetheine adenylyltransferase [Escherichia coli CFT073]
 gi|91213150|ref|YP_543136.1| phosphopantetheine adenylyltransferase [Escherichia coli UTI89]
 gi|110643875|ref|YP_671605.1| phosphopantetheine adenylyltransferase [Escherichia coli 536]
 gi|191170409|ref|ZP_03031962.1| pantetheine-phosphate adenylyltransferase [Escherichia coli F11]
 gi|218560706|ref|YP_002393619.1| phosphopantetheine adenylyltransferase [Escherichia coli S88]
 gi|218691918|ref|YP_002400130.1| phosphopantetheine adenylyltransferase [Escherichia coli ED1a]
 gi|218707268|ref|YP_002414787.1| phosphopantetheine adenylyltransferase [Escherichia coli UMN026]
 gi|227883802|ref|ZP_04001607.1| phosphopantetheine adenylyltransferase [Escherichia coli 83972]
 gi|237703404|ref|ZP_04533885.1| phosphopantetheine adenylyltransferase [Escherichia sp. 3_2_53FAA]
 gi|254038833|ref|ZP_04872885.1| phosphopantetheine adenylyltransferase [Escherichia sp. 1_1_43]
 gi|256025636|ref|ZP_05439501.1| phosphopantetheine adenylyltransferase [Escherichia sp. 4_1_40B]
 gi|293407257|ref|ZP_06651181.1| coaD [Escherichia coli FVEC1412]
 gi|293413068|ref|ZP_06655736.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B354]
 gi|293417095|ref|ZP_06659722.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B185]
 gi|298383003|ref|ZP_06992598.1| phosphopantetheine adenylyltransferase [Escherichia coli FVEC1302]
 gi|300898567|ref|ZP_07116899.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           198-1]
 gi|300948033|ref|ZP_07162173.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           116-1]
 gi|300954472|ref|ZP_07166922.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           175-1]
 gi|300983559|ref|ZP_07176651.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           200-1]
 gi|300984966|ref|ZP_07177218.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           45-1]
 gi|301018963|ref|ZP_07183186.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           69-1]
 gi|301028393|ref|ZP_07191639.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           196-1]
 gi|301047423|ref|ZP_07194503.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           185-1]
 gi|301644300|ref|ZP_07244302.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           146-1]
 gi|306816018|ref|ZP_07450156.1| phosphopantetheine adenylyltransferase [Escherichia coli NC101]
 gi|307140332|ref|ZP_07499688.1| phosphopantetheine adenylyltransferase [Escherichia coli H736]
 gi|331649449|ref|ZP_08350535.1| pantetheine-phosphate adenylyltransferase [Escherichia coli M605]
 gi|331659954|ref|ZP_08360892.1| pantetheine-phosphate adenylyltransferase [Escherichia coli TA206]
 gi|331665259|ref|ZP_08366160.1| pantetheine-phosphate adenylyltransferase [Escherichia coli TA143]
 gi|29427784|sp|Q8FC88|COAD_ECOL6 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|122421891|sp|Q1R4V9|COAD_ECOUT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|123048707|sp|Q0TBH5|COAD_ECOL5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226706694|sp|B7MFJ5|COAD_ECO45 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226706697|sp|B7NET8|COAD_ECOLU RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254764154|sp|B7N1T5|COAD_ECO81 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|26110710|gb|AAN82894.1|AE016769_9 Phosphopantetheine adenylyltransferase [Escherichia coli CFT073]
 gi|91074724|gb|ABE09605.1| phosphopantetheine adenylyltransferase [Escherichia coli UTI89]
 gi|110345467|gb|ABG71704.1| phosphopantetheine adenylyltransferase [Escherichia coli 536]
 gi|190909217|gb|EDV68803.1| pantetheine-phosphate adenylyltransferase [Escherichia coli F11]
 gi|218367475|emb|CAR05257.1| pantetheine-phosphate adenylyltransferase [Escherichia coli S88]
 gi|218429482|emb|CAR10305.1| pantetheine-phosphate adenylyltransferase [Escherichia coli ED1a]
 gi|218434365|emb|CAR15289.1| pantetheine-phosphate adenylyltransferase [Escherichia coli UMN026]
 gi|222035342|emb|CAP78087.1| Phosphopantetheine adenylyltransferase [Escherichia coli LF82]
 gi|226838798|gb|EEH70825.1| phosphopantetheine adenylyltransferase [Escherichia sp. 1_1_43]
 gi|226902668|gb|EEH88927.1| phosphopantetheine adenylyltransferase [Escherichia sp. 3_2_53FAA]
 gi|227839080|gb|EEJ49546.1| phosphopantetheine adenylyltransferase [Escherichia coli 83972]
 gi|291426068|gb|EFE99102.1| coaD [Escherichia coli FVEC1412]
 gi|291431126|gb|EFF04119.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B185]
 gi|291468715|gb|EFF11208.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B354]
 gi|294493453|gb|ADE92209.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           IHE3034]
 gi|298276839|gb|EFI18357.1| phosphopantetheine adenylyltransferase [Escherichia coli FVEC1302]
 gi|299878504|gb|EFI86715.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           196-1]
 gi|300300697|gb|EFJ57082.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           185-1]
 gi|300306883|gb|EFJ61403.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           200-1]
 gi|300318551|gb|EFJ68335.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           175-1]
 gi|300357787|gb|EFJ73657.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           198-1]
 gi|300399457|gb|EFJ82995.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           69-1]
 gi|300408246|gb|EFJ91784.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           45-1]
 gi|300452404|gb|EFK16024.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           116-1]
 gi|301077338|gb|EFK92144.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           146-1]
 gi|305850414|gb|EFM50871.1| phosphopantetheine adenylyltransferase [Escherichia coli NC101]
 gi|307555733|gb|ADN48508.1| phosphopantetheine adenylyltransferase [Escherichia coli ABU 83972]
 gi|307628707|gb|ADN73011.1| phosphopantetheine adenylyltransferase [Escherichia coli UM146]
 gi|309704036|emb|CBJ03382.1| phosphopantetheine adenylyltransferase [Escherichia coli ETEC
           H10407]
 gi|312948195|gb|ADR29022.1| phosphopantetheine adenylyltransferase [Escherichia coli O83:H1
           str. NRG 857C]
 gi|315285379|gb|EFU44824.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           110-3]
 gi|315292971|gb|EFU52323.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           153-1]
 gi|315297029|gb|EFU56309.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           16-3]
 gi|315618663|gb|EFU99249.1| pantetheine-phosphate adenylyltransferase [Escherichia coli 3431]
 gi|320193859|gb|EFW68492.1| Phosphopantetheine adenylyltransferase [Escherichia coli WV_060327]
 gi|323934821|gb|EGB31203.1| pantetheine-phosphate adenylyltransferase [Escherichia coli E1520]
 gi|323939607|gb|EGB35813.1| pantetheine-phosphate adenylyltransferase [Escherichia coli E482]
 gi|323949873|gb|EGB45757.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H252]
 gi|323954826|gb|EGB50606.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H263]
 gi|324008139|gb|EGB77358.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           57-2]
 gi|324012606|gb|EGB81825.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           60-1]
 gi|330909696|gb|EGH38210.1| phosphopantetheine adenylyltransferase [Escherichia coli AA86]
 gi|331041947|gb|EGI14091.1| pantetheine-phosphate adenylyltransferase [Escherichia coli M605]
 gi|331053169|gb|EGI25202.1| pantetheine-phosphate adenylyltransferase [Escherichia coli TA206]
 gi|331057769|gb|EGI29755.1| pantetheine-phosphate adenylyltransferase [Escherichia coli TA143]
          Length = 159

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 97/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F +++ER EL +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMF-TLEERVELAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHLGNVE-----VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA 159


>gi|82779124|ref|YP_405473.1| phosphopantetheine adenylyltransferase [Shigella dysenteriae Sd197]
 gi|309784389|ref|ZP_07679028.1| pantetheine-phosphate adenylyltransferase [Shigella dysenteriae
           1617]
 gi|123561127|sp|Q329M3|COAD_SHIDS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|81243272|gb|ABB63982.1| putative enzyme of LPS biosynthesis [Shigella dysenteriae Sd197]
 gi|308927896|gb|EFP73364.1| pantetheine-phosphate adenylyltransferase [Shigella dysenteriae
           1617]
          Length = 159

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 97/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F +++ER EL +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKTMF-TLEERVELAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHLGNVE-----VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVYQALMAKLA 159


>gi|89900457|ref|YP_522928.1| coenzyme A biosynthesis protein [Rhodoferax ferrireducens T118]
 gi|89345194|gb|ABD69397.1| Coenzyme A biosynthesis protein [Rhodoferax ferrireducens T118]
          Length = 166

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 55/166 (33%), Positives = 93/166 (56%), Gaps = 6/166 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            AVY G+FDPIT GH D++ +A    + +++A+     K K   S++ER  + ++++ H+
Sbjct: 6   IAVYPGTFDPITLGHEDVVRRATQLFDRVIVAVAAGHHK-KALFSLEERMAMTREAVKHY 64

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                  V V SF GL  +      A+ +VRGLR +TDFDYE ++  +NR L P++ T+ 
Sbjct: 65  PK-----VQVESFSGLLRDFVVSQGAKAMVRGLRAVTDFDYEFQLAGMNRSLMPDVETVF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           L   +  ++++ST +R + S+  ++  FV   V   L   V SL +
Sbjct: 120 LTPSDKYQFISSTFVREIASLGGEVDKFVSPSVNECLIEKVRSLAQ 165


>gi|269137428|ref|YP_003294128.1| phosphopantetheine adenylyltransferase [Edwardsiella tarda EIB202]
 gi|267983088|gb|ACY82917.1| phosphopantetheine adenylyltransferase [Edwardsiella tarda EIB202]
 gi|304557502|gb|ADM40166.1| Phosphopantetheine adenylyltransferase [Edwardsiella tarda FL6-60]
          Length = 161

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 50/166 (30%), Positives = 96/166 (57%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y G+FDP+TNGH+DI+ +A    + +++AI  +  K   F +++ER  + ++  
Sbjct: 1   MSRTAIYPGTFDPLTNGHLDIVTRAAHMFDRVILAIAASPGKRPLF-TLEERVAMAREVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V  F  L  + A+   A ++VRGLR ++DF+YE+++ ++NR L P + 
Sbjct: 60  AHLANVE-----VQGFSELMAHFAQRQRANILVRGLRAVSDFEYELQLANMNRHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           ++ L   E+  +++S+L++ +     D+ +F+P+PV   L   + +
Sbjct: 115 SVFLMPAEAWSFISSSLVKEVARHGGDVDAFLPEPVARTLMARLRN 160


>gi|258514454|ref|YP_003190676.1| pantetheine-phosphate adenylyltransferase [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257778159|gb|ACV62053.1| pantetheine-phosphate adenylyltransferase [Desulfotomaculum
           acetoxidans DSM 771]
          Length = 165

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 50/168 (29%), Positives = 83/168 (49%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY GSFDP+TNGH+D+I +A    + +++A+  N  K   F   +      + +  
Sbjct: 1   MRIGVYPGSFDPVTNGHLDVIERAALLFDRVIVAVSRNVSKNPLFTVSE------RVATL 54

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +      V V SF+GL    A+   AQ I+RGLR ++DF+ E  M   N+ +   + T
Sbjct: 55  QQVLIPYYNVVVDSFDGLTAFYARQQGAQAIIRGLRAISDFETEFMMALTNKKIVSSVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + L  +    +++S+ ++ L S    + + VP  V   L+      VK
Sbjct: 115 VFLMTRAEYSFISSSAVKELASFGGCVETMVPPLVEQKLREKFAFKVK 162


>gi|88797605|ref|ZP_01113194.1| phosphopantetheine adenylyltransferase [Reinekea sp. MED297]
 gi|88779777|gb|EAR10963.1| phosphopantetheine adenylyltransferase [Reinekea sp. MED297]
          Length = 161

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 52/166 (31%), Positives = 89/166 (53%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M    +Y G+FDPIT GHMD+I + L     +++A+  +  K   F S+ ER  L ++  
Sbjct: 1   MSSTVIYPGTFDPITLGHMDLIERGLRHFGKVIVAVADSPKKKPLF-SLDERVALAREVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V  F  L V+ A++ +AQVI+RGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  ESLGNVE-----VAGFSNLLVDFAREHNAQVILRGLRVVSDFEYEFQLANMNRVLAPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           ++ L   E   +++ST +R +  ++ D++  V   V   LK     
Sbjct: 115 SLFLTPSEQYSFISSTFVREIAYLNGDVSKMVHPAVEAALKKRFSQ 160


>gi|138894634|ref|YP_001125087.1| phosphopantetheine adenylyltransferase [Geobacillus
           thermodenitrificans NG80-2]
 gi|196247757|ref|ZP_03146459.1| pantetheine-phosphate adenylyltransferase [Geobacillus sp. G11MC16]
 gi|166216549|sp|A4ILY8|COAD_GEOTN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|134266147|gb|ABO66342.1| Phosphopantetheine adenylyltransferase [Geobacillus
           thermodenitrificans NG80-2]
 gi|196212541|gb|EDY07298.1| pantetheine-phosphate adenylyltransferase [Geobacillus sp. G11MC16]
          Length = 164

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 58/166 (34%), Positives = 92/166 (55%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDP+T GH+DII +     + + +A+  NS K   F +++ER EL+++  
Sbjct: 1   MASIAVCPGSFDPVTYGHLDIIKRGAKVFDQVYVAVLNNSSKKPLF-TVEERMELLREVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   + V V SF GL V+ A+   A  I+RGLR ++DF+YEM++TS+NR L   I 
Sbjct: 60  RTL-----DNVHVESFHGLLVDYARSKKANAILRGLRAVSDFEYEMQITSMNRVLDENIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T  +       +++S++++ +   + DI+  VP  V   LK    S
Sbjct: 115 TFFMMTNSQYAFLSSSIVKEVAKYNGDISELVPPVVEAALKRKFAS 160


>gi|94499819|ref|ZP_01306355.1| pantetheine-phosphate adenylyltransferase [Oceanobacter sp. RED65]
 gi|94428020|gb|EAT12994.1| pantetheine-phosphate adenylyltransferase [Oceanobacter sp. RED65]
          Length = 159

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 52/159 (32%), Positives = 91/159 (57%), Gaps = 6/159 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPITNGH D++ +A    + +V+A+  +  K   F  +  R +L ++ + 
Sbjct: 1   MTRVIYPGTFDPITNGHTDLVTRASKLFDHIVVAVADSPHKKPLF-DLDTRCQLAEEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          ++ F  L  +  ++ +AQV++RGLR ++DF+YE ++ ++NR L PE+ T
Sbjct: 60  HLDNVE-----IVGFNTLLAHFVREQNAQVLLRGLRAVSDFEYEFQLANMNRALAPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           + L   E   Y++STLIR +  ++ D+  FV   V   L
Sbjct: 115 VFLTPDERHSYISSTLIREIARLEGDVKKFVHPAVEQAL 153


>gi|300714653|ref|YP_003739456.1| Phosphopantetheine adenylyltransferase [Erwinia billingiae Eb661]
 gi|299060489|emb|CAX57596.1| Phosphopantetheine adenylyltransferase [Erwinia billingiae Eb661]
          Length = 158

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 58/164 (35%), Positives = 98/164 (59%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+DI+ +A    + +V+AI  +  K   F +++ER  L +Q +
Sbjct: 1   MSTKAIYPGTFDPMTNGHLDIVTRAALMFDRIVLAIAASPSKKPMF-TLEERVSLAQQVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A+D  A V+VRGLR ++DF+YEM++  +NR L PE+ 
Sbjct: 60  AHLPNVE-----VVGFSDLMANFARDQQANVLVRGLRAVSDFEYEMQLAHMNRHLLPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           ++ L   E   +++S+L++ +     D+++F+P PV   L+  +
Sbjct: 115 SVFLMPSEQYSFISSSLVKEVARHKGDVSAFLPQPVFDALQAKL 158


>gi|84684722|ref|ZP_01012622.1| pantetheine-phosphate adenylyltransferase [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667057|gb|EAQ13527.1| pantetheine-phosphate adenylyltransferase [Rhodobacterales
           bacterium HTCC2654]
          Length = 165

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 60/165 (36%), Positives = 92/165 (55%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F +++ER E+++    
Sbjct: 1   MRVALYPGTFDPITIGHIDIIKRACALVDRLVIGVAINRDKGPMF-TLEERVEMVEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L +N A D+ A +IVRGLR +TDF+YE +M  +NR L   I T
Sbjct: 60  ALSEQTGTEIVAHPFENLLINCAYDVGASIIVRGLRAVTDFEYEYQMVGMNRALDASIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A    + + S L++ +  +D D++ FV   V   L   +  
Sbjct: 120 VFLMADLKHQAIASKLVKEIARLDGDVSKFVTPDVKQRLYQKLGR 164


>gi|313904063|ref|ZP_07837443.1| pantetheine-phosphate adenylyltransferase [Eubacterium
           cellulosolvens 6]
 gi|313471212|gb|EFR66534.1| pantetheine-phosphate adenylyltransferase [Eubacterium
           cellulosolvens 6]
          Length = 161

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 61/164 (37%), Positives = 97/164 (59%), Gaps = 6/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH+DI+ +A    + ++I +  NS KT  F S+ ER  ++K++  
Sbjct: 1   MSIAVYPGTFDPVTYGHIDIVKRASKLFDTVIIGVLHNSAKTPLF-SVDERVNILKKATE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    V V +FEGL+V+ A++  A VIVRGLR +TDF+YE++M   N+ L P++ T
Sbjct: 60  DIPN-----VQVHAFEGLSVDFARECGANVIVRGLRLITDFEYELQMAQTNKKLAPDVDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
             LF      Y++ST ++ + +   DI+ FVP  V   + + + 
Sbjct: 115 TFLFTSLQYSYLSSTTVKEVAAFGGDISEFVPPFVAEQIHSKIK 158


>gi|170724446|ref|YP_001758472.1| phosphopantetheine adenylyltransferase [Shewanella woodyi ATCC
           51908]
 gi|229541046|sp|B1KL36|COAD_SHEWM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|169809793|gb|ACA84377.1| pantetheine-phosphate adenylyltransferase [Shewanella woodyi ATCC
           51908]
          Length = 158

 Score =  166 bits (420), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 58/163 (35%), Positives = 95/163 (58%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDP+TNGH D+I +A    + +VI I  N  K   F ++ ER +L+K   
Sbjct: 1   MHKRAIYPGTFDPVTNGHADLIERAAKLFQHVVIGIAANPSKQPRF-TLDERVQLLKLVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AKD  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHLDNVE-----VVGFSGLLVDFAKDQQASVLVRGLRAVSDFEYEFQLANMNRRLDPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           ++ L   E + +++STL++ +     D++ FV   V   L + 
Sbjct: 115 SVFLTPSEENSFISSTLVKEVALHGGDVSQFVHPEVSKALLSK 157


>gi|270157981|ref|ZP_06186638.1| phosphopantetheine adenylyltransferase [Legionella longbeachae
           D-4968]
 gi|289163753|ref|YP_003453891.1| pantetheine-phosphate adenylyltransferase [Legionella longbeachae
           NSW150]
 gi|269990006|gb|EEZ96260.1| phosphopantetheine adenylyltransferase [Legionella longbeachae
           D-4968]
 gi|288856926|emb|CBJ10740.1| pantetheine-phosphate adenylyltransferase [Legionella longbeachae
           NSW150]
          Length = 171

 Score =  166 bits (420), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 63/164 (38%), Positives = 100/164 (60%), Gaps = 7/164 (4%)

Query: 1   MMR-KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           MM+ KA+Y G+FDP+TNGH+DII +A     ++V+ +  N  K   FL ++ R  L+K+S
Sbjct: 7   MMKLKAIYPGTFDPVTNGHVDIITRAAKIFPEIVVGVASNRAKRP-FLPMETRINLLKES 65

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           + H        V V+ FE L ++   + +A +I+RGLR ++DF+YE ++  +NR L  +I
Sbjct: 66  LAHLP-----GVCVLGFENLLIDFVLEQNAGIILRGLRAVSDFEYEFQLAGMNRKLSKKI 120

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            TI L   E+  +++STL+R +  +D DI+ FVP  V   LK  
Sbjct: 121 ETIFLTPSENLMFISSTLVREIAFLDGDISQFVPACVVRELKKR 164


>gi|288958232|ref|YP_003448573.1| pantetheine-phosphate adenylyltransferase [Azospirillum sp. B510]
 gi|288910540|dbj|BAI72029.1| pantetheine-phosphate adenylyltransferase [Azospirillum sp. B510]
          Length = 187

 Score =  166 bits (420), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 52/163 (31%), Positives = 92/163 (56%), Gaps = 2/163 (1%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R  VY G+FDPITNGHMDII +A   V+ L+I +  N+ K   + + +  + + +     
Sbjct: 13  RIGVYPGTFDPITNGHMDIIQRAARQVDHLIIGVARNAGKGPLYSTDERVAMVREDVAA- 71

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
            +  +   + V +F+ L ++ A +++A+VI+RGLR ++DF+YE +M  +N  L P++ TI
Sbjct: 72  -LNAAGASIEVRAFDNLLMHFAIEMNARVIIRGLRAVSDFEYEFQMAGMNARLNPKVETI 130

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
            L + E  ++++S  ++ +  +  DI  FV   V   L     
Sbjct: 131 FLMSSEKHQFISSRFVKEIGRLGGDIRHFVSPRVAERLAERFA 173


>gi|134096060|ref|YP_001101135.1| phosphopantetheine adenylyltransferase [Herminiimonas
           arsenicoxydans]
 gi|166216552|sp|A4G927|COAD_HERAR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|133739963|emb|CAL63014.1| Phosphopantetheine adenylyltransferase (Pantetheine-phosphate
           adenylyltransferase) (PPAT) (Dephospho-CoA
           pyrophosphorylase) [Herminiimonas arsenicoxydans]
          Length = 163

 Score =  166 bits (420), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 52/168 (30%), Positives = 96/168 (57%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y G+FDP+T GH D++ +A    + L++ +  +  K   F S++ER  +  + + 
Sbjct: 1   MVTAIYPGTFDPLTRGHEDLVRRASGLFDKLIVGVADSKNKKPFF-SLEERLTISNEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+       V V SF GL  +  +   A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPN-----VHVESFSGLLKDFVRRHDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + L   +  ++++ T++R + ++  D++ FV   V  +LK  + +  +
Sbjct: 115 LFLTPSDQYQFISGTIVREIAALGGDVSKFVFPSVDKWLKEKIAAQEQ 162


>gi|215488913|ref|YP_002331344.1| phosphopantetheine adenylyltransferase [Escherichia coli O127:H6
           str. E2348/69]
 gi|312968025|ref|ZP_07782236.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           2362-75]
 gi|254764152|sp|B7ULI9|COAD_ECO27 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|215266985|emb|CAS11430.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O127:H6
           str. E2348/69]
 gi|312287284|gb|EFR15193.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           2362-75]
          Length = 159

 Score =  166 bits (420), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 97/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F +++ER EL +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMF-TLEERVELAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHLGSVE-----VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA 159


>gi|77361205|ref|YP_340780.1| phosphopantetheine adenylyltransferase (PPAT) (dephospho-CoA
           pyrophosphorylase) [Pseudoalteromonas haloplanktis
           TAC125]
 gi|123588470|sp|Q3IHU4|COAD_PSEHT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|76876116|emb|CAI87338.1| Phosphopantetheine adenylyltransferase (PPAT) (Dephospho-CoA
           pyrophosphorylase) [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 164

 Score =  166 bits (420), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 52/164 (31%), Positives = 95/164 (57%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+Y G+FDP+TNGH D+I +A    + +++AI  N  K   F   +      + ++
Sbjct: 1   MKITAIYPGTFDPLTNGHTDLIQRASKMFDTVIVAIAHNPSKQPCFSLDE------RVAL 54

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            + +    + V VI F GL  +LA+D +A V++RG+R ++DFDYE ++ ++NR L P++ 
Sbjct: 55  ANTLLTHIDNVKVIGFSGLLADLARDHNANVLIRGIRAVSDFDYEFQLANMNRRLNPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           ++ L   E + +++STL++ +   + D++ FV   V   L   +
Sbjct: 115 SVFLTPSERNSFISSTLVKEVARHNGDVSEFVDPIVMAALNKKL 158


>gi|269103923|ref|ZP_06156620.1| phosphopantetheine adenylyltransferase [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268163821|gb|EEZ42317.1| phosphopantetheine adenylyltransferase [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 162

 Score =  166 bits (420), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 95/165 (57%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDPITNGH+D+I +A +  + +++ +  N  K   F  + ER  L +   
Sbjct: 1   MTTRVIYPGTFDPITNGHLDLIERAAAMFDTVIVGVAYNPTKKPLF-DLDERVALAQSVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          ++ F GL VN AK+ +A V+VRGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 60  QHLPNVE-----IVGFSGLLVNFAKEHNANVLVRGLRAVSDFEYEFQLANMNRRLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T+ L   E + +++ST+++ +     D++ FVP  V + L   + 
Sbjct: 115 TVFLTPAEENSFISSTIVKEVALHKGDVSQFVPQEVSIQLYKKLA 159


>gi|261341757|ref|ZP_05969615.1| hypothetical protein ENTCAN_08236 [Enterobacter cancerogenus ATCC
           35316]
 gi|288316125|gb|EFC55063.1| pantetheine-phosphate adenylyltransferase [Enterobacter
           cancerogenus ATCC 35316]
          Length = 159

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 90/165 (54%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPITNGH+DII +A S  + +++AI  +  K   F   +      + ++
Sbjct: 1   MSTKAIYPGTFDPITNGHLDIITRAASMFDKVILAIAASPSKKPMFDLNE------RVAL 54

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     V V+ F  L  N A+   A +++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 55  ATDAISHLPNVEVVGFSDLMANFARAQQANILIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMEKLK 159


>gi|227115117|ref|ZP_03828773.1| phosphopantetheine adenylyltransferase [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 162

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 51/166 (30%), Positives = 93/166 (56%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+D++ +A    + +V+AI  +  K   F ++ ER  L K + 
Sbjct: 1   MTTKAIYPGTFDPLTNGHLDLLTRASRLFDHVVLAIAASPSKHTLF-TLDERVALAKGAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L V+ A+   A ++VRGLR + DF+YE+++  +N  L P + 
Sbjct: 60  QHLSNVE-----VVGFSDLMVHFAQQQKANILVRGLRAVADFEYELQLAKMNHHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           ++ L   E   +++S+L++ +     D++ F+PD +   L++ +  
Sbjct: 115 SVFLMPSEEWSFISSSLVKEVARHGGDVSHFLPDAIVSALQDKLSK 160


>gi|259906763|ref|YP_002647119.1| Phosphopantetheine adenylyltransferase [Erwinia pyrifoliae Ep1/96]
 gi|224962385|emb|CAX53840.1| Phosphopantetheine adenylyltransferase [Erwinia pyrifoliae Ep1/96]
 gi|283476549|emb|CAY72377.1| kdtB [Erwinia pyrifoliae DSM 12163]
          Length = 158

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 58/164 (35%), Positives = 92/164 (56%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+DI+ +A    + +V+AI  +  K   F S++ER  L  + +
Sbjct: 1   MSTKAIYPGTFDPMTNGHLDIVTRAARMFDRIVLAIAASPSKKPMF-SLEERVALASEVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N AK   A V+VRGLR ++DF+YEM++  +NR L P + 
Sbjct: 60  AHLPNVD-----VVGFSDLLANFAKAQQANVLVRGLRAVSDFEYEMQLAQMNRHLLPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           ++ L   E   +++S+L++ +     D+ SF+P  V   LK   
Sbjct: 115 SVFLMPSEQYAFISSSLMKEVARHGGDVESFLPTAVYQALKARF 158


>gi|71083678|ref|YP_266398.1| pantetheine-phosphate adenylyltransferase [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|123646547|sp|Q4FLZ4|COAD_PELUB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|71062791|gb|AAZ21794.1| pantetheine-phosphate adenylyltransferase [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 164

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 93/165 (56%), Gaps = 1/165 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + AVY G+FDPIT GH+D+I +AL   + ++IA    + K   F S++ R +LIK+++
Sbjct: 1   MKKVAVYPGTFDPITFGHIDVINKALKLFDKVIIAASDGANKNYLFNSLE-RVQLIKKAL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
           F  +     ++ VISF  L  +L K   + +I+RGLR ++DF+YE ++  +NR L   I 
Sbjct: 60  FVDLKFDKKKIEVISFTSLTTDLCKKYKSNIILRGLRAVSDFEYEFQLAGMNRKLNNNIE 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           TI L +   ++ ++S  ++ ++ +  DI  F        LK    
Sbjct: 120 TIFLMSDVENQIISSRFVKEIVRLKGDIKKFTTKSTIKSLKEKYE 164


>gi|291619453|ref|YP_003522195.1| CoaD [Pantoea ananatis LMG 20103]
 gi|291154483|gb|ADD79067.1| CoaD [Pantoea ananatis LMG 20103]
 gi|327395776|dbj|BAK13198.1| phosphopantetheine adenylyltransferase CoaD [Pantoea ananatis
           AJ13355]
          Length = 171

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 56/164 (34%), Positives = 92/164 (56%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPIT GH+DI+ +A    + LV+AI  +  K   F ++ ER  L +Q+ 
Sbjct: 13  MTTKAIYPGTFDPITLGHIDIVTRAAQMFDRLVVAIAASPSKKPLF-TLDERVALARQAT 71

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V  F  L  N A+   A ++VRGLR ++DF+YE ++  +NR L P + 
Sbjct: 72  AHLANVE-----VTGFSDLMANFARTQQANILVRGLRAVSDFEYETQLARMNRHLLPTLE 126

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           ++ L   E+  +++STL++ +     D+++F+P PV   L   +
Sbjct: 127 SVFLMPSENFSFISSTLVKEVARHGGDVSAFLPAPVHQALLAKL 170


>gi|186475079|ref|YP_001856549.1| phosphopantetheine adenylyltransferase [Burkholderia phymatum
           STM815]
 gi|229488126|sp|B2JCN4|COAD_BURP8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|184191538|gb|ACC69503.1| pantetheine-phosphate adenylyltransferase [Burkholderia phymatum
           STM815]
          Length = 168

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 55/168 (32%), Positives = 101/168 (60%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F +++ER E+  + + 
Sbjct: 1   MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRNKRPFF-NLEERLEIANEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+       V V+SF+GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPN-----VQVMSFKGLLKDFVRVNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + +   +  ++++ T++R +  +  D++ FV   V   L++ V +L +
Sbjct: 115 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKRLQDKVAALEQ 162


>gi|332084814|gb|EGI89997.1| pantetheine-phosphate adenylyltransferase [Shigella boydii 5216-82]
          Length = 159

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  N  K   F +++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAANPSKKPMF-TLEERVALAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHLGNVE-----VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA 159


>gi|258620581|ref|ZP_05715618.1| phosphopantetheine adenylyltransferase [Vibrio mimicus VM573]
 gi|258587096|gb|EEW11808.1| phosphopantetheine adenylyltransferase [Vibrio mimicus VM573]
          Length = 247

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 53/178 (29%), Positives = 91/178 (51%), Gaps = 6/178 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D++ +A    ++++IAI  +  K   F S+ ER    ++   H 
Sbjct: 8   RVIYPGTFDPITNGHLDLVERAAQMFDEVIIAIAASPSKNTMF-SLDERVHFAREVTAHL 66

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
              ++       F GL V+ A+   A V++RGLR   DF+YE  +T++ R L P + ++ 
Sbjct: 67  DNVTAK-----GFSGLLVDFAQTEKANVLIRGLRTTVDFEYEFGLTNMYRRLMPGLESVF 121

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTIF 181
           L   E   +++ST++R +     ++  FVP  V   L     +L         P+  F
Sbjct: 122 LTPSEEHAFISSTIVREVAIHGGNVDEFVPSIVAEALHQKEKNLELQRDENQHPSIPF 179


>gi|83595879|gb|ABC25241.1| pantetheine-phosphate adenylyltransferase [uncultured marine
           bacterium Ant4D3]
          Length = 162

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 54/167 (32%), Positives = 93/167 (55%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KA+Y G+FDP+T+GH+D+I +A    E++V+A+  +  K      +++R EL +    
Sbjct: 1   MNKAIYPGTFDPVTHGHVDLIQRASKLFEEVVVAVAESPTKRPML-DLKKRVELTRIITE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +     VI F GL   L     A +I+RGLR ++DF+YE ++  +NR L P++ +
Sbjct: 60  PLGNVT-----VIGFSGLLTELLTQQGANIILRGLRAVSDFEYEFQLAKMNRVLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L   E   +++STL+R + S+  D++ FV   V   L+  +  L 
Sbjct: 115 MFLTPAEKHSFISSTLVREIASLGGDVSQFVHPLVAEELRQHLSKLR 161


>gi|119387181|ref|YP_918236.1| pantetheine-phosphate adenylyltransferase [Paracoccus denitrificans
           PD1222]
 gi|189082578|sp|A1BAJ6|COAD_PARDP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|119377776|gb|ABL72540.1| pantetheine-phosphate adenylyltransferase [Paracoccus denitrificans
           PD1222]
          Length = 164

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 89/165 (53%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH DII +AL  V+ LVI +  N  K+  F  +++R  ++++   
Sbjct: 1   MRIGLYPGTFDPITLGHQDIIQRALELVDRLVIGVAINRDKSPLFA-LEDRVAMVREECD 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +      + V  FE L ++ A+D+ A VIVRGLR + DF+YE +M  +NR +   I T
Sbjct: 60  RIVAKRGGEIVVHPFENLLIDCARDVGATVIVRGLRAVADFEYEFQMVGMNRAMDDSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A    + + S L++ +  +  D++ FV   V   L      
Sbjct: 120 VFLMADARRQAIASKLVKEIARLGGDVSKFVSPTVRDALVGRFAR 164


>gi|317494723|ref|ZP_07953135.1| pantetheine-phosphate adenylyltransferase [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316917325|gb|EFV38672.1| pantetheine-phosphate adenylyltransferase [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 159

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 51/165 (30%), Positives = 95/165 (57%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDP+TNGH+D++ +A S  + +++AI  +  K   F +++ER  L  Q  
Sbjct: 1   MEKRAIYPGTFDPMTNGHLDLVTRAASMFDHVILAIAASPSKKPMF-TLEERVALATQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  + A+  +A ++VRGLR ++DF+YEM++ ++NR L P + 
Sbjct: 60  AHLPNVE-----VLGFSELMAHFAQHQNAHILVRGLRAVSDFEYEMQLANMNRHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     DI  FVP+ +   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHGGDIAPFVPEQIAQALGEKLA 159


>gi|15804175|ref|NP_290214.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           EDL933]
 gi|15833763|ref|NP_312536.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. Sakai]
 gi|16131505|ref|NP_418091.1| pantetheine-phosphate adenylyltransferase [Escherichia coli str.
           K-12 substr. MG1655]
 gi|24114903|ref|NP_709413.1| phosphopantetheine adenylyltransferase [Shigella flexneri 2a str.
           301]
 gi|30065090|ref|NP_839261.1| phosphopantetheine adenylyltransferase [Shigella flexneri 2a str.
           2457T]
 gi|82545997|ref|YP_409944.1| phosphopantetheine adenylyltransferase [Shigella boydii Sb227]
 gi|89110377|ref|AP_004157.1| pantetheine-phosphate adenylyltransferase [Escherichia coli str.
           K-12 substr. W3110]
 gi|110807688|ref|YP_691208.1| phosphopantetheine adenylyltransferase [Shigella flexneri 5 str.
           8401]
 gi|157158987|ref|YP_001465114.1| phosphopantetheine adenylyltransferase [Escherichia coli E24377A]
 gi|157163115|ref|YP_001460433.1| phosphopantetheine adenylyltransferase [Escherichia coli HS]
 gi|168748718|ref|ZP_02773740.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4113]
 gi|168753458|ref|ZP_02778465.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4401]
 gi|168759731|ref|ZP_02784738.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4501]
 gi|168766054|ref|ZP_02791061.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4486]
 gi|168772400|ref|ZP_02797407.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4196]
 gi|168779789|ref|ZP_02804796.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4076]
 gi|168785510|ref|ZP_02810517.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC869]
 gi|170018136|ref|YP_001723090.1| phosphopantetheine adenylyltransferase [Escherichia coli ATCC 8739]
 gi|170083142|ref|YP_001732462.1| pantetheine-phosphate adenylyltransferase [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170682523|ref|YP_001745934.1| phosphopantetheine adenylyltransferase [Escherichia coli SMS-3-5]
 gi|187730134|ref|YP_001882331.1| phosphopantetheine adenylyltransferase [Shigella boydii CDC
           3083-94]
 gi|188491996|ref|ZP_02999266.1| pantetheine-phosphate adenylyltransferase [Escherichia coli 53638]
 gi|191167828|ref|ZP_03029634.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B7A]
 gi|193063853|ref|ZP_03044940.1| pantetheine-phosphate adenylyltransferase [Escherichia coli E22]
 gi|193070368|ref|ZP_03051310.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           E110019]
 gi|194430622|ref|ZP_03063076.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B171]
 gi|194435652|ref|ZP_03067755.1| pantetheine-phosphate adenylyltransferase [Escherichia coli 101-1]
 gi|195936195|ref|ZP_03081577.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. EC4024]
 gi|208809610|ref|ZP_03251947.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4206]
 gi|208814470|ref|ZP_03255799.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4045]
 gi|209395850|ref|YP_002273112.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4115]
 gi|209921105|ref|YP_002295189.1| phosphopantetheine adenylyltransferase [Escherichia coli SE11]
 gi|217326368|ref|ZP_03442452.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. TW14588]
 gi|218556196|ref|YP_002389109.1| phosphopantetheine adenylyltransferase [Escherichia coli IAI1]
 gi|218697355|ref|YP_002405022.1| phosphopantetheine adenylyltransferase [Escherichia coli 55989]
 gi|238902725|ref|YP_002928521.1| pantetheine-phosphate adenylyltransferase [Escherichia coli BW2952]
 gi|253771525|ref|YP_003034356.1| phosphopantetheine adenylyltransferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254163562|ref|YP_003046670.1| phosphopantetheine adenylyltransferase [Escherichia coli B str.
           REL606]
 gi|254795589|ref|YP_003080426.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. TW14359]
 gi|256021362|ref|ZP_05435227.1| phosphopantetheine adenylyltransferase [Shigella sp. D9]
 gi|260846601|ref|YP_003224379.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O103:H2
           str. 12009]
 gi|260857971|ref|YP_003231862.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O26:H11
           str. 11368]
 gi|260870364|ref|YP_003236766.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O111:H-
           str. 11128]
 gi|261224183|ref|ZP_05938464.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261254794|ref|ZP_05947327.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. FRIK966]
 gi|291285005|ref|YP_003501823.1| Phosphopantetheine adenylyltransferase [Escherichia coli O55:H7
           str. CB9615]
 gi|293463958|ref|ZP_06664372.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B088]
 gi|297518692|ref|ZP_06937078.1| phosphopantetheine adenylyltransferase [Escherichia coli OP50]
 gi|300815127|ref|ZP_07095352.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           107-1]
 gi|300822404|ref|ZP_07102544.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           119-7]
 gi|300907675|ref|ZP_07125303.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           84-1]
 gi|300919799|ref|ZP_07136274.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           115-1]
 gi|300923418|ref|ZP_07139459.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           182-1]
 gi|300927936|ref|ZP_07143495.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           187-1]
 gi|300939233|ref|ZP_07153913.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           21-1]
 gi|301303867|ref|ZP_07209986.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           124-1]
 gi|301325316|ref|ZP_07218823.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           78-1]
 gi|307314281|ref|ZP_07593889.1| pantetheine-phosphate adenylyltransferase [Escherichia coli W]
 gi|309797625|ref|ZP_07692013.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           145-7]
 gi|331670474|ref|ZP_08371313.1| pantetheine-phosphate adenylyltransferase [Escherichia coli TA271]
 gi|331675114|ref|ZP_08375871.1| pantetheine-phosphate adenylyltransferase [Escherichia coli TA280]
 gi|331679725|ref|ZP_08380395.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H591]
 gi|331685297|ref|ZP_08385883.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H299]
 gi|62288044|sp|P0A6I6|COAD_ECOLI RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|62288045|sp|P0A6I7|COAD_ECO57 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|62288046|sp|P0A6I8|COAD_SHIFL RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|122957051|sp|Q0SYG2|COAD_SHIF8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|123558303|sp|Q31UZ2|COAD_SHIBS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|167009042|sp|A7ZTI5|COAD_ECO24 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|167009043|sp|A8A696|COAD_ECOHS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|189082568|sp|B1IZF9|COAD_ECOLC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226706696|sp|B7M4B8|COAD_ECO8A RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226706698|sp|B1LK71|COAD_ECOSM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226709004|sp|B5YWD2|COAD_ECO5E RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226709005|sp|B6I3L1|COAD_ECOSE RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229488305|sp|B1X968|COAD_ECODH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541045|sp|B2TTU8|COAD_SHIB3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254764153|sp|B7L747|COAD_ECO55 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|259491309|sp|C4ZXM6|COAD_ECOBW RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|7767003|pdb|1B6T|A Chain A, Phosphopantetheine Adenylyltransferase In Complex With 3'-
           Dephospho-Coa From Escherichia Coli
 gi|7767004|pdb|1B6T|B Chain B, Phosphopantetheine Adenylyltransferase In Complex With 3'-
           Dephospho-Coa From Escherichia Coli
 gi|18655796|pdb|1GN8|A Chain A, Phosphopantetheine Adenylyltransferase In Complex With
           Mn2+ Atp From Escherichia Coli
 gi|18655797|pdb|1GN8|B Chain B, Phosphopantetheine Adenylyltransferase In Complex With
           Mn2+ Atp From Escherichia Coli
 gi|73535259|pdb|1H1T|A Chain A, Phosphopantetheine Adenylyltransferase In Complex With
           Coenzyme A From Escherichia Coli
 gi|73535260|pdb|1H1T|B Chain B, Phosphopantetheine Adenylyltransferase In Complex With
           Coenzyme A From Escherichia Coli
 gi|12518390|gb|AAG58778.1|AE005591_2 putative enzyme of LPS biosynthesis [Escherichia coli O157:H7 str.
           EDL933]
 gi|146544|gb|AAA03746.1| 18 kD protein [Escherichia coli]
 gi|146557|gb|AAA24044.1| 18 kD protein [Escherichia coli]
 gi|466772|gb|AAB18611.1| 4th start codon [Escherichia coli str. K-12 substr. MG1655]
 gi|1790065|gb|AAC76658.1| pantetheine-phosphate adenylyltransferase [Escherichia coli str.
           K-12 substr. MG1655]
 gi|13363984|dbj|BAB37932.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. Sakai]
 gi|24054145|gb|AAN45120.1| putative enzyme of lipopolysaccharide synthesis [Shigella flexneri
           2a str. 301]
 gi|30043351|gb|AAP19072.1| putative enzyme of lipopolysaccharide synthesis [Shigella flexneri
           2a str. 2457T]
 gi|81247408|gb|ABB68116.1| putative enzyme of lipopolysaccharide synthesis [Shigella boydii
           Sb227]
 gi|85676408|dbj|BAE77658.1| pantetheine-phosphate adenylyltransferase [Escherichia coli str.
           K12 substr. W3110]
 gi|110617236|gb|ABF05903.1| putative enzyme of lipopolysaccharide synthesis [Shigella flexneri
           5 str. 8401]
 gi|157068795|gb|ABV08050.1| pantetheine-phosphate adenylyltransferase [Escherichia coli HS]
 gi|157081017|gb|ABV20725.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           E24377A]
 gi|169753064|gb|ACA75763.1| pantetheine-phosphate adenylyltransferase [Escherichia coli ATCC
           8739]
 gi|169890977|gb|ACB04684.1| pantetheine-phosphate adenylyltransferase [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170520241|gb|ACB18419.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           SMS-3-5]
 gi|187427126|gb|ACD06400.1| pantetheine-phosphate adenylyltransferase [Shigella boydii CDC
           3083-94]
 gi|187771704|gb|EDU35548.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4196]
 gi|188016909|gb|EDU55031.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4113]
 gi|188487195|gb|EDU62298.1| pantetheine-phosphate adenylyltransferase [Escherichia coli 53638]
 gi|189002466|gb|EDU71452.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4076]
 gi|189358865|gb|EDU77284.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4401]
 gi|189364404|gb|EDU82823.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4486]
 gi|189369785|gb|EDU88201.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4501]
 gi|189374680|gb|EDU93096.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC869]
 gi|190902171|gb|EDV61914.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B7A]
 gi|192930568|gb|EDV83175.1| pantetheine-phosphate adenylyltransferase [Escherichia coli E22]
 gi|192956307|gb|EDV86768.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           E110019]
 gi|194411334|gb|EDX27702.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B171]
 gi|194425195|gb|EDX41179.1| pantetheine-phosphate adenylyltransferase [Escherichia coli 101-1]
 gi|208729411|gb|EDZ79012.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4206]
 gi|208735747|gb|EDZ84434.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4045]
 gi|209157250|gb|ACI34683.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4115]
 gi|209754678|gb|ACI75651.1| phosphopantetheine adenylyltransferase [Escherichia coli]
 gi|209754680|gb|ACI75652.1| phosphopantetheine adenylyltransferase [Escherichia coli]
 gi|209754682|gb|ACI75653.1| phosphopantetheine adenylyltransferase [Escherichia coli]
 gi|209754684|gb|ACI75654.1| phosphopantetheine adenylyltransferase [Escherichia coli]
 gi|209754686|gb|ACI75655.1| phosphopantetheine adenylyltransferase [Escherichia coli]
 gi|209914364|dbj|BAG79438.1| phosphopantetheine adenylyltransferase [Escherichia coli SE11]
 gi|217322589|gb|EEC31013.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. TW14588]
 gi|218354087|emb|CAV00636.1| pantetheine-phosphate adenylyltransferase [Escherichia coli 55989]
 gi|218362964|emb|CAR00601.1| pantetheine-phosphate adenylyltransferase [Escherichia coli IAI1]
 gi|224613061|dbj|BAH24281.1| phosphopantetheine adenyltransferase [Escherichia coli B]
 gi|238861973|gb|ACR63971.1| pantetheine-phosphate adenylyltransferase [Escherichia coli BW2952]
 gi|242379158|emb|CAQ33960.1| pantetheine-phosphate adenylyltransferase monomer, subunit of
           phosphopantetheine adenylyltransferase [Escherichia coli
           BL21(DE3)]
 gi|253322569|gb|ACT27171.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975463|gb|ACT41134.1| phosphopantetheine adenylyltransferase [Escherichia coli B str.
           REL606]
 gi|253979619|gb|ACT45289.1| phosphopantetheine adenylyltransferase [Escherichia coli BL21(DE3)]
 gi|254594989|gb|ACT74350.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. TW14359]
 gi|257756620|dbj|BAI28122.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O26:H11
           str. 11368]
 gi|257761748|dbj|BAI33245.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O103:H2
           str. 12009]
 gi|257766720|dbj|BAI38215.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O111:H-
           str. 11128]
 gi|260447347|gb|ACX37769.1| pantetheine-phosphate adenylyltransferase [Escherichia coli DH1]
 gi|281602997|gb|ADA75981.1| Phosphopantetheine adenylyltransferase [Shigella flexneri 2002017]
 gi|284923667|emb|CBG36764.1| phosphopantetheine adenylyltransferase [Escherichia coli 042]
 gi|290764878|gb|ADD58839.1| Phosphopantetheine adenylyltransferase [Escherichia coli O55:H7
           str. CB9615]
 gi|291321590|gb|EFE61026.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B088]
 gi|300400611|gb|EFJ84149.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           84-1]
 gi|300413152|gb|EFJ96462.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           115-1]
 gi|300420328|gb|EFK03639.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           182-1]
 gi|300455875|gb|EFK19368.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           21-1]
 gi|300464028|gb|EFK27521.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           187-1]
 gi|300525051|gb|EFK46120.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           119-7]
 gi|300532019|gb|EFK53081.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           107-1]
 gi|300840830|gb|EFK68590.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           124-1]
 gi|300847843|gb|EFK75603.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           78-1]
 gi|306906104|gb|EFN36623.1| pantetheine-phosphate adenylyltransferase [Escherichia coli W]
 gi|308118812|gb|EFO56074.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           145-7]
 gi|313647492|gb|EFS11942.1| pantetheine-phosphate adenylyltransferase [Shigella flexneri 2a
           str. 2457T]
 gi|315062922|gb|ADT77249.1| pantetheine-phosphate adenylyltransferase [Escherichia coli W]
 gi|315138216|dbj|BAJ45375.1| phosphopantetheine adenylyltransferase [Escherichia coli DH1]
 gi|315254020|gb|EFU33988.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           85-1]
 gi|320176307|gb|EFW51367.1| Phosphopantetheine adenylyltransferase [Shigella dysenteriae CDC
           74-1112]
 gi|320186826|gb|EFW61546.1| Phosphopantetheine adenylyltransferase [Shigella flexneri CDC
           796-83]
 gi|320191315|gb|EFW65965.1| Phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. EC1212]
 gi|320639541|gb|EFX09149.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. G5101]
 gi|320644980|gb|EFX14010.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H-
           str. 493-89]
 gi|320650247|gb|EFX18736.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H-
           str. H 2687]
 gi|320655599|gb|EFX23527.1| phosphopantetheine adenylyltransferase [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320661333|gb|EFX28757.1| phosphopantetheine adenylyltransferase [Escherichia coli O55:H7
           str. USDA 5905]
 gi|323155285|gb|EFZ41468.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           EPECa14]
 gi|323160758|gb|EFZ46694.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           E128010]
 gi|323173226|gb|EFZ58855.1| pantetheine-phosphate adenylyltransferase [Escherichia coli LT-68]
 gi|323179396|gb|EFZ64963.1| pantetheine-phosphate adenylyltransferase [Escherichia coli 1180]
 gi|323182662|gb|EFZ68065.1| pantetheine-phosphate adenylyltransferase [Escherichia coli 1357]
 gi|323376485|gb|ADX48753.1| pantetheine-phosphate adenylyltransferase [Escherichia coli KO11]
 gi|323944087|gb|EGB40167.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H120]
 gi|323959882|gb|EGB55530.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H489]
 gi|323971276|gb|EGB66521.1| pantetheine-phosphate adenylyltransferase [Escherichia coli TA007]
 gi|324019743|gb|EGB88962.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           117-3]
 gi|324116027|gb|EGC09953.1| pantetheine-phosphate adenylyltransferase [Escherichia coli E1167]
 gi|326337367|gb|EGD61202.1| Phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. 1044]
 gi|326339892|gb|EGD63699.1| Phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. 1125]
 gi|331062536|gb|EGI34456.1| pantetheine-phosphate adenylyltransferase [Escherichia coli TA271]
 gi|331068023|gb|EGI39421.1| pantetheine-phosphate adenylyltransferase [Escherichia coli TA280]
 gi|331072897|gb|EGI44222.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H591]
 gi|331077668|gb|EGI48880.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H299]
 gi|332089486|gb|EGI94590.1| pantetheine-phosphate adenylyltransferase [Shigella boydii 3594-74]
 gi|332104948|gb|EGJ08294.1| pantetheine-phosphate adenylyltransferase [Shigella sp. D9]
          Length = 159

 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F +++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMF-TLEERVALAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHLGNVE-----VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA 159


>gi|255262985|ref|ZP_05342327.1| pantetheine-phosphate adenylyltransferase [Thalassiobium sp. R2A62]
 gi|255105320|gb|EET47994.1| pantetheine-phosphate adenylyltransferase [Thalassiobium sp. R2A62]
          Length = 165

 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 89/165 (53%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +AL  V+ LVI +  N  K   F  ++ER  +++    
Sbjct: 1   MRIGLYPGTFDPITMGHLDIIRRALVLVDRLVIGVAINRDKGPLF-DLEERVAMVEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                S   + V  FE L ++ A+D+ A +I+RGLR + DF+YE +M  +NR L   I T
Sbjct: 60  KLSEASGVEIVVHPFENLLIDCARDVGAGIIIRGLRAVADFEYEYQMVGMNRQLDNTIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A+   + + S L++ +  +  D++ FV   +   L      
Sbjct: 120 VFLMAEAEHQAIASKLVKEISRLGGDVSKFVTPEIRAALDAKFDR 164


>gi|161505739|ref|YP_001572851.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|189082585|sp|A9MKP0|COAD_SALAR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|160867086|gb|ABX23709.1| hypothetical protein SARI_03915 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 159

 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 95/165 (57%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F ++ ER  L +++ 
Sbjct: 1   MQKRAIYPGTFDPITNGHLDIVTRATQMFDHVILAIAASPGKNPMF-TLDERVALAQKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V  F  L  N A+D  A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHLSNVE-----VAGFSDLMANFARDRQANILIRGLRAVADFEYEMQLAHMNRHLMPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+PD V   L N + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPDNVHQALMNKLK 159


>gi|310765973|gb|ADP10923.1| Phosphopantetheine adenylyltransferase [Erwinia sp. Ejp617]
          Length = 158

 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 58/164 (35%), Positives = 92/164 (56%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+DI+ +A    + +V+AI  +  K   F S++ER  L  + +
Sbjct: 1   MSTKAIYPGTFDPMTNGHLDIVTRAARIFDRIVLAIAASPSKKPMF-SLEERVALASEVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N AK   A V+VRGLR ++DF+YEM++  +NR L P + 
Sbjct: 60  AHLPNVD-----VVGFSDLLANFAKAQQANVLVRGLRAVSDFEYEMQLAQMNRHLLPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           ++ L   E   +++S+L++ +     D+ SF+P  V   LK   
Sbjct: 115 SVFLMPSEQYAFISSSLMKEVARHGGDVESFLPTAVYRALKARF 158


>gi|256823446|ref|YP_003147409.1| pantetheine-phosphate adenylyltransferase [Kangiella koreensis DSM
           16069]
 gi|256796985|gb|ACV27641.1| pantetheine-phosphate adenylyltransferase [Kangiella koreensis DSM
           16069]
          Length = 160

 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 56/166 (33%), Positives = 96/166 (57%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +  +Y G+FDPIT GHMD++ +A    + ++IAI  +  K   F S+ ER ++++   
Sbjct: 1   MKKTVLYPGTFDPITKGHMDLVNRACRLFDKVIIAIAHSPSKKPLF-SLDERVDMVRMIF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V+ F GL  N AK+ SA  I+RG+R ++DF++E ++ ++NR L P++ 
Sbjct: 60  ADNPQVE-----VLGFRGLLANFAKENSAIAILRGIRAVSDFEFEFQLANMNRHLDPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           +I L   E   Y++S+L+R + S+  DI++FV + V   L +   S
Sbjct: 115 SIFLTPSEKYSYISSSLVREVASLGGDISAFVDERVEQALLDKFKS 160


>gi|260779656|ref|ZP_05888546.1| phosphopantetheine adenylyltransferase [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260604465|gb|EEX30769.1| phosphopantetheine adenylyltransferase [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 164

 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 58/167 (34%), Positives = 94/167 (56%), Gaps = 10/167 (5%)

Query: 1   MMR----KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELI 56
           M +    + +Y G+FDPITNGH+D+I +A    ++++IA+  +  K   F +++ER    
Sbjct: 1   MSKKRLSRVIYPGTFDPITNGHLDLIERAADMFDEVIIAVAASPSKNTMF-TLEERVTFA 59

Query: 57  KQSIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLC 116
           +Q   H    SS       F GL V+ AK  +A V++RGLR   DF+YE  +T++ R L 
Sbjct: 60  QQVTQHLDNVSSK-----GFSGLMVDFAKQENANVLIRGLRTTVDFEYEFGLTNMYRRLM 114

Query: 117 PEIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           P + ++ L   E   +++ST++R +     D+T+FVP  V   LKN 
Sbjct: 115 PGLESVFLTPAEEHAFISSTIVREVAIHGGDVTNFVPKAVAEALKNK 161


>gi|291563380|emb|CBL42196.1| pantetheine-phosphate adenylyltransferase, bacterial
           [butyrate-producing bacterium SS3/4]
          Length = 165

 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 54/167 (32%), Positives = 93/167 (55%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+T GH+D+I +A    + L+I +  N  KT  F S++ER +++++   
Sbjct: 1   MKTAIYPGSFDPVTLGHIDVIKRASKLFDHLIIGVLNNRAKTPLF-SVEERVKMLEEVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V SF GL V+ AK+ +A  +VRGLR +TDF+YE+++  +NR +   I T
Sbjct: 60  DIPNVE-----VKSFAGLTVDFAKECNANAVVRGLRAITDFEYELQIAQLNRVMDTSIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L       Y++S+ ++ + +   DI++FV   V   +   +    
Sbjct: 115 VFLTTSLEYAYLSSSTVKEVAAYGGDISNFVTPYVADEVHKRLRERQ 161


>gi|324111528|gb|EGC05509.1| pantetheine-phosphate adenylyltransferase [Escherichia fergusonii
           B253]
 gi|325499441|gb|EGC97300.1| phosphopantetheine adenylyltransferase [Escherichia fergusonii
           ECD227]
          Length = 159

 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 95/165 (57%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F +++ER  L + + 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMF-TLEERVALAQHAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            +          V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  ANLGNVE-----VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA 159


>gi|167646832|ref|YP_001684495.1| phosphopantetheine adenylyltransferase [Caulobacter sp. K31]
 gi|189082558|sp|B0SZS4|COAD_CAUSK RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|167349262|gb|ABZ71997.1| pantetheine-phosphate adenylyltransferase [Caulobacter sp. K31]
          Length = 162

 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 58/165 (35%), Positives = 96/165 (58%), Gaps = 3/165 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+TNGH+DII +A+  V+ LVI +  N  K   F +++ER   +++   
Sbjct: 1   MRIGLYPGTFDPVTNGHLDIIGRAVKLVDKLVIGVAVNIGKGPLF-TLEERVATLERETA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H       ++ V  F+ L +  A+++ AQ+IVRGLR + DF+YE +MT++N+ L  EI T
Sbjct: 60  HLTK--IAQIEVRPFDTLLMYFAREVGAQMIVRGLRAVADFEYEFQMTAMNQQLDREIET 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A    + + S L++ + ++  D+  FVP  V   L   +  
Sbjct: 118 VFLMADPRHQAIASRLVKEIAALGGDVHKFVPPGVAEQLLAKLAK 162


>gi|152976344|ref|YP_001375861.1| phosphopantetheine adenylyltransferase [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|189082554|sp|A7GRV8|COAD_BACCN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|152025096|gb|ABS22866.1| pantetheine-phosphate adenylyltransferase [Bacillus cytotoxicus NVH
           391-98]
          Length = 163

 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 56/169 (33%), Positives = 93/169 (55%), Gaps = 6/169 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+ +GSFDPIT GH+DII +     +++ + +  NS K   F S++ER ELI+++ 
Sbjct: 1   MTSIAISSGSFDPITLGHLDIIKRGAKVFDEVYVVVLNNSAKKPFF-SVEERLELIREAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V S  GL V  AK  +A  I+RGLR ++DF+YEM++TS+NR L   I 
Sbjct: 60  KEIPNVK-----VDSHSGLLVEYAKMRNANAILRGLRAVSDFEYEMQITSMNRKLDENIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           T  +       +++S++++ +     +++  VP  V   LK+   + +K
Sbjct: 115 TFFIMTNNQYSFLSSSIVKEVARYGGNVSGLVPSCVERALKDKFQTPLK 163


>gi|74314132|ref|YP_312551.1| phosphopantetheine adenylyltransferase [Shigella sonnei Ss046]
 gi|123615829|sp|Q3YVZ6|COAD_SHISS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|73857609|gb|AAZ90316.1| putative enzyme of lipopolysaccharide synthesis [Shigella sonnei
           Ss046]
 gi|323166883|gb|EFZ52622.1| pantetheine-phosphate adenylyltransferase [Shigella sonnei 53G]
          Length = 159

 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F +++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMF-TLEERVALTQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHLGNVE-----VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALVAKLA 159


>gi|194431310|ref|ZP_03063603.1| pantetheine-phosphate adenylyltransferase [Shigella dysenteriae
           1012]
 gi|194420765|gb|EDX36841.1| pantetheine-phosphate adenylyltransferase [Shigella dysenteriae
           1012]
 gi|320179970|gb|EFW54912.1| Phosphopantetheine adenylyltransferase [Shigella boydii ATCC 9905]
 gi|332084478|gb|EGI89673.1| pantetheine-phosphate adenylyltransferase [Shigella dysenteriae
           155-74]
          Length = 159

 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F +++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMF-TLEERVALAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHLGNVE-----VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 115 SVFLMPPKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA 159


>gi|259419032|ref|ZP_05742949.1| pantetheine-phosphate adenylyltransferase [Silicibacter sp.
           TrichCH4B]
 gi|259345254|gb|EEW57108.1| pantetheine-phosphate adenylyltransferase [Silicibacter sp.
           TrichCH4B]
          Length = 165

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 59/163 (36%), Positives = 90/163 (55%), Gaps = 1/163 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A   V+ LVI +  N  K   F  ++ER  +I+    
Sbjct: 1   MRIGLYPGTFDPITLGHIDIIRRAAMLVDRLVIGVAINRDKGPLF-DLEERVAMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L ++ A+D+ AQVIVRGLR + DF+YE +M  +NR L   I T
Sbjct: 60  KLTEQTGTEIIAHPFENLLIDCARDVGAQVIVRGLRAVADFEYEFQMVGMNRALDDSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L A+   + + S L++ +  +D D++ FV   V   L   +
Sbjct: 120 VFLMAEARHQAIASKLVKEIARLDGDVSKFVTPLVRDRLMERL 162


>gi|119773252|ref|YP_925992.1| pantetheine-phosphate adenylyltransferase [Shewanella amazonensis
           SB2B]
 gi|119765752|gb|ABL98322.1| Pantetheine-phosphate adenylyltransferase [Shewanella amazonensis
           SB2B]
          Length = 189

 Score =  165 bits (417), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 57/160 (35%), Positives = 96/160 (60%), Gaps = 6/160 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDP+TNGH D+I +A +  + +VI +  +  K   F S+++R EL+K+  
Sbjct: 29  MHTRAIYPGTFDPVTNGHADLIERAANLFKHVVIGVAASPSKQPKF-SLEKRVELLKKVT 87

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AKD  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 88  AHLDNVE-----VVGFTGLLVDFAKDQQASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 142

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           ++ L   E + +++STL++ +     D++ FV   V   L
Sbjct: 143 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPDVAAEL 182


>gi|295675396|ref|YP_003603920.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp.
           CCGE1002]
 gi|295435239|gb|ADG14409.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp.
           CCGE1002]
          Length = 169

 Score =  165 bits (417), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 55/167 (32%), Positives = 95/167 (56%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F   +      + +I 
Sbjct: 1   MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFFTLQE------RLAIA 54

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +      V V+SF+GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 55  HEVLGHYPNVQVMSFKGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + +   +  ++++ T++R +  +  D++ FV   V  +LK  V SL 
Sbjct: 115 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLKEKVASLD 161


>gi|291522175|emb|CBK80468.1| pantetheine-phosphate adenylyltransferase, bacterial [Coprococcus
           catus GD/7]
          Length = 167

 Score =  165 bits (417), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 62/174 (35%), Positives = 96/174 (55%), Gaps = 8/174 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDP+T GH+DII ++   V+ L+I +  NS KT  F S++ER  ++K+   
Sbjct: 1   MRTAIYPGSFDPVTYGHIDIIKRSAKMVDKLIIGVLSNSSKTPLF-SVEERVNMLKEVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V SF GL ++ A   +A++IVRGLR +TDF+YE++    NR + P + T
Sbjct: 60  DIPNVE-----VTSFAGLLIDFADACNAKIIVRGLRAVTDFEYELQWAQANRAVRPHLDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKL 175
           + L       Y++S+ +R L     D++ FVP  V   L   + S  K +  + 
Sbjct: 115 LFLVTNVEYSYLSSSAVRELARYHGDVSLFVPPYVEQKLDEKLDS--KENEHEQ 166


>gi|254283936|ref|ZP_04958904.1| pantetheine-phosphate adenylyltransferase [gamma proteobacterium
           NOR51-B]
 gi|219680139|gb|EED36488.1| pantetheine-phosphate adenylyltransferase [gamma proteobacterium
           NOR51-B]
          Length = 164

 Score =  165 bits (417), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 55/170 (32%), Positives = 88/170 (51%), Gaps = 8/170 (4%)

Query: 2   MRK--AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           MR    VY G+FDPITNGH+D+I +A    + +V+AI  +  K   F  I+ER  L K  
Sbjct: 1   MRTHTVVYPGTFDPITNGHVDLIERAARLFDRVVVAIATSDRKGPLFA-IEERVALAKTV 59

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           + H          V  F  L     +   +  ++RGLR + DF+YE ++ ++NR + P+ 
Sbjct: 60  LSHLDNIE-----VTGFNILLTRFVEQYDSNCVLRGLRAVADFEYEFQLANMNRAIKPDF 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
            ++ L   E   Y++S+L++ + S+  DI+ FVP PV   L        +
Sbjct: 115 ESVFLTPAEHLSYISSSLVKEIASLGGDISPFVPPPVATALHEKFPDAQR 164


>gi|152980565|ref|YP_001354825.1| phosphopantetheine adenylyltransferase [Janthinobacterium sp.
           Marseille]
 gi|166216553|sp|A6T2S8|COAD_JANMA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|151280642|gb|ABR89052.1| pantetheine-phosphate adenylyltransferase [Janthinobacterium sp.
           Marseille]
          Length = 161

 Score =  165 bits (417), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 95/165 (57%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y G+FDP+T GH D++ +A    + L++ +  +  K   F S++ER  +  + + 
Sbjct: 1   MVTAIYPGTFDPLTRGHEDLVRRASGLFDKLIVGVADSRNKKPFF-SLEERLTISNEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+       V V SF GL  +  +   A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPN-----VHVESFSGLLKDFVRRHDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   +  ++++ T++R + ++  D++ FV   V  +LK  + +
Sbjct: 115 LFLTPSDQYQFISGTIVREIATLGGDVSKFVFPSVDKWLKEKIAA 159


>gi|255281787|ref|ZP_05346342.1| pantetheine-phosphate adenylyltransferase [Bryantella formatexigens
           DSM 14469]
 gi|255267854|gb|EET61059.1| pantetheine-phosphate adenylyltransferase [Bryantella formatexigens
           DSM 14469]
          Length = 162

 Score =  165 bits (417), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 58/168 (34%), Positives = 96/168 (57%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++AVY GSFDP+T GH+DII ++ + V++L++ +  N+ K   F S++    L++ +  
Sbjct: 1   MKRAVYPGSFDPVTFGHLDIIRRSAALVDELIVGVLQNNNKKPLFSSLERVKILLEVTKD 60

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                  + V V +F GL+++  K   AQ +VRGLR +TDFDYE++M   NR + P+I T
Sbjct: 61  M------SNVRVEAFTGLSIDFVKKCDAQFLVRGLRAITDFDYELQMAQTNRIMAPDIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           I L       Y++S+ ++ +     DI+ FVP  V   +   +    K
Sbjct: 115 IFLTTSLEYAYLSSSTVKEVAYYGGDISKFVPSGVVRAILEKMHPENK 162


>gi|218702400|ref|YP_002410029.1| phosphopantetheine adenylyltransferase [Escherichia coli IAI39]
 gi|226706695|sp|B7NPE0|COAD_ECO7I RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|218372386|emb|CAR20260.1| pantetheine-phosphate adenylyltransferase [Escherichia coli IAI39]
          Length = 159

 Score =  165 bits (417), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 97/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F +++ER +L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMF-TLEERVDLAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  THLGNVE-----VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA 159


>gi|197247364|ref|YP_002148657.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|226709013|sp|B5EXD9|COAD_SALA4 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|197211067|gb|ACH48464.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
          Length = 159

 Score =  165 bits (417), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 97/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F +++ER  L +++ 
Sbjct: 1   MQKRAIYPGTFDPITNGHLDIVTRATQMFDHVILAIAASPGKKPMF-TLEERVALAQKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A+D  A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHLGNVE-----VVGFSDLMANFARDRQANILIRGLRAVADFEYEMQLAHMNRHLMPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+PD V   L + + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPDNVHQALMDKLK 159


>gi|209519638|ref|ZP_03268428.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp. H160]
 gi|209499924|gb|EDZ99989.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp. H160]
          Length = 169

 Score =  165 bits (417), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 55/167 (32%), Positives = 95/167 (56%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F   +      + +I 
Sbjct: 1   MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFFTLQE------RLAIA 54

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +      V V+SF+GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 55  HEVLGHYPNVQVMSFKGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + +   +  ++++ T++R +  +  D++ FV   V  +LK  V SL 
Sbjct: 115 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLKEKVASLD 161


>gi|24376156|ref|NP_720200.1| phosphopantetheine adenylyltransferase [Shewanella oneidensis MR-1]
 gi|29427746|sp|Q8E8I0|COAD_SHEON RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|24351199|gb|AAN57643.1|AE015900_3 phosphopantetheine adenylyltransferase [Shewanella oneidensis MR-1]
          Length = 163

 Score =  165 bits (417), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 56/157 (35%), Positives = 93/157 (59%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH D+I +A    + ++I I  N  K   F +++ER EL+ +  
Sbjct: 1   MHTRAIYPGTFDPITNGHADLIERAAKLFKHVIIGIAANPSKQPRF-TLEERVELVNRVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHLDNVE-----VVGFSGLLVDFAKEQRASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E + +++STL++ +     D++ FV   V 
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPEVA 151


>gi|192291249|ref|YP_001991854.1| phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           TIE-1]
 gi|229541047|sp|B3QIM6|COAD_RHOPT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|192284998|gb|ACF01379.1| pantetheine-phosphate adenylyltransferase [Rhodopseudomonas
           palustris TIE-1]
          Length = 169

 Score =  165 bits (417), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 56/166 (33%), Positives = 97/166 (58%), Gaps = 1/166 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++  A++  + LV+AIG +  K   F + + R  ++++  
Sbjct: 1   MSRIALYPGSFDPVTNGHLDVVRHAVALCDKLVVAIGIHPGKKPLFTTEE-RLAMVERVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +       +++ L V  A+ + A +++RGLRD TD DYEM++  +N  + P I 
Sbjct: 60  GPVAKAAGCDFGCTTYDNLTVTAAEKVGATIMIRGLRDGTDLDYEMQIAGMNETMAPAIH 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+ L A    R +T+TL+R + ++  D+++FVP  V   LK+   +
Sbjct: 120 TVFLPASVGVRPITATLVRQIAAMGGDVSAFVPAEVASALKSKFAA 165


>gi|94264616|ref|ZP_01288400.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related [delta
           proteobacterium MLMS-1]
 gi|94265654|ref|ZP_01289395.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related [delta
           proteobacterium MLMS-1]
 gi|93453825|gb|EAT04191.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related [delta
           proteobacterium MLMS-1]
 gi|93454970|gb|EAT05207.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related [delta
           proteobacterium MLMS-1]
          Length = 181

 Score =  165 bits (417), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 55/162 (33%), Positives = 85/162 (52%), Gaps = 5/162 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPIT GH+DII + L+  + +++AI  N  K   F   + R  ++      
Sbjct: 15  RIAVYPGTFDPITMGHLDIIKRGLTLFDRIIVAIAKNPDKQPLFSLAERRRMILDCFEA- 73

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                 +RV V    GL V+ A    A+ I+RGLR ++DFDYE ++  +NR +  E+ T+
Sbjct: 74  ----DEDRVEVDEVSGLLVDYAYRRGARAIIRGLRAVSDFDYEFQLALMNRRIEREVETV 129

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
            L       Y++S++I+       D+   VPD VC  L+   
Sbjct: 130 FLMTGFRWIYISSSIIKDAARHGGDVGGLVPDHVCECLRQRF 171


>gi|1518926|gb|AAC44332.1| protein thought to participate in the synthesis of the
           lipopolysaccharide core [Allochromatium vinosum DSM 180]
          Length = 169

 Score =  165 bits (417), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 60/160 (37%), Positives = 98/160 (61%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY G+FDPITNGH+D+I +A    + +V+A+  ++ KT  F S +ER EL++ S+ 
Sbjct: 1   MRTVVYPGTFDPITNGHVDLIHRAARLFDRVVVAVAADTGKTPVF-STEERVELVRGSVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      ++ FEGL VN A+ +   VI+RGLR ++DF+YE ++  +NR + P+I T
Sbjct: 60  GDPNVE-----ILPFEGLLVNFARTLGVSVIMRGLRAVSDFEYEFQLAGMNRRMAPDIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L   E   Y++S+L+R +  +  D+++FV   V   L+
Sbjct: 115 LFLTPAEQYAYISSSLVREIARLRGDVSTFVTPTVQAALR 154


>gi|156972981|ref|YP_001443888.1| phosphopantetheine adenylyltransferase [Vibrio harveyi ATCC
           BAA-1116]
 gi|226706705|sp|A7MSN5|COAD_VIBHB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|156524575|gb|ABU69661.1| hypothetical protein VIBHAR_00659 [Vibrio harveyi ATCC BAA-1116]
          Length = 159

 Score =  165 bits (417), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 59/165 (35%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+K +Y G+FDPITNGH+DII +A +  + ++I +  +  K   F S++ER +L+++S  
Sbjct: 1   MKKVIYPGTFDPITNGHLDIITRAANMFDQIIIGVAASPSKKTLF-SLEERVKLVEESTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H    S        F GL V+ A++  A V+VRGLR   DF+YE  +TS+ R L P + +
Sbjct: 60  HLSNVS-----TAGFSGLLVDFAREQEANVLVRGLRTTVDFEYEFGLTSMYRKLLPGVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++ST++R +     D+  FVP  V   +K  V  
Sbjct: 115 VFLTPAEEYAFLSSTIVREVAIHGGDVEQFVPKCVYTAIKTKVAK 159


>gi|83590705|ref|YP_430714.1| phosphopantetheine adenylyltransferase [Moorella thermoacetica ATCC
           39073]
 gi|123524125|sp|Q2RHB8|COAD_MOOTA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|83573619|gb|ABC20171.1| Phosphopantetheine adenylyltransferase [Moorella thermoacetica ATCC
           39073]
          Length = 160

 Score =  164 bits (416), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 59/166 (35%), Positives = 93/166 (56%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY G+FDPITNGH+DII +A+S  + +V+ +  ++ K   F S++ER EL++    
Sbjct: 1   MKVAVYPGTFDPITNGHLDIIRRAVSIFDRVVVGVAADNYKKTLF-SLEERVELVRTVTR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +     V SF GL V+ A+   A  IVRGLR ++DF+YE +M+ +N+ L  ++ T
Sbjct: 60  DIPGVT-----VKSFSGLLVDFARREEAVAIVRGLRAVSDFEYEFQMSIMNKKLASDLET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + L       +++S++IR   S+   I   VP  V   L      L
Sbjct: 115 VFLMTATEYSFLSSSIIRQAASLGGCIHGLVPPEVERVLLKRYGFL 160


>gi|163731384|ref|ZP_02138831.1| pantetheine-phosphate adenylyltransferase [Roseobacter litoralis
           Och 149]
 gi|161394838|gb|EDQ19160.1| pantetheine-phosphate adenylyltransferase [Roseobacter litoralis
           Och 149]
          Length = 166

 Score =  164 bits (416), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 85/165 (51%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A   ++ LVI +  N  K   F S++ER  +++    
Sbjct: 1   MRVGLYPGTFDPITLGHIDIIRRASGLLDKLVIGVAINRDKGPLF-SLEERVAMVEAESI 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L ++ A D+ A VIVRGLR + DF+YE +M  +NR L   I T
Sbjct: 60  KIAALTGLEIVTHPFENLLIDCASDVGATVIVRGLRAVADFEYEYQMVGMNRQLDDTIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A+   + + S L++ +  +   +  FV   V   L      
Sbjct: 120 VFLMAEAEHQAIASKLVKEIARLGGGVEKFVTPEVNAALLKKFGR 164


>gi|261856151|ref|YP_003263434.1| pantetheine-phosphate adenylyltransferase [Halothiobacillus
           neapolitanus c2]
 gi|261836620|gb|ACX96387.1| pantetheine-phosphate adenylyltransferase [Halothiobacillus
           neapolitanus c2]
          Length = 174

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 59/163 (36%), Positives = 98/163 (60%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++A+Y G+FDPIT GH+D+  +A    +++++A+   S KT  F ++ +R EL  +++ 
Sbjct: 1   MKRAIYPGTFDPITFGHIDVARRAAHLYDEVIVAVAAASTKTPLF-NLDQRCELALKALE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +         V  F GL V+ A+   +  IVRGLR ++DF+ E++M +VNR L PEI T
Sbjct: 60  CYPNI-----RVEPFGGLLVDFARQSQSCSIVRGLRAVSDFESEIQMAAVNRRLAPEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L   E   +V+S+++R L  +  ++ SFVP  V   LK I+
Sbjct: 115 VFLSPTEELGFVSSSIVRELARLGGNVASFVPLHVVDALKEII 157


>gi|302389605|ref|YP_003825426.1| Phosphopantetheine adenylyltransferase [Thermosediminibacter oceani
           DSM 16646]
 gi|302200233|gb|ADL07803.1| Phosphopantetheine adenylyltransferase [Thermosediminibacter oceani
           DSM 16646]
          Length = 159

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGH+DII ++    + L++A+  N  K   F +++ER E+IK+S+ 
Sbjct: 1   MNVAIYPGSFDPVTNGHLDIIERSSRLFDRLIVAVLRNPSKKPLF-TVEERIEMIKKSVS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V  F GL V+ A+   A +IV+GLR ++DF+YE++M  +N+ L  EI T
Sbjct: 60  HIKNVE-----VDYFSGLLVDFARLKKACIIVKGLRAVSDFEYELQMALMNKKLDEEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + +       Y++S++++ + S+   +   VP  V   L+     
Sbjct: 115 VFIMTNAKYSYLSSSIVKEVASLGGCVKELVPPLVAEKLREKFNK 159


>gi|294138882|ref|YP_003554860.1| phosphopantetheine adenylyltransferase [Shewanella violacea DSS12]
 gi|293325351|dbj|BAJ00082.1| phosphopantetheine adenylyltransferase [Shewanella violacea DSS12]
          Length = 159

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 59/160 (36%), Positives = 93/160 (58%), Gaps = 6/160 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH D+I +A    + +VI I  N  K   F +++ER ELIK   
Sbjct: 1   MHTKAIYPGTFDPVTNGHTDLIERAAKLFKHVVIGIAANPSKQPKF-TLEERVELIKLVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L  ++ 
Sbjct: 60  AHLDNVE-----VVGFTGLLVDFAKEQQASVLVRGLRAVSDFEYEFQLANMNRRLSADLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           ++ L   E + +++STL++ +     D++ FV   V   L
Sbjct: 115 SVFLTPAEENSFISSTLVKEVAYHGGDVSQFVHPEVSKAL 154


>gi|144899943|emb|CAM76807.1| Coenzyme A biosynthesis protein:Cytidyltransferase
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 169

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 58/164 (35%), Positives = 97/164 (59%), Gaps = 1/164 (0%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R  +Y G+FDPITNGH+DI+ +A   V+ L++A+  N+ K     S+ ER  L++  +  
Sbjct: 4   RIGLYPGTFDPITNGHLDIVTRAAKVVDKLIVAVAINAGKGP-LYSLDERVALVEAEVAE 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                +  + V +F+ L V+ A+D  A++I+RGLR ++DF+YE +M  +N  L P+I T+
Sbjct: 63  VAKQHNVIIEVRAFDNLLVDFARDCGARIIIRGLRAVSDFEYEFQMAGMNARLSPQIETL 122

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            L A E  ++++S  ++ +  +  DI+SFV   V   L    IS
Sbjct: 123 FLMASERCQFISSRFVKEIGRLGGDISSFVSPRVRASLDEKFIS 166


>gi|218551162|ref|YP_002384953.1| phosphopantetheine adenylyltransferase [Escherichia fergusonii ATCC
           35469]
 gi|226706699|sp|B7LVJ5|COAD_ESCF3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|218358703|emb|CAQ91359.1| pantetheine-phosphate adenylyltransferase [Escherichia fergusonii
           ATCC 35469]
 gi|323965900|gb|EGB61348.1| pantetheine-phosphate adenylyltransferase [Escherichia coli M863]
 gi|323975146|gb|EGB70251.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           TW10509]
 gi|327250760|gb|EGE62462.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           STEC_7v]
          Length = 159

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 95/165 (57%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F +++ER  L + + 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMF-TLEERVALAQHAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHLGNVE-----VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA 159


>gi|238910240|ref|ZP_04654077.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
          Length = 159

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F  ++ER  L +++ 
Sbjct: 1   MQKRAIYPGTFDPITNGHLDIVTRATQMFDHVILAIAASPGKKPMF-PLEERVALAQKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A+D  A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHLGNVE-----VVGFSDLMANFARDRQANILIRGLRAVADFEYEMQLAHMNRHLMPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+PD V   L + + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPDNVHQALMDKLK 159


>gi|146309772|ref|YP_001174846.1| phosphopantetheine adenylyltransferase [Enterobacter sp. 638]
 gi|167009044|sp|A4W515|COAD_ENT38 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|145316648|gb|ABP58795.1| Phosphopantetheine adenylyltransferase [Enterobacter sp. 638]
          Length = 159

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 92/165 (55%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPITNGH+DII +A S  + +++AI  +  K   F  ++ER  L   ++
Sbjct: 1   MSTKAIYPGTFDPITNGHIDIITRAASMFDRVILAIAASPSKKPMF-DLEERVALATTAL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A+   A +++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  QHLPNVE-----VMGFSDLMANFARAQQANILIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P  V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHAGDVTHFLPANVHQALMEKLK 159


>gi|149925753|ref|ZP_01914017.1| phosphopantetheine adenylyltransferase [Limnobacter sp. MED105]
 gi|149825870|gb|EDM85078.1| phosphopantetheine adenylyltransferase [Limnobacter sp. MED105]
          Length = 167

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 51/163 (31%), Positives = 93/163 (57%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR AVY G+FDP+T GH D++ +     + LV+ +  +  K   F S+ ER ++ ++ + 
Sbjct: 1   MRIAVYPGTFDPLTRGHEDLVRRGAKIFDKLVVGVADSPNKKPFF-SMDERVQIAREVLS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V  F GL  +  ++ +A VI+RGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPNVE-----VKGFRGLLKDFVRENNANVIIRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L   +  ++++ T++R + S+  D++ FV   V  +L   +
Sbjct: 115 MFLTPSDQYQFISGTIVREIASLGGDVSKFVFPSVEHWLNQKL 157


>gi|52840791|ref|YP_094590.1| phosphopantetheine adenylyltransferase [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|52627902|gb|AAU26643.1| phosphopantetheine adenylyltransferase [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
          Length = 199

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 58/163 (35%), Positives = 99/163 (60%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KA+Y G+FDP+TNGH+DII +A +   +L++A+  N  K     S + R  L+++S+
Sbjct: 37  MKQKAIYPGTFDPVTNGHIDIITRASTIFPELIVAVASNKNKRPYL-SWESRISLLEESV 95

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F+ L ++   + +A +I+RGLR ++DF+YE ++  +NR L  ++ 
Sbjct: 96  GHLT-----GVRVVGFDNLLIDFVLEQNAGIILRGLRAVSDFEYEFQLAGMNRKLSKKVE 150

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           T+ L   E   Y++STL+R + +++ DI+ FVP  V   LK  
Sbjct: 151 TLFLTPAEHLMYISSTLVREIAALNGDISQFVPPNVVRELKKR 193


>gi|149200165|ref|ZP_01877188.1| Phosphopantetheine adenylyltransferase [Lentisphaera araneosa
           HTCC2155]
 gi|149136702|gb|EDM25132.1| Phosphopantetheine adenylyltransferase [Lentisphaera araneosa
           HTCC2155]
          Length = 169

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 53/162 (32%), Positives = 83/162 (51%), Gaps = 6/162 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + A+Y GSFDP+T GH+D+I +A    + L++ +  N+ K   F   + R  +I      
Sbjct: 5   KVAIYPGSFDPLTFGHLDVIERAAKLFDKLIVLVAVNASKQAHFSLDERRGHII------ 58

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
            I      + V S  GL V    +  A  +VRGLR ++DF+YE+ M  +NR L P+  T+
Sbjct: 59  DICQHIPNIEVHSISGLLVEALNNFDACAVVRGLRSISDFEYEIHMAMMNRDLNPKCETV 118

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
            L     + +V+S +IR +  +  DI  FVP  +   LK   
Sbjct: 119 FLMPSPETSFVSSRMIREIARLGGDIAKFVPPIIADALKEKY 160


>gi|54296578|ref|YP_122947.1| phosphopantetheine adenylyltransferase [Legionella pneumophila str.
           Paris]
 gi|61212503|sp|Q5X7J6|COAD_LEGPA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|53750363|emb|CAH11757.1| hypothetical protein lpp0609 [Legionella pneumophila str. Paris]
          Length = 168

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 59/163 (36%), Positives = 99/163 (60%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KA+Y G+FDP+TNGH+DII +A +   +L++A+  N  K     S + R  L+++S+
Sbjct: 8   MKQKAIYPGTFDPVTNGHIDIITRASTIFPELIVAVASNKNKRPYL-SWETRISLLEESV 66

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F+ L ++   + SA +I+RGLR ++DF+YE ++  +NR L  ++ 
Sbjct: 67  GHLT-----GVRVVGFDNLLIDFVLEQSAGIILRGLRAVSDFEYEFQLAGMNRKLSKKVE 121

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           T+ L   E   Y++STL+R + +++ DI+ FVP  V   LK  
Sbjct: 122 TLFLTPAEHLMYISSTLVREIAALNGDISQFVPPNVVRELKKR 164


>gi|86158157|ref|YP_464942.1| coenzyme A biosynthesis protein, cytidyltransferase-related
           [Anaeromyxobacter dehalogenans 2CP-C]
 gi|123497714|sp|Q2IIM3|COAD_ANADE RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|85774668|gb|ABC81505.1| Coenzyme A biosynthesis protein, Cytidyltransferase-related protein
           [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 164

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 94/166 (56%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+ II + L+  + LV+A+  N  K+  F ++ ER  LI++++
Sbjct: 1   MNRAAIYPGSFDPLTNGHLAIIQRGLNLFDRLVVAVANNPQKSPMF-TVDERKALIREAV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            +          V SF+GL V+ A+      ++RGLR ++DF+YE ++ ++N+ L PE  
Sbjct: 60  GNDPRVE-----VDSFDGLMVDYARTRGIPKVLRGLRAVSDFEYEFQLANMNKKLLPEFE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           ++ +   E   +V++ L+R +     ++   VP  V   L+  +  
Sbjct: 115 SVFVMTGEDYFFVSARLVREVAVFGGNVEGLVPPNVLEALQRKLGR 160


>gi|254486094|ref|ZP_05099299.1| pantetheine-phosphate adenylyltransferase [Roseobacter sp. GAI101]
 gi|214042963|gb|EEB83601.1| pantetheine-phosphate adenylyltransferase [Roseobacter sp. GAI101]
          Length = 164

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 59/165 (35%), Positives = 88/165 (53%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F   + R  LI     
Sbjct: 1   MRVGLYPGTFDPITLGHLDIIRRATTLVDKLVIGVAINRDKGPLFELTE-RVALITSECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               ++   V V  FE L +N A+D+ AQ+I+RGLR + DF+YE +M  +NR L   I T
Sbjct: 60  KLQEETGVEVVVHPFENLLINCARDVGAQMIIRGLRAVADFEYEYQMVGMNRKLDDSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A+   + + S L++ +  +  D++ FV   V   L      
Sbjct: 120 VFLMAEAEHQAIASKLVKEIARLGGDVSKFVTPTVNAELLKRFAK 164


>gi|330902165|gb|EGH33410.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 149

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 52/155 (33%), Positives = 90/155 (58%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+  +  K   F  +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDQVVIAVAASPKKNPLF-PLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  HLPNVE-----VVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L   E   +++STL+R + ++  DIT FV   V
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFVHPAV 149


>gi|237654276|ref|YP_002890590.1| phosphopantetheine adenylyltransferase [Thauera sp. MZ1T]
 gi|237625523|gb|ACR02213.1| pantetheine-phosphate adenylyltransferase [Thauera sp. MZ1T]
          Length = 162

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 50/167 (29%), Positives = 94/167 (56%), Gaps = 8/167 (4%)

Query: 2   MR--KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           M+   AVY G+FDP T GH D++ +A    E +V+A+  ++ K   F  +++R ++ + +
Sbjct: 1   MKEAIAVYPGTFDPFTRGHEDLVRRASILFEKVVVAVARSNSKNPIFG-LEDRVDIARDA 59

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           +  F         V+ F+ L +   +   A+VI+RGLR ++DF+YE +M  +NR L P++
Sbjct: 60  VSAFPNVE-----VVGFDCLLMEFLQQQDARVIIRGLRAVSDFEYEFQMAGMNRKLYPDV 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            T+ L   E   ++++T++R +  +  D++ FV   V   L+  + S
Sbjct: 115 ETVFLTPGEEFMFISATMVREIARLGGDVSKFVQPRVLARLQERLKS 161


>gi|326389526|ref|ZP_08211093.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           ethanolicus JW 200]
 gi|325994531|gb|EGD52956.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 159

 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 92/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+T GH+DII +  +  + L++A+  N  K   F +++ER EL+K   +
Sbjct: 1   MKTAIYPGSFDPVTYGHIDIIKRGANLFDKLIVAVLLNPSKKPLF-TVEERVELLKAVTY 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      +  F+GL V+ AK ++A  I++GLR ++DF+YE +M  +N+ L P + T
Sbjct: 60  DIPNVE-----IDYFDGLLVDYAKKVNANAIIKGLRMVSDFEYEFQMALINKKLNPSVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           I L       Y++S++++ +      ++ FVPD V   L      
Sbjct: 115 IFLMTNAKYGYLSSSVVKEIAQFGGCLSEFVPDIVAQKLIEKFSR 159


>gi|86742286|ref|YP_482686.1| phosphopantetheine adenylyltransferase [Frankia sp. CcI3]
 gi|123750803|sp|Q2J6Y5|COAD_FRASC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|86569148|gb|ABD12957.1| Phosphopantetheine adenylyltransferase [Frankia sp. CcI3]
          Length = 162

 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 95/165 (57%), Gaps = 3/165 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+A   GSFDPITNGH+DII++A    +++V+A+  N  K   F ++ ER ELI+++  
Sbjct: 1   MRRAACPGSFDPITNGHLDIIVRASRLFDEVVVAVSINKNKVTLF-TVDERMELIREA-L 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
              P + + V V +  GL V+  +    Q IV+GLR ++DFDYE++M  +N  L   + T
Sbjct: 59  RDHPMAPSNVLVDASHGLIVDFCRSRGIQSIVKGLRAVSDFDYELQMAQMNNSLA-GVET 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + +       +++S+L++ +     D++  VPD V   L+  +  
Sbjct: 118 LFMSTNPQYAFLSSSLVKEVARYGGDVSGLVPDVVLKQLRERLAQ 162


>gi|239996976|ref|ZP_04717500.1| phosphopantetheine adenylyltransferase [Alteromonas macleodii ATCC
           27126]
          Length = 162

 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 52/166 (31%), Positives = 94/166 (56%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH D+I +A      +++AI  N  K   F +++ER E+IK+  
Sbjct: 1   MHTRALYPGTFDPITNGHADLIERASQLFSHVIVAIASNPSKKPLF-TLEERVEMIKKVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V+ F GL  + A + +A +++RGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  ADLPNVE-----VVGFTGLLADFADEQNATILIRGLRAVSDFEYEFQLANMNRRLNPKLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           ++ L   E + +++STL++ +      ++ F    V   LK+ +  
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHRGAVSGFCHPVVEKALKDRLSK 160


>gi|221065353|ref|ZP_03541458.1| pantetheine-phosphate adenylyltransferase [Comamonas testosteroni
           KF-1]
 gi|220710376|gb|EED65744.1| pantetheine-phosphate adenylyltransferase [Comamonas testosteroni
           KF-1]
          Length = 164

 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 53/163 (32%), Positives = 92/163 (56%), Gaps = 6/163 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            AVY G+FDPIT GH D++ +A      +++A+     K   F S++ER  +++++  ++
Sbjct: 6   IAVYPGTFDPITLGHEDVVRRAAQLFGKVIVAVAAGHHKKTLF-SLEERIAMVREACANY 64

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                 +V V SF+GL  +      A+ +VRGLR +TDFDYE ++  +NR L PE+ T+ 
Sbjct: 65  P-----QVQVESFDGLLAHFVLARGAKAMVRGLRAVTDFDYEFQLAGMNRTLMPEVETVF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           L   +  ++++ST +R + +++ D+  FV   V   L   V  
Sbjct: 120 LTPSDRYQFISSTFVREIATLNGDVDKFVSKGVHERLMAKVGR 162


>gi|84503060|ref|ZP_01001156.1| pantetheine-phosphate adenylyltransferase [Oceanicola batsensis
           HTCC2597]
 gi|84388604|gb|EAQ01476.1| pantetheine-phosphate adenylyltransferase [Oceanicola batsensis
           HTCC2597]
          Length = 164

 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 93/165 (56%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F  +++R  +I+ +  
Sbjct: 1   MRTGLYPGTFDPITLGHLDIIRRATALVDRLVIGVAINRDKGPLF-DLEDRVSMIQNACE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               +++  + V  FE L ++ A D+ A +IVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  DMQAETNTEIVVHPFENLLIHCAHDVGATLIVRGLRAVADFEYEYQMVGMNRSLDSSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A    + + S L++ +  +D D++ FV   V   L+  +  
Sbjct: 120 VFLMADAKRQAIASKLVKEICRLDGDVSKFVTPAVNDKLRAKLGK 164


>gi|170691509|ref|ZP_02882674.1| pantetheine-phosphate adenylyltransferase [Burkholderia graminis
           C4D1M]
 gi|170143714|gb|EDT11877.1| pantetheine-phosphate adenylyltransferase [Burkholderia graminis
           C4D1M]
          Length = 171

 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 55/167 (32%), Positives = 100/167 (59%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F +++ER ++  + + 
Sbjct: 1   MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRNKKPFF-TLKERLDIAHEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+       V V+SF+GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPN-----VQVMSFKGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + +   +  ++++ T++R +  +  D++ FV   V  +LK  V +L 
Sbjct: 115 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLKEKVAALD 161


>gi|89092447|ref|ZP_01165401.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related
           [Oceanospirillum sp. MED92]
 gi|89083535|gb|EAR62753.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related
           [Oceanospirillum sp. MED92]
          Length = 159

 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 55/161 (34%), Positives = 87/161 (54%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDPITNGH D+I +A    + +V+AI  +  K      ++ R  L+ +   
Sbjct: 1   MNTAVYPGTFDPITNGHSDLIERAAKLFDKVVVAIAESPKKRPML-PLETRVALVAEVTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          ++ F+ L   L    +A +I+RGLR ++DF+YE ++ ++NR L P + +
Sbjct: 60  HLDNVE-----IVGFDCLLAELLAQQNANIILRGLRAVSDFEYEFQLAAMNRHLAPNVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           I L   E   +V+STLIR + S+  D++ FV   V   L  
Sbjct: 115 IFLTPAEHLSFVSSTLIREISSLGGDVSKFVHPAVNKALIE 155


>gi|331644352|ref|ZP_08345481.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H736]
 gi|331036646|gb|EGI08872.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H736]
          Length = 194

 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 97/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F +++ER EL +Q+ 
Sbjct: 36  MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMF-TLEERVELAQQAT 94

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 95  AHLGNVE-----VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 149

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 150 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA 194


>gi|320666347|gb|EFX33346.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. LSU-61]
          Length = 159

 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F +++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMF-TLEERVVLAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHLGNVE-----VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA 159


>gi|149914739|ref|ZP_01903269.1| Coenzyme A biosynthesis protein [Roseobacter sp. AzwK-3b]
 gi|149811532|gb|EDM71367.1| Coenzyme A biosynthesis protein [Roseobacter sp. AzwK-3b]
          Length = 163

 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 60/164 (36%), Positives = 94/164 (57%), Gaps = 1/164 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A   V+ LVI +  N  K   F S++ER E+I++   
Sbjct: 1   MRIGLYPGTFDPITLGHLDIIRRAAMLVDRLVIGVAINRDKGPLF-SLEERVEMIEEECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L ++ A D+ AQ+IVRGLR + DF+YE +M  +NR L  ++ T
Sbjct: 60  KLTEQTGTEIVAHPFENLLIDCANDVGAQLIVRGLRAVADFEYEFQMVGMNRALDNKVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L A  S + + S L++ +  ++ D++ FV  PV   L+    
Sbjct: 120 VFLMADASHQAIASKLVKEIARLNGDVSKFVTPPVRERLRAKFA 163


>gi|50119111|ref|YP_048278.1| phosphopantetheine adenylyltransferase [Pectobacterium atrosepticum
           SCRI1043]
 gi|61212573|sp|Q6DAV2|COAD_ERWCT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|49609637|emb|CAG73070.1| phosphopantetheine adenylyltransferase [Pectobacterium atrosepticum
           SCRI1043]
          Length = 159

 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 49/164 (29%), Positives = 90/164 (54%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+D++ +A    + +V+AI  +  K   F   +      + ++
Sbjct: 1   MTTKAIYPGTFDPLTNGHLDLLTRAARLFDHVVLAIAASPSKNTLFTLDE------RVAL 54

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            +      + V VI F  L V+ A+   A ++VRGLR + DF+YE+++  +N  L P + 
Sbjct: 55  ANDATQHLSNVEVIGFSDLMVHFAQQQKANILVRGLRAVADFEYELQLAKMNHHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           ++ L   E   +++S+L++ +     D+T F+PD +   L   +
Sbjct: 115 SVFLMPSEEWSFISSSLVKEVARHGGDVTHFLPDAIVRALLEKL 158


>gi|20807930|ref|NP_623101.1| phosphopantetheine adenylyltransferase [Thermoanaerobacter
           tengcongensis MB4]
 gi|29427846|sp|Q8R9U9|COAD_THETN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|20516499|gb|AAM24705.1| Phosphopantetheine adenylyltransferase [Thermoanaerobacter
           tengcongensis MB4]
          Length = 160

 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 61/165 (36%), Positives = 91/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDP+T GH+DII +  +  + L++A+  N  K   F SIQER EL+K+   
Sbjct: 1   MRVAIYPGSFDPVTYGHIDIIKRGANLFDKLIVAVLLNPAKRPLF-SIQERIELLKEVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V  F+GL V  AK ++A  I++GLR ++DF+YE +M  VN+ L P + T
Sbjct: 60  DIPNVE-----VDYFDGLLVEYAKKVNASAIIKGLRMVSDFEYEFQMALVNKKLNPSVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           I L       Y++S+L++ +      ++ FVPD V   L      
Sbjct: 115 IFLMTSPKYGYLSSSLVKEIAQFGGCLSEFVPDIVAERLMEKFKK 159


>gi|307264820|ref|ZP_07546382.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|306920078|gb|EFN50290.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           wiegelii Rt8.B1]
          Length = 160

 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 55/164 (33%), Positives = 92/164 (56%), Gaps = 6/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+T GH+DII +  +  + L++A+  N  K   F S++ER EL+K   +
Sbjct: 1   MKTAIYPGSFDPVTYGHIDIIKRGANLFDKLIVAVLLNPSKKPLF-SVEERVELLKAVTY 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      +  F+GL V+ AK ++A  I++GLR ++DF+YE +M  +N+ L P + T
Sbjct: 60  DIPNVE-----IDYFDGLLVDYAKKVNANAIIKGLRMVSDFEYEFQMALINKKLNPSVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           I L       Y++S++++ +      ++ FVPD V   L     
Sbjct: 115 IFLMTNAKYGYLSSSVVKEIAQFGGCLSEFVPDIVAQKLMEKFS 158


>gi|330831599|ref|YP_004394551.1| phosphopantetheine adenylyltransferase [Aeromonas veronii B565]
 gi|328806735|gb|AEB51934.1| Phosphopantetheine adenylyltransferase [Aeromonas veronii B565]
          Length = 160

 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 91/165 (55%), Gaps = 8/165 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDP+TNGH D+I +A    +++V+ +  +  K   F   + R +L++Q  
Sbjct: 1   MTTRVIYPGTFDPVTNGHADLIGRAAKLFDEVVVGVANSPSKRPLFDLAE-RVQLVQQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V+ F GL V+ AK+  A V++RGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 60  SQLPNVK-----VVGFSGLLVDFAKEHQANVLIRGLRAVSDFEYEFQLANMNRRLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL--KNI 163
           ++ L   E + +++STL++ +     DI  FV   V   +  K  
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDIRQFVDPVVAQAIAAKQK 159


>gi|197122520|ref|YP_002134471.1| phosphopantetheine adenylyltransferase [Anaeromyxobacter sp. K]
 gi|220917305|ref|YP_002492609.1| pantetheine-phosphate adenylyltransferase [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|229488115|sp|B4UCU5|COAD_ANASK RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254763922|sp|B8J9D7|COAD_ANAD2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|196172369|gb|ACG73342.1| pantetheine-phosphate adenylyltransferase [Anaeromyxobacter sp. K]
 gi|219955159|gb|ACL65543.1| pantetheine-phosphate adenylyltransferase [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 164

 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 94/166 (56%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+ II + L+  + LV+A+  N  K+  F ++ ER  LI++++
Sbjct: 1   MNRAAIYPGSFDPLTNGHLAIIQRGLNLFDRLVVAVANNPQKSPMF-TVDERKALIREAV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            +          V SF+GL V+ A+      ++RGLR ++DF+YE ++ ++N+ L PE  
Sbjct: 60  GNDPRVE-----VDSFDGLMVDYARTRGIPKVLRGLRAVSDFEYEFQLANMNKKLLPEFE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           ++ +   E   +V++ L+R +     ++   VP  V   L+  +  
Sbjct: 115 SVFVMTGEDYFFVSARLVREVAQFGGNVEGLVPANVLEALQRKLGR 160


>gi|84386873|ref|ZP_00989897.1| phosphopantetheine adenylyltransferase [Vibrio splendidus 12B01]
 gi|84378163|gb|EAP95022.1| phosphopantetheine adenylyltransferase [Vibrio splendidus 12B01]
          Length = 160

 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 62/166 (37%), Positives = 96/166 (57%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +K +Y G+FDPITNGH+DII +A    ++++I +  +  K   F S+ ER ELI+Q+ 
Sbjct: 1   MTKKVIYPGTFDPITNGHLDIIERAAKMFDEVLIGVAASPSKKTMF-SLPERVELIEQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H    S     V  F GL V+ AK+  A +++RGLR   DF+YE  +TS+ R L P I 
Sbjct: 60  SHINNTS-----VAGFSGLLVDFAKEQDANILIRGLRTTVDFEYEFGLTSMYRKLLPGIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           ++ L   E   +++ST++R +     DI+ FVP+ V   + + V  
Sbjct: 115 SVFLTPSEEYAFLSSTIVREVAIHGGDISGFVPNTVNTAIIDKVTK 160


>gi|91763281|ref|ZP_01265245.1| pantetheine-phosphate adenylyltransferase [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|91717694|gb|EAS84345.1| pantetheine-phosphate adenylyltransferase [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 164

 Score =  164 bits (415), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 92/165 (55%), Gaps = 1/165 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +  VY G+FDPIT GH+D+I +AL   + ++IA    + K   F S++ R +LIK+++
Sbjct: 1   MKKVVVYPGTFDPITFGHIDVINKALKLFDKVIIAASDGANKNYLFNSLE-RVQLIKKAL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
           F  +     ++ VISF  L  +L K   + +I+RGLR ++DF+YE ++  +NR L   I 
Sbjct: 60  FVDLKFDKKKIEVISFTSLTTDLCKKYKSNIILRGLRAVSDFEYEFQLAGMNRKLNNNIE 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           TI L +   ++ ++S  ++ ++ +  DI  F        LK    
Sbjct: 120 TIFLMSDVENQIISSRFVKEIVRLKGDIKKFTTKSTIKSLKEKYE 164


>gi|152972480|ref|YP_001337626.1| phosphopantetheine adenylyltransferase [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|238897075|ref|YP_002921821.1| phosphopantetheine adenylyltransferase [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262040683|ref|ZP_06013921.1| pantetheine-phosphate adenylyltransferase [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|329996930|ref|ZP_08302627.1| pantetheine-phosphate adenylyltransferase [Klebsiella sp. MS 92-3]
 gi|8469202|sp|Q9XC89|COAD_KLEPN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216554|sp|A6TFM5|COAD_KLEP7 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|5006992|gb|AAD37773.1|AF146532_13 KdtB [Klebsiella pneumoniae]
 gi|150957329|gb|ABR79359.1| phosphopantetheine adenylyltransferase [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|238549403|dbj|BAH65754.1| phosphopantetheine adenylyltransferase [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
 gi|259042047|gb|EEW43080.1| pantetheine-phosphate adenylyltransferase [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|328539220|gb|EGF65249.1| pantetheine-phosphate adenylyltransferase [Klebsiella sp. MS 92-3]
          Length = 159

 Score =  164 bits (415), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 57/165 (34%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPITNGH+DI+ +A S  + +V+AI  +  K   F S+ ER  L +Q+ 
Sbjct: 1   MSTKAIYPGTFDPITNGHIDIVTRAASMFDKVVLAIAASPSKKPMF-SLDERIALAEQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +        VI F  L  N A+   A +++RGLR + DF+YEM++  +NR L P + 
Sbjct: 60  AHLVNVE-----VIGFSDLMANFARAQQANILIRGLRAVADFEYEMQLAHMNRHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D++ F+P  V   L N + 
Sbjct: 115 SVFLMPCKEWSFISSSLVKEVARHQGDVSHFLPANVHQALLNKLK 159


>gi|147678098|ref|YP_001212313.1| phosphopantetheine adenylyltransferase [Pelotomaculum
           thermopropionicum SI]
 gi|146274195|dbj|BAF59944.1| phosphopantetheine adenylyltransferase [Pelotomaculum
           thermopropionicum SI]
          Length = 167

 Score =  164 bits (414), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 58/168 (34%), Positives = 92/168 (54%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+  GSFDP+T GH+DII +A    + ++ A+  N  K   F S++ER E++K  + 
Sbjct: 1   MRTAICPGSFDPVTFGHLDIISRASLLFDRVIAAVSRNPCKNPMF-SVEERMEMLKSVLS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +         V S+EGL VN A    A+ IVRGLR ++DF+ E +M  VN+ L   + T
Sbjct: 60  PYPNVE-----VDSYEGLTVNYALQQKARTIVRGLRVISDFENEFKMALVNKKLSCHVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           I L  K    +++ST+++ +      + S VP  V   ++  + SL +
Sbjct: 115 IFLMTKAEYSFISSTVVKEVAFFGGSLASLVPPLVEKKVREKLKSLER 162


>gi|119468499|ref|ZP_01611590.1| Phosphopantetheine adenylyltransferase (PPAT) (Dephospho-CoA
           pyrophosphorylase) [Alteromonadales bacterium TW-7]
 gi|119448007|gb|EAW29272.1| Phosphopantetheine adenylyltransferase (PPAT) (Dephospho-CoA
           pyrophosphorylase) [Alteromonadales bacterium TW-7]
          Length = 163

 Score =  164 bits (414), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 53/164 (32%), Positives = 95/164 (57%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+Y G+FDP+TNGH D+I +A    + +++A+  N  K   F   +      + ++
Sbjct: 1   MNVTAIYPGTFDPLTNGHTDLIQRAAKMFDTVLVAVANNPSKQPCFNLEE------RVAL 54

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            + I    + V VI F GL  +LA+D +A V++RG+R ++DFDYE ++ ++NR L P++ 
Sbjct: 55  ANTILSHLDNVKVIGFSGLLADLARDHNAHVLIRGIRAVSDFDYEFQLANMNRRLNPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           ++ L   E + +++STL++ +     D++ FV   +   LK  V
Sbjct: 115 SVFLTPAEKNSFISSTLVKEVARHHGDVSEFVDPIIVKALKEKV 158


>gi|91977069|ref|YP_569728.1| phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           BisB5]
 gi|123762732|sp|Q137B2|COAD_RHOPS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|91683525|gb|ABE39827.1| Phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           BisB5]
          Length = 165

 Score =  164 bits (414), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 95/165 (57%), Gaps = 1/165 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++  A++  + LV+AIG +  K   F + + R  ++K   
Sbjct: 1   MSRIALYPGSFDPVTNGHLDVVRHAVALCDRLVVAIGIHPGKKPLFTTEE-RLMMVKSVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +       +++ L V  A+ + A +++RGLRD TD DYEM++  +N  + P I 
Sbjct: 60  EPVANAAGCTFDCTTYDNLTVTSAQQVGATLMIRGLRDGTDLDYEMQIAGMNETMAPGIH 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T+ + A    R +T+TL+R + ++  D+++FVP  V   LK+   
Sbjct: 120 TVFVPASVGVRPITATLVRQIAAMGGDVSAFVPPDVAASLKSKFA 164


>gi|307728377|ref|YP_003905601.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp.
           CCGE1003]
 gi|323524667|ref|YP_004226820.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp.
           CCGE1001]
 gi|307582912|gb|ADN56310.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp.
           CCGE1003]
 gi|323381669|gb|ADX53760.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp.
           CCGE1001]
          Length = 171

 Score =  164 bits (414), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 55/167 (32%), Positives = 100/167 (59%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F +++ER ++  + + 
Sbjct: 1   MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRNKKPFF-TLKERLDIAHEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+       V V+SF+GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPN-----VQVMSFKGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + +   +  ++++ T++R +  +  D++ FV   V  +LK  V +L 
Sbjct: 115 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLKEKVAALD 161


>gi|111225166|ref|YP_715960.1| phosphopantetheine adenylyltransferase [Frankia alni ACN14a]
 gi|122953792|sp|Q0RDM7|COAD_FRAAA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|111152698|emb|CAJ64440.1| CMP-deoxy-D-manno-octulosonate-lipid A transferase
           (phosphopantetheine adenylyltransferase) [Frankia alni
           ACN14a]
          Length = 162

 Score =  164 bits (414), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 57/162 (35%), Positives = 96/162 (59%), Gaps = 3/162 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GSFDPITNGH+DI+I+A    +++V+A+  N  K   F +I ER ELI++++ 
Sbjct: 1   MRRAVCPGSFDPITNGHLDIVIRASKLFDEVVVAVSINKNKATLF-TIDERMELIREAVR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           +    + + V V +  GL V+  +    Q IV+GLR ++DFDYE++M  +N  L   + T
Sbjct: 60  NHP-MAPSNVVVDASHGLVVDFCRARGIQSIVKGLRAVSDFDYELQMAQMNNSLA-GVET 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           + +       +++S+L++ +     D++  VPD V   L+  
Sbjct: 118 LFMSTNPQYAFLSSSLVKEVARYGGDVSHLVPDVVLKQLRER 159


>gi|157373256|ref|YP_001471856.1| phosphopantetheine adenylyltransferase [Shewanella sediminis
           HAW-EB3]
 gi|189082591|sp|A8FPF5|COAD_SHESH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|157315630|gb|ABV34728.1| Pantetheine-phosphate adenylyltransferase [Shewanella sediminis
           HAW-EB3]
          Length = 158

 Score =  164 bits (414), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 55/160 (34%), Positives = 92/160 (57%), Gaps = 6/160 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDP+TNGH D+I +A    + +VI I  N  K   F +++ER  L++   
Sbjct: 1   MHTRAIYPGTFDPVTNGHADLIERAAKLFKHVVIGIAANPSKKPRF-TLEERVALLQLVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L  ++ 
Sbjct: 60  SHLDNVE-----VVGFSGLLVDFAKEQKASVLVRGLRAVSDFEYEFQLANMNRRLSSDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           ++ L   E + +++STL++ +     D++ FV   V   L
Sbjct: 115 SVFLTPAEENSFISSTLVKEVAHHGGDVSQFVHPEVAKAL 154


>gi|16767010|ref|NP_462625.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|167994346|ref|ZP_02575438.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|29427903|sp|Q8ZL48|COAD_SALTY RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|16422293|gb|AAL22584.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|205327774|gb|EDZ14538.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|261248873|emb|CBG26727.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267995986|gb|ACY90871.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301160262|emb|CBW19785.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312914751|dbj|BAJ38725.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321226778|gb|EFX51828.1| Phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|323132085|gb|ADX19515.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
          Length = 159

 Score =  164 bits (414), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F ++ ER  L +++ 
Sbjct: 1   MQKRAIYPGTFDPITNGHLDIVTRATQMFDHVILAIAASPSKKPMF-TLDERVALAQKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A+D  A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHLGNVE-----VVGFSDLMANFARDRQANILIRGLRAVADFEYEMQLAHMNRHLMPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+PD V   L + + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPDNVHQALMDKLK 159


>gi|85710786|ref|ZP_01041847.1| phosphopantetheine adenylyltransferase [Idiomarina baltica OS145]
 gi|85695190|gb|EAQ33127.1| phosphopantetheine adenylyltransferase [Idiomarina baltica OS145]
          Length = 163

 Score =  164 bits (414), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 60/165 (36%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R+A+Y G+FDPITNGH D+I +A S   ++++ +  +  K   F S+QER  L +Q  
Sbjct: 1   MHRRAIYPGTFDPITNGHADLIERAASLFSEIIVGVAESPSKKPLF-SLQERVLLAQQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   + V V+ F GL VN AKD  A V++RGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 60  EKL-----DNVRVVGFSGLLVNFAKDHDASVLIRGLRAVSDFEYEFQLANMNRRLFPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E + +++STL++ +     D+  FV   V   L+    
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVGEFVDGRVAEALQQKFA 159


>gi|161616805|ref|YP_001590770.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167549027|ref|ZP_02342786.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|168232572|ref|ZP_02657630.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|168235330|ref|ZP_02660388.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|168241904|ref|ZP_02666836.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168260521|ref|ZP_02682494.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|168464967|ref|ZP_02698859.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|168818445|ref|ZP_02830445.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|194442711|ref|YP_002042975.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194448279|ref|YP_002047757.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194470241|ref|ZP_03076225.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194733976|ref|YP_002116660.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197263631|ref|ZP_03163705.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|198242346|ref|YP_002217686.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200388561|ref|ZP_03215173.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204928500|ref|ZP_03219699.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205354673|ref|YP_002228474.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207858962|ref|YP_002245613.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|189082586|sp|A9MVM9|COAD_SALPB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226709014|sp|B5FM58|COAD_SALDC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226709015|sp|B5R5F8|COAD_SALEP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226709016|sp|B5RGF3|COAD_SALG2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541040|sp|B4TZX6|COAD_SALSV RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541042|sp|B4SXD6|COAD_SALNS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541043|sp|B4T9B9|COAD_SALHS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|161366169|gb|ABX69937.1| hypothetical protein SPAB_04624 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194401374|gb|ACF61596.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194406583|gb|ACF66802.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194456605|gb|EDX45444.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194709478|gb|ACF88699.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|195632296|gb|EDX50780.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|197241886|gb|EDY24506.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197291569|gb|EDY30921.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|197936862|gb|ACH74195.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|199605659|gb|EDZ04204.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204321933|gb|EDZ07131.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205274454|emb|CAR39486.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205325528|gb|EDZ13367.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|205333237|gb|EDZ20001.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|205338719|gb|EDZ25483.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205344325|gb|EDZ31089.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|205350157|gb|EDZ36788.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|206710765|emb|CAR35126.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|320088145|emb|CBY97907.1| Phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|322612891|gb|EFY09843.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618956|gb|EFY15843.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625267|gb|EFY22094.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322630066|gb|EFY26839.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322634257|gb|EFY30992.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635842|gb|EFY32551.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322643020|gb|EFY39597.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322645052|gb|EFY41583.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649848|gb|EFY46271.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322653055|gb|EFY49390.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322661126|gb|EFY57354.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322662385|gb|EFY58598.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322667263|gb|EFY63429.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674360|gb|EFY70453.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322678432|gb|EFY74493.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322680938|gb|EFY76972.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322687126|gb|EFY83099.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323195850|gb|EFZ81022.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323198233|gb|EFZ83339.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323200851|gb|EFZ85921.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323206605|gb|EFZ91563.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323210482|gb|EFZ95368.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323216230|gb|EGA00958.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220453|gb|EGA04907.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323225316|gb|EGA09550.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323228430|gb|EGA12561.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323234251|gb|EGA18339.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237236|gb|EGA21303.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323244755|gb|EGA28759.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323245870|gb|EGA29860.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323250947|gb|EGA34823.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323257305|gb|EGA41004.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262229|gb|EGA45790.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323264560|gb|EGA48064.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323268850|gb|EGA52308.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326625470|gb|EGE31815.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326629812|gb|EGE36155.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 159

 Score =  164 bits (414), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F ++ ER  L +++ 
Sbjct: 1   MQKRAIYPGTFDPITNGHLDIVTRATQMFDHVILAIAASPGKKPMF-TLDERVALAQKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A+D  A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHLGNVE-----VVGFSDLMANFARDRQANILIRGLRAVADFEYEMQLAHMNRHLMPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+PD V   L + + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPDNVHQALMDKLK 159


>gi|114799402|ref|YP_761438.1| pantetheine-phosphate adenylyltransferase [Hyphomonas neptunium
           ATCC 15444]
 gi|114739576|gb|ABI77701.1| pantetheine-phosphate adenylyltransferase [Hyphomonas neptunium
           ATCC 15444]
          Length = 165

 Score =  164 bits (414), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 57/166 (34%), Positives = 88/166 (53%), Gaps = 1/166 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R  +Y G+FDP T GH+DI  +A   V+ L+I +  N  K   F S+ ER  +++   
Sbjct: 1   MHRIGLYPGTFDPPTAGHIDIFSRAAKLVDTLIIGVAINEAKKPLF-SLDERVAMVEHEC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            +        + ++   GL ++ A+  +A +IVRGLR + DF+YE +MT++N  L P+I 
Sbjct: 60  ANLKGTGLAEIKILPMRGLLMHFAEKCNANIIVRGLRAVQDFEYEFQMTAMNEQLNPDIE 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           TI L A    + V S L++ + S+  DIT FV   V   L      
Sbjct: 120 TIFLMADVRHQAVASRLVKEIASLGGDITPFVTPSVKKALLEKYKQ 165


>gi|86607292|ref|YP_476055.1| phosphopantetheine adenylyltransferase [Synechococcus sp. JA-3-3Ab]
 gi|123504920|sp|Q2JRG2|COAD_SYNJA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|86555834|gb|ABD00792.1| pantetheine-phosphate adenylyltransferase [Synechococcus sp.
           JA-3-3Ab]
          Length = 159

 Score =  164 bits (414), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 58/161 (36%), Positives = 87/161 (54%), Gaps = 6/161 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y GSFDPIT GH+DII +A      +++A+  N  KT  F + ++R   I  S+ H 
Sbjct: 2   IALYPGSFDPITFGHLDIIERASRLFSKVIVAVLKNPNKTPLF-TPEQRQAQILLSVAHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V +F GL V  A+   A+VIVRGLR ++DFD E++M   N+ L PE+ T+ 
Sbjct: 61  KNVE-----VDTFSGLTVAYARQRGARVIVRGLRVLSDFDVELQMAHTNKLLAPELETLF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           L       +V+S+L++ +  +   I   VP PV   L+   
Sbjct: 116 LATASEHSFVSSSLVKEVAKLGGPIDHLVPPPVAQDLRERF 156


>gi|299821542|ref|ZP_07053430.1| pantetheine-phosphate adenylyltransferase [Listeria grayi DSM
           20601]
 gi|299817207|gb|EFI84443.1| pantetheine-phosphate adenylyltransferase [Listeria grayi DSM
           20601]
          Length = 160

 Score =  164 bits (414), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 55/163 (33%), Positives = 87/163 (53%), Gaps = 6/163 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + A+  GSFDPITNGH+DII +A    + L +++  NS K   F  +  R  LIK+   H
Sbjct: 4   KIAIIPGSFDPITNGHLDIIERAAKVFDVLYVSVLANSSKQPLF-DLDTRLALIKEVTAH 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                  +V V S +GL V  A    A  IVRGLR ++DF+YEM++ S+NR L  ++ T 
Sbjct: 63  IP-----QVRVESAQGLTVQYAASKGAVAIVRGLRAVSDFEYEMQIASMNRTLEEDVETF 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
            +       +++S++++ +     DI+  VP  V   ++    
Sbjct: 118 FVMTNSKYSFLSSSIVKEVAKYQGDISGLVPKAVEEAIQAKFR 160


>gi|304399013|ref|ZP_07380882.1| pantetheine-phosphate adenylyltransferase [Pantoea sp. aB]
 gi|304353473|gb|EFM17851.1| pantetheine-phosphate adenylyltransferase [Pantoea sp. aB]
          Length = 159

 Score =  164 bits (414), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+T GH+DI+ +A    +++++A+  +  K   F S+ ER  L  + +
Sbjct: 1   MTTKAIYPGTFDPVTLGHVDIVTRAAQMFDEVILAVAASPSKKPMF-SLDERVALTGEVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A+D  A V++RGLR ++DF+YEM++  +NR L P + 
Sbjct: 60  AHLPNVE-----VVGFSDLMANFARDQQANVLIRGLRAVSDFEYEMQLAQMNRHLLPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E   +++S+L++ +     D+++F+P PV   L   + 
Sbjct: 115 SVFLMPSEGFSFISSSLVKEVARHKGDVSAFLPAPVHQALLAKLA 159


>gi|23098906|ref|NP_692372.1| phosphopantetheine adenyltransferase [Oceanobacillus iheyensis
           HTE831]
 gi|29427764|sp|Q8ER64|COAD_OCEIH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|22777133|dbj|BAC13407.1| phosphopantetheine adenyltransferase (pantetheine-phosphate
           adenylyltransferase) [Oceanobacillus iheyensis HTE831]
          Length = 161

 Score =  164 bits (414), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 59/167 (35%), Positives = 99/167 (59%), Gaps = 6/167 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+  GSFDPITNGH+DII +  +  E++++ +  N  K+  F S+ ER EL++ SI
Sbjct: 1   MGKLAICPGSFDPITNGHLDIIQRGANVFEEVIVTVFNNQSKSPLF-SVTERIELLEDSI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H    S     V S   L ++ A++  A  ++RGLR ++DF+YEM++TS+NR L  +I 
Sbjct: 60  KHIPNVS-----VDSSSRLLMDYAREKKAHAVIRGLRAVSDFEYEMQITSMNRKLNEDIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           T+ +       +++S++++ +   D +I+  VP+PV   LK     L
Sbjct: 115 TLFMMTNNQYSFLSSSMVKEIAKYDGNISGLVPEPVEKALKAKFNYL 161


>gi|119897053|ref|YP_932266.1| phosphopantetheine adenylyltransferase [Azoarcus sp. BH72]
 gi|167009040|sp|A1K3H4|COAD_AZOSB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|119669466|emb|CAL93379.1| Pantetheine-phosphate adenylyltransferase [Azoarcus sp. BH72]
          Length = 163

 Score =  164 bits (414), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 95/167 (56%), Gaps = 8/167 (4%)

Query: 2   MR--KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           MR   A+Y G+FDP T GH D++ +A    + +V+ +  +  K   F +++ER E+ ++ 
Sbjct: 1   MRDGVAIYPGTFDPFTRGHEDLVRRASLLFDQVVVGVAESRGKAPIF-TLEERVEIAREV 59

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           +  F       V V  F+GL ++  +  + +VI+RGLR ++DF+YE +M  +NR L P++
Sbjct: 60  VKPFPN-----VRVAGFDGLLMDFLRAQNGRVILRGLRAVSDFEYEFQMAGMNRKLFPDV 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            T+ L   E   ++++T++R +  +  D++ FV   V   L+  V S
Sbjct: 115 ETVFLTPAEEYMFISATMVREIARLGGDVSKFVQPSVLTQLQQKVSS 161


>gi|157149251|ref|YP_001456570.1| phosphopantetheine adenylyltransferase [Citrobacter koseri ATCC
           BAA-895]
 gi|166216535|sp|A8ARM1|COAD_CITK8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|157086456|gb|ABV16134.1| hypothetical protein CKO_05091 [Citrobacter koseri ATCC BAA-895]
          Length = 159

 Score =  164 bits (414), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F +++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMF-TLEERVALAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A+   A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHLGNVE-----VMGFSDLMANFARIQQANILIRGLRAVADFEYEMQLAHMNRHLMPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L + + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMDKLK 159


>gi|153834844|ref|ZP_01987511.1| pantetheine-phosphate adenylyltransferase [Vibrio harveyi HY01]
 gi|148868715|gb|EDL67792.1| pantetheine-phosphate adenylyltransferase [Vibrio harveyi HY01]
          Length = 159

 Score =  164 bits (414), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 59/165 (35%), Positives = 93/165 (56%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+K +Y G+FDPITNGH+DII +A +  + ++I +  +  K   F S++ER +L++ S  
Sbjct: 1   MKKVIYPGTFDPITNGHLDIITRAANMFDQIIIGVAASPSKKTLF-SLEERVKLVEASTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H    S        F GL V+ A++  A V+VRGLR   DF+YE  +TS+ R L P + +
Sbjct: 60  HLSNVS-----TAGFSGLLVDFAREQEANVLVRGLRTTVDFEYEFGLTSMYRKLLPGVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++ST++R +     D+  FVP  V   +K  V  
Sbjct: 115 VFLTPAEEYAFLSSTIVREVAIHGGDVEQFVPKCVHTAIKTKVAK 159


>gi|28198198|ref|NP_778512.1| phosphopantetheine adenylyltransferase [Xylella fastidiosa
           Temecula1]
 gi|182680833|ref|YP_001828993.1| phosphopantetheine adenylyltransferase [Xylella fastidiosa M23]
 gi|31563025|sp|Q87EM8|COAD_XYLFT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541055|sp|B2I7J1|COAD_XYLF2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|28056268|gb|AAO28161.1| phosphopantetheine adenyltransferase [Xylella fastidiosa Temecula1]
 gi|182630943|gb|ACB91719.1| pantetheine-phosphate adenylyltransferase [Xylella fastidiosa M23]
 gi|307579301|gb|ADN63270.1| phosphopantetheine adenylyltransferase [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 162

 Score =  164 bits (414), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 93/162 (57%), Gaps = 6/162 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K      +Q+R  L ++++  
Sbjct: 7   RIAVYPGTFDPITNGHIDLVSRAAPLFESVVVGVAQSPSKGPSL-PLQQRVTLAREALCQ 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V VI F+ L  +  + + A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 66  HEN-----VQVIGFDTLLAHFVRHVGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
            L   E   +++S+L+R +  +  D++ F P  V   L+  +
Sbjct: 121 FLTPAEQHSFISSSLVREIARLGGDVSGFAPAAVVAALRQNL 162


>gi|325289861|ref|YP_004266042.1| Phosphopantetheine adenylyltransferase [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324965262|gb|ADY56041.1| Phosphopantetheine adenylyltransferase [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 158

 Score =  164 bits (414), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 58/163 (35%), Positives = 90/163 (55%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR AVY G+FDP+T GHMDI+ +A    + ++I +  NS K   F S++ER EL+K  I 
Sbjct: 1   MRIAVYPGTFDPVTLGHMDILHRAAQLFDKIIIGVAANSNKETLF-SLEERQELLKHEIK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V  F GL V  A+   A  ++RGLR ++DF+YE ++  +N+ L P++ T
Sbjct: 60  EMSNVE-----VCPFSGLTVEFARQCGAVALIRGLRAISDFEYEFQLALMNKKLAPDMET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L  K    +++S+ I+   S+   I+ FVP  V   L   +
Sbjct: 115 VFLMTKSEYSFISSSAIKWAASLKGSISEFVPPNVEKALLKKL 157


>gi|59710739|ref|YP_203515.1| phosphopantetheine adenylyltransferase [Vibrio fischeri ES114]
 gi|71648653|sp|Q5E8L9|COAD_VIBF1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|59478840|gb|AAW84627.1| pantetheine-phosphate adenylyltransferase [Vibrio fischeri ES114]
          Length = 162

 Score =  164 bits (414), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 58/166 (34%), Positives = 94/166 (56%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +  +Y G+FDPITNGH+D+I ++ S  + +++A+  +  K   F ++ ER +L++   
Sbjct: 1   MTKLTLYPGTFDPITNGHLDLIKRSASMFDHIIVAVAASPSKKTLF-TLDERVQLVQAVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     V V  F GL V+ AK+  A ++VRGLR   DF+YE  +TS+ R L PE+ 
Sbjct: 60  KDLPN-----VYVEGFSGLMVDFAKEKKANLLVRGLRTTMDFEYEFGLTSMYRKLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           ++ L   E   +++ST++R +      + +FVP  V   LKN V S
Sbjct: 115 SVFLTPSEEYAFLSSTIVREVALHGGSVEAFVPSSVNQALKNKVAS 160


>gi|220908683|ref|YP_002483994.1| phosphopantetheine adenylyltransferase [Cyanothece sp. PCC 7425]
 gi|254763946|sp|B8HPS4|COAD_CYAP4 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|219865294|gb|ACL45633.1| pantetheine-phosphate adenylyltransferase [Cyanothece sp. PCC 7425]
          Length = 169

 Score =  164 bits (414), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 46/163 (28%), Positives = 82/163 (50%), Gaps = 6/163 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            AVY GSFDPIT GH+D+I +     E +V+A+  N  K   F ++++R + I+    H 
Sbjct: 2   IAVYPGSFDPITLGHLDVIERGCKLFETVVVAVSKNPNKIPLF-TVEQRIQQIRTCTLHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                +    ++     +       AQV++RGLR ++DF+YE++M   N+ L P+I T+ 
Sbjct: 61  ANVEIDAFHGLTVSYAKMRQ-----AQVLLRGLRAVSDFEYELQMAHTNKSLYPQIETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           L       +++S+ ++ +      +   VP  V + L+     
Sbjct: 116 LTTANEYSFLSSSQVKEIARFGGSVAHLVPANVAIDLEKCFAQ 158


>gi|145301058|ref|YP_001143899.1| phosphopantetheine adenylyltransferase [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|166216053|sp|A4STC9|COAD_AERS4 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|142853830|gb|ABO92151.1| pantetheine-phosphate adenylyltransferase [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|224995191|gb|ACN76678.1| CoaD [Aeromonas salmonicida]
          Length = 160

 Score =  164 bits (414), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 54/163 (33%), Positives = 89/163 (54%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  K +Y G+FDPITNGH D+I +A    +++V+ +  +  K   F   + R  L +Q  
Sbjct: 1   MTNKVIYPGTFDPITNGHTDLIGRAARLFDEVVVGVANSPSKRPLFDLAE-RVLLARQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AK+  A V++RGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 60  AHLPNVK-----VVGFSGLLVDFAKEQQANVLIRGLRAVSDFEYEFQLANMNRRLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           ++ L   E + +++STL++ +     DI  FV   V   +   
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDIRQFVDPIVAKAIAAK 157


>gi|160877572|ref|YP_001556888.1| phosphopantetheine adenylyltransferase [Shewanella baltica OS195]
 gi|189082588|sp|A9KWX0|COAD_SHEB9 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|160863094|gb|ABX51628.1| pantetheine-phosphate adenylyltransferase [Shewanella baltica
           OS195]
 gi|315269770|gb|ADT96623.1| pantetheine-phosphate adenylyltransferase [Shewanella baltica
           OS678]
          Length = 163

 Score =  164 bits (414), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 56/157 (35%), Positives = 93/157 (59%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH D+I +A    + ++I I  N  K   F +++ER EL+ +  
Sbjct: 1   MHTRAIYPGTFDPITNGHADLIERAAKLFKHVIIGIAANPSKQPRF-TLEERVELVNRVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHLDNVE-----VVGFSGLLVDFAKEQKASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E + +++STL++ +     D++ FV   V 
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHSEVA 151


>gi|56459382|ref|YP_154663.1| phosphopantetheine adenylyltransferase [Idiomarina loihiensis L2TR]
 gi|61212490|sp|Q5QUN6|COAD_IDILO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|56178392|gb|AAV81114.1| Phosphopantetheine adenylyltransferase [Idiomarina loihiensis L2TR]
          Length = 166

 Score =  164 bits (414), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 97/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R+A+Y G+FDPITNGH D+I +A +   ++V+ I  +  K   F S++ER  L +Q  
Sbjct: 1   MHRRAIYPGTFDPITNGHADLIERAANLFSEIVVGIAESPSKKPLF-SLEERVLLAQQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 + + V+V+ F GL VN AK+  A V++RGLR ++DF+YE ++ ++NR L P + 
Sbjct: 60  E-----NLDNVTVVGFSGLLVNFAKEYEATVLIRGLRAVSDFEYEFQLANMNRRLAPNLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E + +++S+L++ +     D++ F    V   L+    
Sbjct: 115 SVFLTPAEENSFISSSLVKEVALHGGDVSGFTDARVASALEQKFS 159


>gi|86749991|ref|YP_486487.1| phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           HaA2]
 gi|123292509|sp|Q2IW34|COAD_RHOP2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|86573019|gb|ABD07576.1| Phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           HaA2]
          Length = 165

 Score =  163 bits (413), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 95/165 (57%), Gaps = 1/165 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++  A+   + LV+AIG +  K   F + + R  ++++  
Sbjct: 1   MSRIALYPGSFDPVTNGHLDVVRHAVELCDRLVVAIGIHPGKKPLFTTEE-RLVMVRRVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +       +++ L V  A+ + A +++RGLRD TD DYEM++  +N  + P + 
Sbjct: 60  EPVAEAAGCAFDCTTYDNLTVTAAQQVGASLMIRGLRDGTDLDYEMQIAGMNETMAPGVH 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T+ L A    R +T+TL+R + ++  D+++FVP  V   LK+   
Sbjct: 120 TVFLPASVGVRPITATLVRQIAAMGGDVSAFVPPDVAASLKSKFA 164


>gi|255318862|ref|ZP_05360088.1| pantetheine-phosphate adenylyltransferase [Acinetobacter
           radioresistens SK82]
 gi|262378880|ref|ZP_06072037.1| pantetheine-phosphate adenylyltransferase [Acinetobacter
           radioresistens SH164]
 gi|255304118|gb|EET83309.1| pantetheine-phosphate adenylyltransferase [Acinetobacter
           radioresistens SK82]
 gi|262300165|gb|EEY88077.1| pantetheine-phosphate adenylyltransferase [Acinetobacter
           radioresistens SH164]
          Length = 163

 Score =  163 bits (413), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 55/164 (33%), Positives = 91/164 (55%), Gaps = 7/164 (4%)

Query: 1   MMR-KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           M + + +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER  L K S
Sbjct: 1   MSKARVIYPGTFDPITNGHIDLVTRAAKMFDEVVVAIAIGHHKNPVF-SLEERVALAKAS 59

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           + H           + F+GL VN   +  A  ++RGLR ++DF+YE ++ ++NR L P+ 
Sbjct: 60  LSHLSNVE-----FVGFDGLLVNFFHEQKATAVLRGLRAISDFEYEFQLANMNRQLDPQF 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
             + L   E   +++STL+R +  +  D+  FVP  V    K  
Sbjct: 115 EAVFLTPSEQYSFISSTLVREIARLKGDVNKFVPPAVVEAFKRK 158


>gi|332139466|ref|YP_004425204.1| phosphopantetheine adenylyltransferase [Alteromonas macleodii str.
           'Deep ecotype']
 gi|226708998|sp|B4S2C7|COAD_ALTMD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|327549488|gb|AEA96206.1| phosphopantetheine adenylyltransferase [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 162

 Score =  163 bits (413), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 51/168 (30%), Positives = 94/168 (55%), Gaps = 6/168 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH D+I +A      +++AI  N  K   F +++ER E+IK+  
Sbjct: 1   MHTRALYPGTFDPITNGHADLIERASQLFSHVIVAIASNPSKKPLF-TLEERVEMIKKVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V+ F GL  + A + +A +++RGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  ADLPNVE-----VVGFTGLLADFADEQNATILIRGLRAVSDFEYEFQLANMNRRLNPKLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           ++ L   E + +++STL++ +      ++ F    V   L++ +    
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHRGAVSGFCHPVVEQALRDRLGKKN 162


>gi|126737917|ref|ZP_01753647.1| pantetheine-phosphate adenylyltransferase [Roseobacter sp.
           SK209-2-6]
 gi|126721310|gb|EBA18014.1| pantetheine-phosphate adenylyltransferase [Roseobacter sp.
           SK209-2-6]
          Length = 166

 Score =  163 bits (413), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 59/165 (35%), Positives = 93/165 (56%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F S++ER  +I+    
Sbjct: 1   MRVGLYPGTFDPITLGHIDIIRRASALVDKLVIGVAINRDKGPMF-SLEERVVMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L ++ A+D+ AQ+IVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  KLSEQTGTEIVAHPFENLLIDCARDVGAQIIVRGLRAVADFEYEYQMVGMNRVLDSSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A+   + + S L++ +  +D D++SFV   V   L   +  
Sbjct: 120 VFLMAEARHQAIASKLVKEIARLDGDVSSFVTPLVNAELAKRLGK 164


>gi|39935667|ref|NP_947943.1| phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           CGA009]
 gi|61212613|sp|Q6N6L4|COAD_RHOPA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|39649520|emb|CAE28042.1| phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           CGA009]
          Length = 169

 Score =  163 bits (413), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 55/166 (33%), Positives = 97/166 (58%), Gaps = 1/166 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++  A++  + LV+AIG +  K   F + + R  ++++  
Sbjct: 1   MSRIALYPGSFDPVTNGHLDVVRHAVALCDKLVVAIGIHPGKKPLFTTEE-RLAMVERVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +       +++ L V  A+ + A +++RGLRD +D DYEM++  +N  + P I 
Sbjct: 60  GPVAKAAGCDFGCTTYDNLTVTAAEKVGATLMIRGLRDGSDLDYEMQIAGMNETMAPAIH 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+ L A    R +T+TL+R + ++  D+++FVP  V   LK+   +
Sbjct: 120 TVFLPASVGVRPITATLVRQIAAMGGDVSAFVPAEVASALKSKFAA 165


>gi|320201341|gb|EFW75922.1| Phosphopantetheine adenylyltransferase [Escherichia coli EC4100B]
          Length = 159

 Score =  163 bits (413), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F+ ++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMFI-LEERVALAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHLGNVE-----VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA 159


>gi|281411970|ref|YP_003346049.1| pantetheine-phosphate adenylyltransferase [Thermotoga naphthophila
           RKU-10]
 gi|281373073|gb|ADA66635.1| pantetheine-phosphate adenylyltransferase [Thermotoga naphthophila
           RKU-10]
          Length = 161

 Score =  163 bits (413), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 59/168 (35%), Positives = 97/168 (57%), Gaps = 7/168 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDPIT GH+DII +ALS  ++LV+ +  N  K   F +++ER +LI++ + 
Sbjct: 1   MK-AVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKKCMF-TLEERKKLIEEVLS 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                  + V V    GL V+  K    +V+VRGLR +TD++YE++M   N+ L  ++ T
Sbjct: 59  -----DLDGVKVDVHNGLLVDYLKKHGIKVLVRGLRAVTDYEYELQMALANKKLYSDLET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + L A E   +++S+L++ +     D+T +VP  V   L   +    +
Sbjct: 114 VFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLKEGKR 161


>gi|56752097|ref|YP_172798.1| phosphopantetheine adenylyltransferase [Synechococcus elongatus PCC
           6301]
 gi|81300816|ref|YP_401024.1| phosphopantetheine adenylyltransferase [Synechococcus elongatus PCC
           7942]
 gi|14195644|sp|Q55235|COAD_SYNE7 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|61212480|sp|Q5N092|COAD_SYNP6 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|7272369|gb|AAA16170.2| ORF2 [Synechococcus elongatus PCC 7942]
 gi|56687056|dbj|BAD80278.1| phosphopantetheine adenylyltransferase [Synechococcus elongatus PCC
           6301]
 gi|81169697|gb|ABB58037.1| Phosphopantetheine adenylyltransferase [Synechococcus elongatus PCC
           7942]
          Length = 166

 Score =  163 bits (413), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 58/169 (34%), Positives = 93/169 (55%), Gaps = 6/169 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y GSFDPIT GH+DII +     + + +A+  N  K   F S+QER E I ++I H  
Sbjct: 3   AIYPGSFDPITFGHLDIIERGCRLFDQVYVAVLRNPNKQPMF-SVQERLEQIAKAIAHLP 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                   V SFEGL VN A+   A  I+RGLR ++DF+ E++M + N+ L  ++ T+ L
Sbjct: 62  N-----AQVDSFEGLTVNYARQRQAGAILRGLRVLSDFELELQMANTNKTLASDLETVFL 116

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSI 173
                  +++S+L++ +     ++  FVP  V   L +    +V+ D +
Sbjct: 117 TTSTEYSFLSSSLVKEVARFGGNVEHFVPSHVAAALYDQFHPVVERDRL 165


>gi|47565803|ref|ZP_00236842.1| pantetheine-phosphate adenylyltransferase [Bacillus cereus G9241]
 gi|47557083|gb|EAL15412.1| pantetheine-phosphate adenylyltransferase [Bacillus cereus G9241]
          Length = 163

 Score =  163 bits (413), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 55/169 (32%), Positives = 91/169 (53%), Gaps = 6/169 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+ +GSFDPIT GH+DII +     +++ + +  NS K   F S++ER +LI+++ 
Sbjct: 1   MTSIAISSGSFDPITLGHLDIIKRGAKVFDEVYVVVLNNSSKKPFF-SVEERLDLIREAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V S  GL V  AK  +A  I+RGLR ++DF+YEM++TS+NR L  +I 
Sbjct: 60  KDIPNVK-----VDSHSGLLVEYAKMRNANAILRGLRAVSDFEYEMQITSMNRKLDEDIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           T  +       +++S++++ +      +   VP  V   LK    + +K
Sbjct: 115 TFFIMTNNQYSFLSSSIVKEVARYGGSVVDLVPPVVERALKEKFQTPLK 163


>gi|270265224|ref|ZP_06193486.1| phosphopantetheine adenylyltransferase [Serratia odorifera 4Rx13]
 gi|270040858|gb|EFA13960.1| phosphopantetheine adenylyltransferase [Serratia odorifera 4Rx13]
          Length = 161

 Score =  163 bits (413), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 92/165 (55%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+D++ +A    + +++AI  +  K   F +++ER  L  Q  
Sbjct: 1   MTSKAIYPGTFDPLTNGHLDLVTRASLMFDHVILAIAASPSKKPLF-TLEERVALATQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  + A   +A ++VRGLR ++DF+YE+++ ++NR L P + 
Sbjct: 60  SHLDNVE-----VLGFSELMAHFAAHQNANILVRGLRAVSDFEYELQLANMNRHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E   +++S+L++ +     DI  F+PD V   L   + 
Sbjct: 115 SVFLMPSEEWSFISSSLVKEVARHGGDIAPFLPDVVTQALMERLA 159


>gi|225016607|ref|ZP_03705799.1| hypothetical protein CLOSTMETH_00514 [Clostridium methylpentosum
           DSM 5476]
 gi|224950571|gb|EEG31780.1| hypothetical protein CLOSTMETH_00514 [Clostridium methylpentosum
           DSM 5476]
          Length = 169

 Score =  163 bits (413), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 93/165 (56%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+  GSFDPIT GH+DII +A    + +++ +  N  K   F +++++ + I ++  
Sbjct: 11  MRVAICPGSFDPITMGHLDIITRACKLFDKVIVLVSDNPDKNATF-TVEQKLDFIDRATA 69

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H     S+  S     GL  +  +D +A  IV+GLR ++DF+YE +M   NR L P+  T
Sbjct: 70  HLPEVESDYTS-----GLLADYMRDKNACAIVKGLRAISDFEYEFQMALANRKLNPDAET 124

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L  +  + Y++S+L+R +  +  DI+ FVP+ +   ++  +  
Sbjct: 125 VFLTTQGENMYLSSSLVRQIAGLGGDISGFVPEVIQKDIEQALKK 169


>gi|283787733|ref|YP_003367598.1| phosphopantetheine adenylyltransferase [Citrobacter rodentium
           ICC168]
 gi|282951187|emb|CBG90880.1| phosphopantetheine adenylyltransferase [Citrobacter rodentium
           ICC168]
          Length = 159

 Score =  163 bits (413), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 95/165 (57%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDP+TNGH+DII +A    + +++AI  +  K   F S++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPLTNGHIDIITRATQMFDHVILAIAASPGKKPMF-SLEERVALARQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  + A+   A +++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHLNNVE-----VLGFSDLMASFARQQQANILIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +   + D+T F+P  +   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHEGDVTHFLPANIHQALMEKLR 159


>gi|168188190|gb|ACA14484.1| CoaD [Aeromonas hydrophila]
          Length = 215

 Score =  163 bits (413), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 53/163 (32%), Positives = 89/163 (54%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  K +Y G+FDPITNGH D+I +A    +++V+ +  +  K   F   + R  L +Q  
Sbjct: 56  MTNKVIYPGTFDPITNGHTDLIGRAARLFDEVVVGVANSPSKRPLFDLAE-RVLLAQQVT 114

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ A++  A V++RGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 115 AHLPNVK-----VVGFSGLLVDFAREQQANVLIRGLRAVSDFEYEFQLANMNRRLMPELE 169

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           ++ L   E + +++STL++ +     DI  FV   V   +   
Sbjct: 170 SVFLTPAEENSFISSTLVKEVALHGGDIRQFVDPIVAKAIAAK 212


>gi|126664645|ref|ZP_01735629.1| phosphopantetheine adenylyltransferase [Marinobacter sp. ELB17]
 gi|126630971|gb|EBA01585.1| phosphopantetheine adenylyltransferase [Marinobacter sp. ELB17]
          Length = 158

 Score =  163 bits (413), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 54/164 (32%), Positives = 88/164 (53%), Gaps = 6/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M K +Y G+FDPIT+GH D+I +A    +++V+A+  NS K       +    + + +  
Sbjct: 1   MPKVIYPGTFDPITHGHTDLIERASRLFDEVVVAVAYNSKKKPLLELEERCELVRRATAH 60

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    V+V+ F  L     +  +A VI+RGLR ++DF+YE ++  +NR L PE+ +
Sbjct: 61  ------VPNVTVMGFSNLLAEFVRSQNATVILRGLRAVSDFEYEFQLADMNRRLAPELES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L       Y++STLIR + S+  D++ FV   V   LKN   
Sbjct: 115 VFLTPTNHLSYISSTLIREIASLGGDVSEFVDPAVQDALKNKFS 158


>gi|121999087|ref|YP_001003874.1| phosphopantetheine adenylyltransferase [Halorhodospira halophila
           SL1]
 gi|229500830|sp|A1WZG0|COAD_HALHL RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|121590492|gb|ABM63072.1| Phosphopantetheine adenylyltransferase [Halorhodospira halophila
           SL1]
          Length = 164

 Score =  163 bits (413), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 56/169 (33%), Positives = 94/169 (55%), Gaps = 8/169 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSV--KTKGFLSIQERSELIKQ 58
           M   A+Y G+FDPIT+GH D+I +     + L++ +  N    K   F  ++ER EL + 
Sbjct: 1   MGVTAIYPGTFDPITHGHTDLIQRGARLFDRLIVGVAANPSPSKAPAFA-VEERLELART 59

Query: 59  SIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPE 118
           ++        + V V +F  L V+      AQVIVRGLR ++DF+YE ++ S+NR L  +
Sbjct: 60  ALA-----GIDNVEVEAFTSLLVDFVAHHEAQVIVRGLRAVSDFEYEFQLASMNRQLRAD 114

Query: 119 IATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + T+ L   E   +++S+L+R + ++  D++ FV   V   L+N V  +
Sbjct: 115 VETVFLTPAEQYAFISSSLVREVAALGGDVSRFVHPAVAEALRNRVRRV 163


>gi|289643145|ref|ZP_06475274.1| pantetheine-phosphate adenylyltransferase [Frankia symbiont of
           Datisca glomerata]
 gi|289507037|gb|EFD28007.1| pantetheine-phosphate adenylyltransferase [Frankia symbiont of
           Datisca glomerata]
          Length = 158

 Score =  163 bits (413), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 93/165 (56%), Gaps = 7/165 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+A   GSFDPITNGH+DII++A    +++V+A+  N  K   F +++ER ELI++   
Sbjct: 1   MRRAACPGSFDPITNGHLDIIVRASRLFDEVVVAVLINKNKANLF-TVEERIELIREVTR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    V V S  GL V+  +    Q IV+GLR ++DFDYE++M  +N  L   + T
Sbjct: 60  DHSN-----VVVESSHGLLVDFCRARGIQAIVKGLRAVSDFDYELQMAQMNHSLA-GVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + +       +++S+L++ + +   D++  VPD V   L+  +  
Sbjct: 114 LFMSTNPQYAFLSSSLVKEVATYGGDVSGLVPDVVLKQLRERLAR 158


>gi|193214911|ref|YP_001996110.1| phosphopantetheine adenylyltransferase [Chloroherpeton thalassium
           ATCC 35110]
 gi|193088388|gb|ACF13663.1| pantetheine-phosphate adenylyltransferase [Chloroherpeton
           thalassium ATCC 35110]
          Length = 168

 Score =  163 bits (413), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 58/170 (34%), Positives = 94/170 (55%), Gaps = 5/170 (2%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R+A+Y G+FDPITNGH+D++ +ALS  +++ + +  N+ K   F + +ER E+I++++  
Sbjct: 4   RRAIYPGTFDPITNGHIDVLERALSIFDEITVVVAVNNQKKPLF-TAEERMEMIQEAVAG 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
           +       +     EGL    A    A  I+RGLR   DF+YE ++  +NR L PEI T+
Sbjct: 63  YSGVKVEILQ----EGLLAEYAHRKEAVAIIRGLRQFIDFEYEFQIALMNRNLYPEITTV 118

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDS 172
            L   E   Y+ S++IR +  +  DI++ VP  V   LK    +  K   
Sbjct: 119 FLMPNEKYTYLASSIIREVSRLGGDISNLVPPCVLSRLKEKHAATAKNQR 168


>gi|16804091|ref|NP_465576.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes
           EGD-e]
 gi|217963801|ref|YP_002349479.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           HCC23]
 gi|224501149|ref|ZP_03669456.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes FSL
           R2-561]
 gi|254899250|ref|ZP_05259174.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes
           J0161]
 gi|254936936|ref|ZP_05268633.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes
           F6900]
 gi|290892198|ref|ZP_06555194.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes FSL
           J2-071]
 gi|29427881|sp|Q8Y5K7|COAD_LISMO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254764157|sp|B8DH77|COAD_LISMH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|16411522|emb|CAD00130.1| lmo2052 [Listeria monocytogenes EGD-e]
 gi|217333071|gb|ACK38865.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           HCC23]
 gi|258609538|gb|EEW22146.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes
           F6900]
 gi|290558321|gb|EFD91839.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes FSL
           J2-071]
 gi|307571626|emb|CAR84805.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           L99]
 gi|313607723|gb|EFR83951.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           FSL F2-208]
          Length = 160

 Score =  163 bits (413), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 58/163 (35%), Positives = 91/163 (55%), Gaps = 6/163 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + AV  G+FDPITNGH+DII +A    + L +++  NS K   F +I+ER E+I+Q   H
Sbjct: 4   KIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSKKPLF-TIEERMEMIRQVTAH 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V V S  GL V+ A    A  IVRGLR ++DF+YEM++ S+NR L  +I T 
Sbjct: 63  LPN-----VQVESASGLTVDYAATRGATAIVRGLRAVSDFEYEMQIASMNRTLNADIETF 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
            +       +++S++++ +     DI+  VP+ V   ++    
Sbjct: 118 FVMTNTKYSFLSSSMVKEVAQYQGDISELVPEIVNKAVQAKFK 160


>gi|331655266|ref|ZP_08356265.1| pantetheine-phosphate adenylyltransferase [Escherichia coli M718]
 gi|331047281|gb|EGI19359.1| pantetheine-phosphate adenylyltransferase [Escherichia coli M718]
          Length = 194

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 97/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F +++ER +L +Q+ 
Sbjct: 36  MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMF-TLEERVDLAQQAT 94

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 95  AHLGNVE-----VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 149

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 150 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA 194


>gi|315283096|ref|ZP_07871362.1| pantetheine-phosphate adenylyltransferase [Listeria marthii FSL
           S4-120]
 gi|313613255|gb|EFR87133.1| pantetheine-phosphate adenylyltransferase [Listeria marthii FSL
           S4-120]
          Length = 160

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 59/163 (36%), Positives = 90/163 (55%), Gaps = 6/163 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + AV  G+FDPITNGH+DII +A    + L +++  NS K   F +++ER E+IKQ   H
Sbjct: 4   KIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSKKPLF-TVEERMEMIKQVTAH 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V V S  GL V+ A    A  IVRGLR ++DF+YEM++ S+NR L  EI T 
Sbjct: 63  LPN-----VQVESASGLTVDYAAKRGATAIVRGLRAVSDFEYEMQIASMNRTLNAEIETF 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
            +       +++S++++ +     DI   VP+ V   ++    
Sbjct: 118 FVMTNTKYSFLSSSMVKEVAQYQGDIRELVPEVVNEAVQAKFK 160


>gi|254515833|ref|ZP_05127893.1| pantetheine-phosphate adenylyltransferase [gamma proteobacterium
           NOR5-3]
 gi|219675555|gb|EED31921.1| pantetheine-phosphate adenylyltransferase [gamma proteobacterium
           NOR5-3]
          Length = 161

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 52/162 (32%), Positives = 87/162 (53%), Gaps = 6/162 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R  +Y G+FDPITNGH+D++ +A    + +V+AI  +  KT  F   +      + ++  
Sbjct: 4   RTVIYPGTFDPITNGHVDLVERAAKLFDRVVVAIAFSEKKTPLFTLDE------RVALCA 57

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                 + V V  F  L  + A   +A+ ++RGLR + DF+YE ++ ++NR L PE  ++
Sbjct: 58  DALAGIDNVEVKGFSNLLTDFAISENARCVLRGLRAVADFEYEFQLANMNRALYPEFESV 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
            L   E   Y++S+L+R + ++  DIT FVP  V   L    
Sbjct: 118 FLTPSEHLSYISSSLVREIAALQGDITPFVPSNVSDALTRKF 159


>gi|293393615|ref|ZP_06637925.1| pantetheine-phosphate adenylyltransferase [Serratia odorifera DSM
           4582]
 gi|291423950|gb|EFE97169.1| pantetheine-phosphate adenylyltransferase [Serratia odorifera DSM
           4582]
          Length = 161

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+D++ +A    + +++AI  +  K   F +++ER  L  Q  
Sbjct: 1   MTSKAIYPGTFDPMTNGHLDLVTRASLMFDRVILAIAASPSKKPLF-TLEERVALATQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  + A   +A ++VRGLR ++DF+YE+++ ++NR L P++ 
Sbjct: 60  SHLDNVE-----VLGFSELMAHFAAHQNANILVRGLRAVSDFEYELQLANMNRHLMPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E   +++S+L++ +     DI+ F+PD V   L   + 
Sbjct: 115 SVFLMPSEEWSFISSSLVKEVARHGGDISPFLPDVVTQALMAKLS 159


>gi|329904068|ref|ZP_08273663.1| Phosphopantetheine adenylyltransferase [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327548152|gb|EGF32866.1| Phosphopantetheine adenylyltransferase [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 162

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 92/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y G+FDP+T GH D++ +A      L++ +  +  K   F  ++ER  +  + + 
Sbjct: 1   MVTAIYPGTFDPLTRGHEDLVRRASGLFGKLIVGVADSKNKKPFF-DLEERLTIANEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+       V V SF GL  +  +   A+VIVRGLR ++DF+YE +M  +NR L PE+ T
Sbjct: 60  HYPN-----VVVESFSGLLKDFVRRHDARVIVRGLRAVSDFEYEFQMAGMNRYLLPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   +  ++++ T++R +  +  D++ FV   V  +LK  + +
Sbjct: 115 LFLTPSDQYQFISGTIVREIALLGGDVSKFVFPSVEKWLKEKIAA 159


>gi|30022017|ref|NP_833648.1| phosphopantetheine adenylyltransferase [Bacillus cereus ATCC 14579]
 gi|75762262|ref|ZP_00742149.1| Phosphopantetheine adenylyltransferase [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|206971081|ref|ZP_03232032.1| phosphopantetheine adenylyltransferase [Bacillus cereus AH1134]
 gi|218231719|ref|YP_002368729.1| phosphopantetheine adenylyltransferase [Bacillus cereus B4264]
 gi|218899085|ref|YP_002447496.1| phosphopantetheine adenylyltransferase [Bacillus cereus G9842]
 gi|296504423|ref|YP_003666123.1| phosphopantetheine adenylyltransferase [Bacillus thuringiensis
           BMB171]
 gi|61211619|sp|Q819P1|COAD_BACCR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226706685|sp|B7IVG6|COAD_BACC2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226706686|sp|B7H6R5|COAD_BACC4 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|29897573|gb|AAP10849.1| Phosphopantetheine adenylyltransferase [Bacillus cereus ATCC 14579]
 gi|74490245|gb|EAO53574.1| Phosphopantetheine adenylyltransferase [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|206733853|gb|EDZ51024.1| phosphopantetheine adenylyltransferase [Bacillus cereus AH1134]
 gi|218159676|gb|ACK59668.1| pantetheine-phosphate adenylyltransferase [Bacillus cereus B4264]
 gi|218544700|gb|ACK97094.1| phosphopantetheine adenylyltransferase [Bacillus cereus G9842]
 gi|296325475|gb|ADH08403.1| phosphopantetheine adenylyltransferase [Bacillus thuringiensis
           BMB171]
 gi|326941699|gb|AEA17595.1| phosphopantetheine adenylyltransferase [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 163

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 56/169 (33%), Positives = 90/169 (53%), Gaps = 6/169 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+ +GSFDPIT GH+DII +     +++ + +  NS K   F S++ER ELI+++ 
Sbjct: 1   MTSIAISSGSFDPITLGHLDIIKRGAKVFDEVYVVVLNNSSKKPFF-SVEERLELIREAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V S  GL V  AK  +A  I+RGLR ++DF+YEM++TS+NR L   I 
Sbjct: 60  KDIPNVK-----VDSHSGLLVEYAKMRNANAILRGLRAVSDFEYEMQITSMNRKLDENIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           T  +       +++S++++ +      +   VP  V   LK    + +K
Sbjct: 115 TFFIMTNNQYSFLSSSIVKEVARYGGSVVDLVPPIVERALKEKFQTPLK 163


>gi|30264001|ref|NP_846378.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           Ames]
 gi|42783024|ref|NP_980271.1| phosphopantetheine adenylyltransferase [Bacillus cereus ATCC 10987]
 gi|47529434|ref|YP_020783.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49186839|ref|YP_030091.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           Sterne]
 gi|49478454|ref|YP_037991.1| phosphopantetheine adenylyltransferase [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|52141559|ref|YP_085270.1| phosphopantetheine adenylyltransferase [Bacillus cereus E33L]
 gi|65321324|ref|ZP_00394283.1| COG0669: Phosphopantetheine adenylyltransferase [Bacillus anthracis
           str. A2012]
 gi|118479148|ref|YP_896299.1| phosphopantetheine adenylyltransferase [Bacillus thuringiensis str.
           Al Hakam]
 gi|165872182|ref|ZP_02216821.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           A0488]
 gi|167633632|ref|ZP_02391956.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           A0442]
 gi|167641027|ref|ZP_02399284.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           A0193]
 gi|170688798|ref|ZP_02880002.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           A0465]
 gi|170705730|ref|ZP_02896193.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           A0389]
 gi|177654306|ref|ZP_02936235.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           A0174]
 gi|190566214|ref|ZP_03019133.1| phosphopantetheine adenylyltransferase [Bacillus anthracis
           Tsiankovskii-I]
 gi|196035921|ref|ZP_03103323.1| phosphopantetheine adenylyltransferase [Bacillus cereus W]
 gi|196038863|ref|ZP_03106171.1| pantetheine-phosphate adenylyltransferase [Bacillus cereus
           NVH0597-99]
 gi|196045791|ref|ZP_03113020.1| phosphopantetheine adenylyltransferase [Bacillus cereus 03BB108]
 gi|206976753|ref|ZP_03237657.1| phosphopantetheine adenylyltransferase [Bacillus cereus H3081.97]
 gi|217961410|ref|YP_002339978.1| phosphopantetheine adenylyltransferase [Bacillus cereus AH187]
 gi|218905060|ref|YP_002452894.1| phosphopantetheine adenylyltransferase [Bacillus cereus AH820]
 gi|222097376|ref|YP_002531433.1| phosphopantetheine adenylyltransferase [Bacillus cereus Q1]
 gi|225865911|ref|YP_002751289.1| pantetheine-phosphate adenylyltransferase [Bacillus cereus 03BB102]
 gi|227816702|ref|YP_002816711.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str. CDC
           684]
 gi|229604704|ref|YP_002868230.1| pantetheine-phosphate adenylyltransferase [Bacillus anthracis str.
           A0248]
 gi|254683695|ref|ZP_05147555.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           CNEVA-9066]
 gi|254721531|ref|ZP_05183320.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           A1055]
 gi|254736040|ref|ZP_05193746.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           Western North America USA6153]
 gi|254743931|ref|ZP_05201614.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           Kruger B]
 gi|254754290|ref|ZP_05206325.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           Vollum]
 gi|254758019|ref|ZP_05210046.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           Australia 94]
 gi|301055420|ref|YP_003793631.1| phosphopantetheine adenylyltransferase [Bacillus anthracis CI]
 gi|61211435|sp|Q635Z7|COAD_BACCZ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|61211551|sp|Q732D8|COAD_BACC1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|61211625|sp|Q81W43|COAD_BACAN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|61212593|sp|Q6HEN5|COAD_BACHK RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216058|sp|A0RHU9|COAD_BACAH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226706684|sp|B7JK17|COAD_BACC0 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226706687|sp|B7HMA9|COAD_BACC7 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254763925|sp|C3P6T7|COAD_BACAA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254763926|sp|C3LHZ4|COAD_BACAC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254763927|sp|C1EPU3|COAD_BACC3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254763928|sp|B9IW07|COAD_BACCQ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|30258645|gb|AAP27864.1| pantetheine-phosphate adenylyltransferase [Bacillus anthracis str.
           Ames]
 gi|42738951|gb|AAS42879.1| phosphopantetheine adenylyltransferase [Bacillus cereus ATCC 10987]
 gi|47504582|gb|AAT33258.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49180766|gb|AAT56142.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           Sterne]
 gi|49330010|gb|AAT60656.1| phosphopantetheine adenylyltransferase (pantetheine-phosphate
           adenylyltransferase) [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|51975028|gb|AAU16578.1| phosphopantetheine adenylyltransferase (pantetheine-phosphate
           adenylyltransferase) [Bacillus cereus E33L]
 gi|118418373|gb|ABK86792.1| Phosphopantetheine adenylyltransferase [Bacillus thuringiensis str.
           Al Hakam]
 gi|164712129|gb|EDR17667.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           A0488]
 gi|167511077|gb|EDR86466.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           A0193]
 gi|167531038|gb|EDR93725.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           A0442]
 gi|170129270|gb|EDS98134.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           A0389]
 gi|170667314|gb|EDT18073.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           A0465]
 gi|172080796|gb|EDT65877.1| phosphopantetheine adenylyltransferase [Bacillus anthracis str.
           A0174]
 gi|190563133|gb|EDV17099.1| phosphopantetheine adenylyltransferase [Bacillus anthracis
           Tsiankovskii-I]
 gi|195991570|gb|EDX55536.1| phosphopantetheine adenylyltransferase [Bacillus cereus W]
 gi|196023231|gb|EDX61909.1| phosphopantetheine adenylyltransferase [Bacillus cereus 03BB108]
 gi|196030586|gb|EDX69185.1| pantetheine-phosphate adenylyltransferase [Bacillus cereus
           NVH0597-99]
 gi|206745063|gb|EDZ56466.1| phosphopantetheine adenylyltransferase [Bacillus cereus H3081.97]
 gi|217063486|gb|ACJ77736.1| phosphopantetheine adenylyltransferase [Bacillus cereus AH187]
 gi|218535075|gb|ACK87473.1| phosphopantetheine adenylyltransferase [Bacillus cereus AH820]
 gi|221241434|gb|ACM14144.1| phosphopantetheine adenylyltransferase (pantetheine-phosphate
           adenylyltransferase) [Bacillus cereus Q1]
 gi|225789129|gb|ACO29346.1| pantetheine-phosphate adenylyltransferase [Bacillus cereus 03BB102]
 gi|227006724|gb|ACP16467.1| pantetheine-phosphate adenylyltransferase [Bacillus anthracis str.
           CDC 684]
 gi|229269112|gb|ACQ50749.1| pantetheine-phosphate adenylyltransferase [Bacillus anthracis str.
           A0248]
 gi|300377589|gb|ADK06493.1| phosphopantetheine adenylyltransferase [Bacillus cereus biovar
           anthracis str. CI]
 gi|324327829|gb|ADY23089.1| phosphopantetheine adenylyltransferase [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 163

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 55/169 (32%), Positives = 90/169 (53%), Gaps = 6/169 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+ +GSFDPIT GH+DII +     +++ + +  NS K   F S++ER +LI+++ 
Sbjct: 1   MTSIAISSGSFDPITLGHLDIIKRGAKVFDEVYVVVLNNSSKKPFF-SVEERLDLIREAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V S  GL V  AK  +A  I+RGLR ++DF+YEM++TS+NR L   I 
Sbjct: 60  KDIPNVK-----VDSHSGLLVEYAKMRNANAILRGLRAVSDFEYEMQITSMNRKLDENIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           T  +       +++S++++ +      +   VP  V   LK    + +K
Sbjct: 115 TFFIMTNNQYSFLSSSIVKEVARYGGSVVDLVPPVVERALKEKFQTPLK 163


>gi|167037712|ref|YP_001665290.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167040373|ref|YP_001663358.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter sp.
           X514]
 gi|256752290|ref|ZP_05493153.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|300914457|ref|ZP_07131773.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter sp.
           X561]
 gi|307724307|ref|YP_003904058.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter sp.
           X513]
 gi|320116127|ref|YP_004186286.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
 gi|229541049|sp|B0K9Z1|COAD_THEP3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541050|sp|B0K1X4|COAD_THEPX RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166854613|gb|ABY93022.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter sp.
           X514]
 gi|166856546|gb|ABY94954.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256748858|gb|EEU61899.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|300889392|gb|EFK84538.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter sp.
           X561]
 gi|307581368|gb|ADN54767.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter sp.
           X513]
 gi|319929218|gb|ADV79903.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
          Length = 159

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 92/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+T GH+DII +  +  + L++A+  N  K   F S++ER EL+K    
Sbjct: 1   MKTAIYPGSFDPVTYGHIDIIERGANLFDKLIVAVLLNPSKKPLF-SVEERVELLKAVT- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                  + V +  F+GL V+ AK + A  I++GLR ++DF+YE +M  +N+ L P + T
Sbjct: 59  ----YDISNVEIDYFDGLLVDYAKKVKANAIIKGLRMVSDFEYEFQMALINKKLNPSLET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           I L       Y++S++++ +      ++ FVPD V   L      
Sbjct: 115 IFLMTNAKYGYLSSSVVKEIAQFGGCLSEFVPDIVAQKLMEKFSR 159


>gi|14719581|pdb|1QJC|A Chain A, Phosphopantetheine Adenylyltransferase In Complex With
           Ampcpp And 4'-Phosphopantetheine From Escherichia Coli
 gi|14719582|pdb|1QJC|B Chain B, Phosphopantetheine Adenylyltransferase In Complex With
           Ampcpp And 4'-Phosphopantetheine From Escherichia Coli
          Length = 158

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 53/163 (32%), Positives = 95/163 (58%), Gaps = 6/163 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F +++ER  L +Q+  H
Sbjct: 2   KRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMF-TLEERVALAQQATAH 60

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ ++
Sbjct: 61  LGNVE-----VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELESV 115

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
            L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 116 FLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA 158


>gi|16801224|ref|NP_471492.1| phosphopantetheine adenylyltransferase [Listeria innocua Clip11262]
 gi|29427917|sp|Q929W5|COAD_LISIN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|16414672|emb|CAC97388.1| lin2158 [Listeria innocua Clip11262]
 gi|313622958|gb|EFR93257.1| pantetheine-phosphate adenylyltransferase [Listeria innocua FSL
           J1-023]
          Length = 161

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 59/164 (35%), Positives = 90/164 (54%), Gaps = 6/164 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + AV  G+FDPITNGH+DII +A    + L +++  NS K   F +++ER E+IKQ   H
Sbjct: 4   KIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSKKPLF-TVEERMEMIKQVTAH 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V V S  GL V+ A    A  IVRGLR ++DF+YEM++ S+NR L  +I T 
Sbjct: 63  LPN-----VHVESASGLTVDYAAKRGATAIVRGLRAVSDFEYEMQIASMNRTLNADIETF 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            +       +++S++++ +     DI   VP+ V   +K     
Sbjct: 118 FVMTNTKYSFLSSSMVKEVAQYQGDIRELVPEVVNKAVKAKFNK 161


>gi|148269333|ref|YP_001243793.1| phosphopantetheine adenylyltransferase [Thermotoga petrophila
           RKU-1]
 gi|166216616|sp|A5IJ44|COAD_THEP1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|147734877|gb|ABQ46217.1| Phosphopantetheine adenylyltransferase [Thermotoga petrophila
           RKU-1]
          Length = 161

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 58/168 (34%), Positives = 95/168 (56%), Gaps = 7/168 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDPIT GH+DII +ALS  ++LV+ +  N  K   F +++ER +LI++ + 
Sbjct: 1   MK-AVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKKCMF-TLEERKKLIEEVLS 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V    GL V+  K    +V+VRGLR +TD++YE++M   N+ L  ++ T
Sbjct: 59  DLSGVK-----VDVHHGLLVDYLKKHGIKVLVRGLRAVTDYEYELQMALANKKLYSDLET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + L A E   +++S+L++ +     D+T +VP  V   L   +    +
Sbjct: 114 VFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLKEGKR 161


>gi|15837582|ref|NP_298270.1| phosphopantetheine adenylyltransferase [Xylella fastidiosa 9a5c]
 gi|14194526|sp|Q9PEP8|COAD_XYLFA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|9105912|gb|AAF83790.1|AE003936_4 lipopolysaccharide synthesis enzyme [Xylella fastidiosa 9a5c]
          Length = 162

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 93/162 (57%), Gaps = 6/162 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K      +Q+R  L ++++  
Sbjct: 7   RIAVYPGTFDPITNGHIDLVSRAAPLFESIVVGVAQSPSKGPSL-PLQQRVALAREALCQ 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V VI F+ L  +  + + A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 66  HEN-----VQVIGFDTLLAHFVRHVGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
            L   E   +++S+L+R +  +  D++ F P  V   L+  +
Sbjct: 121 FLTPAEQHSFISSSLVREIARLGGDVSGFAPAAVVAALRQNL 162


>gi|90580914|ref|ZP_01236716.1| phosphopantetheine adenylyltransferase [Vibrio angustum S14]
 gi|90437985|gb|EAS63174.1| phosphopantetheine adenylyltransferase [Vibrio angustum S14]
          Length = 160

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 49/166 (29%), Positives = 90/166 (54%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDPITNGH+D+I +A +  + +++ +  N  K   F   +      K + 
Sbjct: 1   MTTRVIYPGTFDPITNGHLDLIERAAAMFDHVIVGVAFNPSKKPLFDLNERVELAGKITK 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     V ++ F GL V+ AK+ +A ++VRGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 61  HLD------NVEIVGFSGLLVDFAKERNANILVRGLRAVSDFEYEFQLANMNRRLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+ L   E + +++ST+++ +     D++ FV   +   L      
Sbjct: 115 TVFLTPAEENSFISSTIVKEVALHKGDVSQFVDPLITEALLEKFAK 160


>gi|126726344|ref|ZP_01742185.1| pantetheine-phosphate adenylyltransferase [Rhodobacterales
           bacterium HTCC2150]
 gi|126704207|gb|EBA03299.1| pantetheine-phosphate adenylyltransferase [Rhodobacterales
           bacterium HTCC2150]
          Length = 164

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 56/164 (34%), Positives = 94/164 (57%), Gaps = 1/164 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT+GH+DI+ +A   V+ LVI +  N  K   F +++ER E+I++   
Sbjct: 1   MRIGLYPGTFDPITHGHLDIMKRAAVLVDRLVIGVAINRDKGPMF-TLEERVEMIEKHCA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   + V  FE L ++ A+D+ AQ I+RGLR ++DF+YE +M  +NR +   I T
Sbjct: 60  ALKEHTDVEIVVHPFENLLIDCARDVGAQFIIRGLRAVSDFEYEFQMVGMNRAMDSSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L A+   + + S L++ +  +  D++ FV   V   L +   
Sbjct: 120 VFLMAEAKHQAIASKLVKEIARLGGDVSKFVTKDVHQALLDKFQ 163


>gi|83311481|ref|YP_421745.1| phosphopantetheine adenylyltransferase [Magnetospirillum magneticum
           AMB-1]
 gi|82946322|dbj|BAE51186.1| Phosphopantetheine adenylyltransferase [Magnetospirillum magneticum
           AMB-1]
          Length = 168

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 55/163 (33%), Positives = 90/163 (55%), Gaps = 1/163 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
            R  +Y G+FDP+TNGHMDI+ +A   V+ L++A+  N+ K   F +++ER  + +  + 
Sbjct: 3   KRVGLYPGTFDPVTNGHMDIVARAARVVDHLIVAVAANAGKGPLF-TLEERVAMAELEMA 61

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    + V SF+ L V+      A +IVRGLR ++DF+YE +M  +N  L P+I T
Sbjct: 62  ELAQSIGASIEVRSFDTLLVDFTAGCGANLIVRGLRAVSDFEYEFQMAGMNARLSPDIET 121

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           I L A E  ++++S  ++ +  +  DI+ FV   V   L    
Sbjct: 122 IFLMASERCQFISSRFVKEIGRLGGDISQFVSPRVKAQLDEKF 164


>gi|15643504|ref|NP_228550.1| phosphopantetheine adenylyltransferase [Thermotoga maritima MSB8]
 gi|170287991|ref|YP_001738229.1| pantetheine-phosphate adenylyltransferase [Thermotoga sp. RQ2]
 gi|8469200|sp|Q9WZK0|COAD_THEMA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541051|sp|B1L7W5|COAD_THESQ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|4981266|gb|AAD35822.1|AE001744_12 lipopolysaccharide core biosynthesis protein KdtB [Thermotoga
           maritima MSB8]
 gi|170175494|gb|ACB08546.1| pantetheine-phosphate adenylyltransferase [Thermotoga sp. RQ2]
          Length = 161

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 59/168 (35%), Positives = 97/168 (57%), Gaps = 7/168 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDPIT GH+DII +ALS  ++LV+ +  N  K   F +++ER +LI++ + 
Sbjct: 1   MK-AVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKKCMF-TLEERKKLIEEVLS 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                  + V V    GL V+  K    +V+VRGLR +TD++YE++M   N+ L  ++ T
Sbjct: 59  -----DLDGVKVDVHHGLLVDYLKKHGIKVLVRGLRAVTDYEYELQMALANKKLYSDLET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + L A E   +++S+L++ +     D+T +VP  V   L   +    +
Sbjct: 114 VFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLKEGKR 161


>gi|71275663|ref|ZP_00651948.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related [Xylella
           fastidiosa Dixon]
 gi|71897793|ref|ZP_00680019.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related [Xylella
           fastidiosa Ann-1]
 gi|71901152|ref|ZP_00683257.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related [Xylella
           fastidiosa Ann-1]
 gi|170729518|ref|YP_001774951.1| phosphopantetheine adenylyltransferase [Xylella fastidiosa M12]
 gi|229541059|sp|B0U1Z4|COAD_XYLFM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|71163554|gb|EAO13271.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related [Xylella
           fastidiosa Dixon]
 gi|71729074|gb|EAO31200.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related [Xylella
           fastidiosa Ann-1]
 gi|71732348|gb|EAO34402.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related [Xylella
           fastidiosa Ann-1]
 gi|167964311|gb|ACA11321.1| Pantetheine-phosphate adenylyltransferase [Xylella fastidiosa M12]
          Length = 162

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 93/162 (57%), Gaps = 6/162 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K      +Q+R  L ++++  
Sbjct: 7   RIAVYPGTFDPITNGHIDLVSRAAPLFESIVVGVAQSPSKGPSL-PLQQRVTLAREALCQ 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V VI F+ L  +  + + A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 66  HEN-----VQVIGFDTLLAHFVRHVGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
            L   E   +++S+L+R +  +  D++ F P  V   L+  +
Sbjct: 121 FLTPAEQHSFISSSLVREIARLGGDVSGFAPAAVVAALRQNL 162


>gi|16762584|ref|NP_458201.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29144073|ref|NP_807415.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56415615|ref|YP_152690.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197364542|ref|YP_002144179.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|213161285|ref|ZP_03346995.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213418643|ref|ZP_03351709.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
 gi|213425233|ref|ZP_03357983.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213583921|ref|ZP_03365747.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213615650|ref|ZP_03371476.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213647923|ref|ZP_03377976.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213855125|ref|ZP_03383365.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289824125|ref|ZP_06543722.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|29427886|sp|Q8Z2H1|COAD_SALTI RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|81599219|sp|Q5PC10|COAD_SALPA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541041|sp|B5BI08|COAD_SALPK RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|25318320|pir||AH0971 pantetheine-phosphate adenylyltransferase (EC 2.7.7.3) - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16504889|emb|CAD03268.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139710|gb|AAO71275.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56129872|gb|AAV79378.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197096019|emb|CAR61606.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 159

 Score =  162 bits (411), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F ++ ER  L +++ 
Sbjct: 1   MQKRAIYPGTFDPITNGHLDIVTRATQMFDHVILAIAASPGKKPMF-TLNERVALAQKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A+D  A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHLGNVE-----VVGFSDLMANFARDRQANILIRGLRAVADFEYEMQLAHMNRHLMPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+PD V   L + + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPDNVHQALMDKLK 159


>gi|251770982|gb|EES51566.1| phosphopantetheine adenylyltransferase [Leptospirillum
           ferrodiazotrophum]
          Length = 163

 Score =  162 bits (411), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 63/168 (37%), Positives = 103/168 (61%), Gaps = 5/168 (2%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+R+AVY G+FDP+TNGH+D++ + LS  +++VI +  +  K   F S++ER  L+K++ 
Sbjct: 1   MIRRAVYPGTFDPVTNGHLDMLHRGLSLFDEIVIGVADSPRKAPLF-SLEERILLLKKT- 58

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              IP    +VSV+ F  L V+  ++  A+ I+RG+R + DFDYE+RM  +N+ L  +I 
Sbjct: 59  ---IPYPEPKVSVLGFSHLLVHFVRETGARCILRGVRAVADFDYELRMALINQNLDRDIE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           T+ L   E+  ++TST IR +  +  D++ FVP PV   L+       
Sbjct: 116 TVFLMPSENYMFITSTAIREIAELGGDLSHFVPLPVEDALRQKYSRRQ 163


>gi|114570422|ref|YP_757102.1| phosphopantetheine adenylyltransferase [Maricaulis maris MCS10]
 gi|114340884|gb|ABI66164.1| pantetheine-phosphate adenylyltransferase [Maricaulis maris MCS10]
          Length = 162

 Score =  162 bits (411), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 59/165 (35%), Positives = 101/165 (61%), Gaps = 3/165 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y G+FDP+TNGH+DII +A+  V+ LVI +  N  K   F S+ ER +++++ +
Sbjct: 1   MTRTALYPGTFDPLTNGHIDIIGRAVKLVDHLVIGVAINEAKHPLF-SLDERVDMVREEV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F      ++ V  F+GL ++ A++I AQ IVRGLR ++DF+YE +M ++N+ L  +I 
Sbjct: 60  APFA--DGAQIEVRPFDGLLMHFAEEIGAQSIVRGLRAVSDFEYEFQMVAMNQQLNDDIE 117

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T+ L A    + + S L++ +  +  +I++FV   +   LK  + 
Sbjct: 118 TVFLMADPRHQAIASRLVKEIAKLGGNISAFVTPNIERRLKERLA 162


>gi|17545109|ref|NP_518511.1| phosphopantetheine adenylyltransferase [Ralstonia solanacearum
           GMI1000]
 gi|83746833|ref|ZP_00943880.1| Phosphopantetheine adenylyltransferase [Ralstonia solanacearum
           UW551]
 gi|207742235|ref|YP_002258627.1| phosphopantetheine adenylyltransferase (pantetheine-phosphate
           adenylyltransferase) (ppat) (dephospho-coa
           pyrophosphorylase) protein [Ralstonia solanacearum
           IPO1609]
 gi|300692635|ref|YP_003753630.1| phosphopantetheine adenylyltransferase
           (CMP-deoxy-D-manno-octulosonate-lipid A transferase)
           [Ralstonia solanacearum PSI07]
 gi|300705256|ref|YP_003746859.1| phosphopantetheine adenylyltransferase [Ralstonia solanacearum
           CFBP2957]
 gi|29427878|sp|Q8Y2E6|COAD_RALSO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|17427400|emb|CAD13918.1| probable phosphopantetheine adenylyltransferase
           (pantetheine-phosphate adenylyltransferase) (ppat)
           (dephospho-coa pyrophosphorylase) protein [Ralstonia
           solanacearum GMI1000]
 gi|83726418|gb|EAP73549.1| Phosphopantetheine adenylyltransferase [Ralstonia solanacearum
           UW551]
 gi|206593623|emb|CAQ60550.1| phosphopantetheine adenylyltransferase (pantetheine-phosphate
           adenylyltransferase) (ppat) (dephospho-coa
           pyrophosphorylase) protein [Ralstonia solanacearum
           IPO1609]
 gi|299068051|emb|CBJ39265.1| phosphopantetheine adenylyltransferase
           (CMP-deoxy-D-manno-octulosonate-lipid A transferase)
           [Ralstonia solanacearum CMR15]
 gi|299072920|emb|CBJ44276.1| phosphopantetheine adenylyltransferase
           (CMP-deoxy-D-manno-octulosonate-lipid A transferase)
           [Ralstonia solanacearum CFBP2957]
 gi|299079695|emb|CBJ52372.1| phosphopantetheine adenylyltransferase
           (CMP-deoxy-D-manno-octulosonate-lipid A transferase)
           [Ralstonia solanacearum PSI07]
          Length = 168

 Score =  162 bits (411), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 92/167 (55%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP T GH D++ +A +  ++LV+ +  +  K   F  ++ER  + ++ + 
Sbjct: 1   MVIAVYPGTFDPFTRGHEDLVRRASNIFDELVVGVAQSPNKRPFFA-LEERIHIAREVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+       V V  F GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPN-----VRVEGFSGLLKDFVRKNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L   +  ++++ T +R +  +  D++ FV   V  +L   V    
Sbjct: 115 MFLTPSDQYQFISGTFVREIAQLGGDVSKFVFPSVERWLVEKVGRRH 161


>gi|330447133|ref|ZP_08310783.1| pantetheine-phosphate adenylyltransferase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328491324|dbj|GAA05280.1| pantetheine-phosphate adenylyltransferase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 160

 Score =  162 bits (411), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 49/166 (29%), Positives = 91/166 (54%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDPITNGH+D+I +A +  + +++ +  N  K   F   +      K + 
Sbjct: 1   MTTRVIYPGTFDPITNGHLDLIERAAAMFDHVIVGVAFNPSKKPLFDLNERVELAGKITQ 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     V ++ F GL V+ AK+ +A ++VRGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 61  HLD------NVEIVGFSGLLVDFAKEHNANILVRGLRAVSDFEYEFQLANMNRRLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+ L   E + +++ST+++ +     D++ FV   +   L   +  
Sbjct: 115 TVFLTPAEENSFISSTIVKEVALHKGDVSQFVDPLITTALLEKLAK 160


>gi|293607599|ref|ZP_06689933.1| pantetheine-phosphate adenylyltransferase [Achromobacter piechaudii
           ATCC 43553]
 gi|292814032|gb|EFF73179.1| pantetheine-phosphate adenylyltransferase [Achromobacter piechaudii
           ATCC 43553]
          Length = 167

 Score =  162 bits (411), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 53/162 (32%), Positives = 93/162 (57%), Gaps = 6/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A +  + +V+ I  +  K   F SI ER E+ ++ + 
Sbjct: 1   MIIAVYPGTFDPLTRGHEDLVRRAATLFDKVVVGIAHSRNKKPFF-SIDERVEIAREVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V SF GL  +  +D   +VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPNVE-----VQSFGGLLKDFVRDQGGRVIVRGLRAVSDFEYEFQMAGMNRHLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           + +   +  ++++ T++R +  +  D++ FV   V  +L+  
Sbjct: 115 LFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVERWLQEK 156


>gi|212637672|ref|YP_002314197.1| phosphopantetheine adenylyltransferase [Shewanella piezotolerans
           WP3]
 gi|226706703|sp|B8CVD4|COAD_SHEPW RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|212559156|gb|ACJ31610.1| Phosphopantetheine adenylyltransferase [Shewanella piezotolerans
           WP3]
          Length = 160

 Score =  162 bits (411), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 58/163 (35%), Positives = 93/163 (57%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDP+TNGH D+I +A    + +VI I  N  K   F ++ ER EL+K   
Sbjct: 1   MHTRAIYPGTFDPVTNGHADLIERAAKLFKHVVIGIALNPSKKPRF-TLDERIELLKTVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHLDNVE-----VVGFSGLLVDFAKEQQASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           ++ L   E + +++STL++ +     D++ FV   V   L   
Sbjct: 115 SVFLTPAEENSFISSTLVKEVAHHGGDVSQFVHIKVANALMKK 157


>gi|83593078|ref|YP_426830.1| phosphopantetheine adenylyltransferase [Rhodospirillum rubrum ATCC
           11170]
 gi|123526584|sp|Q2RTK2|COAD_RHORT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|83575992|gb|ABC22543.1| Coenzyme A biosynthesis protein [Rhodospirillum rubrum ATCC 11170]
          Length = 172

 Score =  162 bits (411), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 57/169 (33%), Positives = 96/169 (56%), Gaps = 5/169 (2%)

Query: 1   MM---RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIK 57
           MM   R AVY G+FDP+TNGH+DII +A   V+ L + +  N+ K   F S++ER E+++
Sbjct: 1   MMPTERIAVYPGTFDPVTNGHLDIISRAARLVDRLTVGVAVNAGKGPLF-SLEERVEMVR 59

Query: 58  QSIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCP 117
            ++      +   ++V+ F  L ++ A    A +I RGLR ++DF+YE +M  +N  L  
Sbjct: 60  VAVDKLPT-NGATITVVPFANLLMDFACAQGASMIFRGLRAISDFEYEFQMCGMNSRLNS 118

Query: 118 EIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           ++ T+ L A E S++++S  ++ +  +  DI  FVP  V   L +    
Sbjct: 119 KVETVFLMASERSQFISSRFVKEIGRLGGDIGGFVPAHVRDRLLDRFEE 167


>gi|158312986|ref|YP_001505494.1| phosphopantetheine adenylyltransferase [Frankia sp. EAN1pec]
 gi|229500847|sp|A8L588|COAD_FRASN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|158108391|gb|ABW10588.1| pantetheine-phosphate adenylyltransferase [Frankia sp. EAN1pec]
          Length = 162

 Score =  162 bits (411), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 57/162 (35%), Positives = 95/162 (58%), Gaps = 3/162 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GSFDPITNGH+DII++A    +++V+A+  N  K   F +I+ER +LI+ ++ 
Sbjct: 1   MRRAVCPGSFDPITNGHLDIIVRASKLFDEVVVAVLINKSKAHLF-TIEERIDLIRDAVR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   V V S  GL V+  +    Q IV+GLR ++DFDYE++M  +N  L   + T
Sbjct: 60  SHPD-APTNVVVDSSHGLLVDFCRVRGIQSIVKGLRAVSDFDYELQMAQMNHSLA-GVET 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           + +       +++S+L++ +     D++  VPD V   L++ 
Sbjct: 118 LFMSTNPQYAFLSSSLVKEVARYGGDVSGLVPDVVLKGLRDR 159


>gi|167750939|ref|ZP_02423066.1| hypothetical protein EUBSIR_01924 [Eubacterium siraeum DSM 15702]
 gi|167656118|gb|EDS00248.1| hypothetical protein EUBSIR_01924 [Eubacterium siraeum DSM 15702]
 gi|291531109|emb|CBK96694.1| Phosphopantetheine adenylyltransferase [Eubacterium siraeum 70/3]
 gi|291557424|emb|CBL34541.1| Phosphopantetheine adenylyltransferase [Eubacterium siraeum
           V10Sc8a]
          Length = 162

 Score =  162 bits (411), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 97/165 (58%), Gaps = 4/165 (2%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+T GH++II +A    + +++ +  N +K   F +I ER + +++S+ 
Sbjct: 1   MKTAIYPGSFDPVTYGHLEIISRASKLFDKVIVLVSVNPLKPCSF-TIDERKQFLRESV- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             + +    V V S EGL ++   + +A VIV+GLR ++DF+YE +M   NR LC +  T
Sbjct: 59  --VAEGIGNVEVDSNEGLLIDYFNEHNADVIVKGLRAISDFEYEFQMAQANRKLCYKAET 116

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           I L +K    Y++S++++ +     DI+ FVP+ +   +   +  
Sbjct: 117 IFLTSKSEYTYLSSSMVKQIAMFGGDISDFVPECILDRINERLKR 161


>gi|167585417|ref|ZP_02377805.1| phosphopantetheine adenylyltransferase [Burkholderia ubonensis Bu]
          Length = 166

 Score =  162 bits (411), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 96/166 (57%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F S++ER E+  + + 
Sbjct: 1   MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFF-SLEERLEIANEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V+ F GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPNVK-----VMGFTGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + +   +  ++++ T++R +  +  D++ FV   V  +L   V ++
Sbjct: 115 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAM 160


>gi|220931857|ref|YP_002508765.1| pantetheine-phosphate adenylyltransferase [Halothermothrix orenii H
           168]
 gi|219993167|gb|ACL69770.1| pantetheine-phosphate adenylyltransferase [Halothermothrix orenii H
           168]
          Length = 162

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 48/166 (28%), Positives = 85/166 (51%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+ + VY GSFDP+T GH+DII +A    +++++A+  N  K   F   +    L + + 
Sbjct: 1   MLNRVVYPGSFDPVTYGHLDIIKRAAQIFDEVIVAVFRNPRKNPLFSMDERVKLLKEVTK 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                    RV V  F GL V  A+   A+ ++RGLR ++DF+ E +M S+N+ L  +I 
Sbjct: 61  EID------RVQVDCFNGLLVEYARSKKARAVIRGLRAVSDFEGEFQMASMNKQLDSDIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+         +++S++++ +   + ++   VPD V   L      
Sbjct: 115 TVFFMTDTKYAFLSSSVVKEVAQFNGNVKGMVPDVVAKALVEKYNY 160


>gi|170076944|ref|YP_001733582.1| pantetheine-phosphate adenylyltransferase [Synechococcus sp. PCC
           7002]
 gi|229541048|sp|B1XNE8|COAD_SYNP2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|169884613|gb|ACA98326.1| pantetheine-phosphate adenylyltransferase [Synechococcus sp. PCC
           7002]
          Length = 178

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 51/157 (32%), Positives = 85/157 (54%), Gaps = 6/157 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y GSFDPIT GH+DII +     E +++A+ CN  K+  F S+++R   I++   H 
Sbjct: 2   IAIYPGSFDPITLGHLDIIERGDRLFEKVIVAVLCNPSKSPIF-SLEKRVAQIRRCTQHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V SF GL  + A+  +A V++RGLR ++DF+ E++M   N+ L   I T+ 
Sbjct: 61  PNVE-----VASFTGLTTDYARQRNAGVLLRGLRVLSDFEKELQMAHTNKTLWDNIETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           L       +++S++++ +      +   VPD V   L
Sbjct: 116 LATSNEYSFLSSSVVKEIAKFGGSVDHLVPDNVAEDL 152


>gi|312194936|ref|YP_004014997.1| pantetheine-phosphate adenylyltransferase [Frankia sp. EuI1c]
 gi|311226272|gb|ADP79127.1| pantetheine-phosphate adenylyltransferase [Frankia sp. EuI1c]
          Length = 160

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 57/163 (34%), Positives = 99/163 (60%), Gaps = 3/163 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GSFDPITNGH+DII++A +  +++V+A+  N  K+  F +++ER +LI+Q++ 
Sbjct: 1   MRRAVCPGSFDPITNGHLDIIMRASTQFDEVVVAVLINKGKSTLF-TVEERMDLIRQAV- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
              P ++  + V S  GL V+  +    Q IV+GLR ++DFDYE++M  +N  L   + T
Sbjct: 59  RDHPQAAGNIVVESSHGLLVDFCRAHGIQSIVKGLRAVSDFDYELQMAQMNHRLA-GVET 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + +       +++S+L++ +     D+   VPD V   L+  +
Sbjct: 118 LFMSTNPQYAFLSSSLVKEVARYGGDVAGLVPDVVLKHLRERL 160


>gi|146277435|ref|YP_001167594.1| phosphopantetheine adenylyltransferase [Rhodobacter sphaeroides
           ATCC 17025]
 gi|189082583|sp|A4WSC5|COAD_RHOS5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|145555676|gb|ABP70289.1| pantetheine-phosphate adenylyltransferase [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 162

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 57/164 (34%), Positives = 91/164 (55%), Gaps = 2/164 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T GH+DII +A++ V+ LVI +  N  K   F S++ER  +++    
Sbjct: 1   MRIGLYPGTFDPLTLGHLDIIQRAMALVDRLVIGVAINRDKGPLF-SLEERVRMVESECR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   + V  FE L ++ A+D+ A VI+RGLR + DF+YE +M  +NR L   I T
Sbjct: 60  AIAA-NGGEIVVHPFENLLIDCARDVGASVILRGLRAVADFEYEFQMVGMNRALDAGIET 118

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L A    + + S L++ +  +  D++SFV   V   L     
Sbjct: 119 VFLMADARRQAIASKLVKEIARLGGDVSSFVTPDVGAALMAKYR 162


>gi|119475396|ref|ZP_01615749.1| pantetheine-phosphate adenylyltransferase [marine gamma
           proteobacterium HTCC2143]
 gi|119451599|gb|EAW32832.1| pantetheine-phosphate adenylyltransferase [marine gamma
           proteobacterium HTCC2143]
          Length = 159

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 92/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M   +Y G+F+PITNGH+D++ +A      +V+AI  +  K   F S+ ER +L +Q++ 
Sbjct: 1   MNTVIYPGTFNPITNGHIDLVERASKLFGKVVLAIAYSERKQPMF-SLDERIDLCQQALS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V  F  L V  A+  ++  ++RG+R M DF+YE++M  +NR + P   T
Sbjct: 60  HLDNIE-----VCGFNNLLVEFAQSKNSNTVLRGVRSMKDFEYEIQMADMNRAMTPGFET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   +   Y++STL+R + ++  D++SFVP  V   L   + S
Sbjct: 115 VFLTPSDGLSYISSTLVREISTMGGDVSSFVPAIVLDALNERIKS 159


>gi|289207278|ref|YP_003459344.1| pantetheine-phosphate adenylyltransferase [Thioalkalivibrio sp.
           K90mix]
 gi|288942909|gb|ADC70608.1| pantetheine-phosphate adenylyltransferase [Thioalkalivibrio sp.
           K90mix]
          Length = 163

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 52/159 (32%), Positives = 85/159 (53%), Gaps = 6/159 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y G+FDPIT+GH DI+ +A    + +VIA+  N  K   F  ++ R  L ++++   
Sbjct: 5   TAIYPGTFDPITHGHTDIVRRAARLFDRVVIAVAANPNKGPAF-PLETRVALAEEAV--- 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                  V V  F  L         A VI+RGLR ++DF++E ++ ++NR L PE+ T+ 
Sbjct: 61  --RGIEGVEVQGFNVLLAKFVHAQGANVILRGLRAVSDFEHEFQLAAMNRQLAPEVETLF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           L   E   +V+S+L+R +  +  D++ FV   V   L  
Sbjct: 119 LTPAEEYSFVSSSLVREIARLGGDVSKFVSPGVARMLAE 157


>gi|222056366|ref|YP_002538728.1| pantetheine-phosphate adenylyltransferase [Geobacter sp. FRC-32]
 gi|254764155|sp|B9M4U3|COAD_GEOSF RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|221565655|gb|ACM21627.1| pantetheine-phosphate adenylyltransferase [Geobacter sp. FRC-32]
          Length = 161

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 52/164 (31%), Positives = 89/164 (54%), Gaps = 6/164 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + AVY GSFDPIT GH+DII + L   + +++A+  NS K   F + +      + ++  
Sbjct: 4   KIAVYPGSFDPITYGHLDIIERGLRIFDKIIVAVAKNSEKNSLFPTDE------RIALIK 57

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
            +   S R  V +F GL V+  +D  A VI+RGLR ++DF+YE ++  +NR +  +I T+
Sbjct: 58  EVLGDSERAEVDTFTGLLVDYVRDQGATVIIRGLRAVSDFEYEFQLAQMNRSITQDIETL 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            +       Y++S++++ + S++  I   VP  V   L      
Sbjct: 118 FMMTSVPYSYLSSSIVKEVSSLNGPIEGLVPPAVKKALDAKFNR 161


>gi|113866397|ref|YP_724886.1| phosphopantetheine adenylyltransferase [Ralstonia eutropha H16]
 gi|123134468|sp|Q0KEQ3|COAD_RALEH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|113525173|emb|CAJ91518.1| phosphopantetheine adenylyltransferase [Ralstonia eutropha H16]
          Length = 161

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A +  ++LV+ +  +  K   F S++ER  + ++ + 
Sbjct: 1   MVIAVYPGTFDPMTRGHEDLVRRASNIFDELVVGVAHSPNKRPFF-SLEERIGIAREVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+       V V  F GL  +  ++ +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPN-----VRVEGFSGLLKDFVRNNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   +  ++++ T +R +  +  D++ FV   V  +L+  +  
Sbjct: 115 MFLTPSDQYQFISGTFVREIAVLGGDVSKFVFPSVERWLQEKIGK 159


>gi|332171773|gb|AEE21027.1| pantetheine-phosphate adenylyltransferase [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 160

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 61/166 (36%), Positives = 91/166 (54%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KAVY G+FDPITNGH D+I +A +    +++ I  N  K   F S+QER ELIK+  
Sbjct: 1   MHTKAVYPGTFDPITNGHADLIERAANMFAHVIVGIAANPSKKPLF-SLQERVELIKKVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          VI FEGL  + A    A V++RGLR ++DF+YE ++ ++NR L P + 
Sbjct: 60  AHLPNVE-----VIGFEGLLADFADSQGATVLIRGLRAVSDFEYEFQLANMNRRLNPNLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           +I L   E + +++STL++ +      +  F    V   LK  +  
Sbjct: 115 SIFLTPAEENSFISSTLVKEVALHRGKVDQFCHPAVQAALKEKLQQ 160


>gi|159044293|ref|YP_001533087.1| phosphopantetheine adenylyltransferase [Dinoroseobacter shibae DFL
           12]
 gi|189082567|sp|A8LME1|COAD_DINSH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|157912053|gb|ABV93486.1| phosphopantetheine adenylyltransferase [Dinoroseobacter shibae DFL
           12]
          Length = 171

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 55/163 (33%), Positives = 91/163 (55%), Gaps = 1/163 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T GH+DII +A + V+ LVI +  N  K   F S++ER  +++    
Sbjct: 1   MRIGLYPGTFDPVTLGHLDIIRRASTLVDRLVIGVAINRDKGPLF-SLEERVAMLEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               ++   +    FE L ++ A+D+ A +I+RGLR + DF+YE +M  +NR L   I T
Sbjct: 60  AVSAETGTEIVAHPFENLLIDCARDVGASMIIRGLRAVADFEYEFQMVGMNRRLDDSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L A+   + + S L++ +  +  D+T FV   V   L +  
Sbjct: 120 VFLMAEAEHQAIASKLVKEIARLGGDVTPFVTSQVRAALVDRF 162


>gi|167630222|ref|YP_001680721.1| pantetheine-phosphate adenylyltransferase [Heliobacterium
           modesticaldum Ice1]
 gi|229500831|sp|B0TGU9|COAD_HELMI RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|167592962|gb|ABZ84710.1| pantetheine-phosphate adenylyltransferase [Heliobacterium
           modesticaldum Ice1]
          Length = 168

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 54/168 (32%), Positives = 92/168 (54%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDPIT GHMDI+ +A     ++++A+  N  K   F   + R E+I+ ++ 
Sbjct: 1   MTVAVYPGSFDPITKGHMDIVERAAQIFHEVIVAVVINPNKKPLFTMDE-RVEMIRMAVS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H        V V SF GL V+  +   A+ IVRGLR ++DF+ E +M  +N+ L PE+ T
Sbjct: 60  HISN-----VRVESFSGLLVDFTRKQGARAIVRGLRAVSDFEVEFQMALMNKRLYPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + +       +++S++++ + S   D++ ++P  V   +       V+
Sbjct: 115 VFMATHTDYAFLSSSMVKEVASFGGDVSDYLPPAVLARMAEKYGDTVR 162


>gi|116873488|ref|YP_850269.1| phosphopantetheine adenylyltransferase [Listeria welshimeri serovar
           6b str. SLCC5334]
 gi|123461327|sp|A0AKF8|COAD_LISW6 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|116742366|emb|CAK21490.1| phosphopantetheine adenylyltransferase [Listeria welshimeri serovar
           6b str. SLCC5334]
          Length = 161

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 60/164 (36%), Positives = 92/164 (56%), Gaps = 6/164 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + AV  G+FDPITNGH+DII +A    + L +A+  NS K   F +++ER E+IKQ   H
Sbjct: 4   KIAVIPGTFDPITNGHLDIIERAAKIFDVLYVAVLNNSSKKPLF-TVEERMEMIKQVTAH 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V+V S  GL V+ A    A  IVRGLR ++DF+YEM++ S+NR L  EI T 
Sbjct: 63  LPN-----VAVESASGLTVDYAAKRGATAIVRGLRAVSDFEYEMQIASMNRTLNAEIETF 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            +       +++S++++ +     DI+  VP+ V   ++     
Sbjct: 118 FVMTNTKYSFLSSSMVKEVAQYQGDISELVPEMVNRAIQVKFNK 161


>gi|157692176|ref|YP_001486638.1| phosphopantetheine adenylyltransferase [Bacillus pumilus SAFR-032]
 gi|167009041|sp|A8FCW1|COAD_BACP2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|157680934|gb|ABV62078.1| pantetheine-phosphate adenylyltransferase [Bacillus pumilus
           SAFR-032]
          Length = 160

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 57/165 (34%), Positives = 89/165 (53%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDP+T GH+DII +     +++ + +  NS K   F +++ER ELI+Q+ 
Sbjct: 1   MGNIAVCPGSFDPVTLGHLDIIKRGAKIFDEVYVCVLNNSSKKPLF-TVEERCELIRQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V SF GL V+ AK   A+VI+RGLR +TDF+YEM+ TS+N+ L  +I 
Sbjct: 60  KDLPNIK-----VESFHGLLVDYAKQKEAKVILRGLRAVTDFEYEMQGTSMNKVLNDDIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T  +       +++S++++ +   D  +   VP  V   L     
Sbjct: 115 TFFMMTNNQYSFLSSSIVKEVAKYDGSVKGLVPKEVEEALIEKFK 159


>gi|167835371|ref|ZP_02462254.1| phosphopantetheine adenylyltransferase [Burkholderia thailandensis
           MSMB43]
          Length = 166

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 53/168 (31%), Positives = 97/168 (57%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F S++ER E+  + + 
Sbjct: 1   MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFF-SLEERLEIANEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V+ F GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPNVK-----VMGFTGLLKDFVRANNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + +   +  ++++ T++R +  +  D++ FV   V  +L   V ++ +
Sbjct: 115 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAMAQ 162


>gi|88811314|ref|ZP_01126569.1| phosphopantetheine adenylyltransferase [Nitrococcus mobilis Nb-231]
 gi|88791203|gb|EAR22315.1| phosphopantetheine adenylyltransferase [Nitrococcus mobilis Nb-231]
          Length = 163

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 58/168 (34%), Positives = 90/168 (53%), Gaps = 8/168 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSV--KTKGFLSIQERSELIKQ 58
           M   AVY G+FDPITNGH D+I +A S    +++AI       K   F S++ER  + K+
Sbjct: 1   MGIVAVYPGTFDPITNGHSDLIERAASLFNRVIVAISGAPGAAKQPAF-SLEERVAMAKE 59

Query: 59  SIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPE 118
           ++            V +FE L  N   +  A VI+RGLR ++DF+YE ++  +NR L P 
Sbjct: 60  ALACHANVE-----VTAFESLLANYVIERKANVILRGLRAVSDFEYEFQLAGMNRQLAPR 114

Query: 119 IATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + T+ L   E   Y++STL+R +  +  D++ FV   V   L+  +  
Sbjct: 115 VETLFLTPAEQYAYLSSTLVREVAMLGGDVSRFVHPVVKEALRRRLKR 162


>gi|221639381|ref|YP_002525643.1| phosphopantetheine adenylyltransferase [Rhodobacter sphaeroides
           KD131]
 gi|221160162|gb|ACM01142.1| Pantetheine-phosphate adenylyltransferase [Rhodobacter sphaeroides
           KD131]
          Length = 166

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 58/165 (35%), Positives = 92/165 (55%), Gaps = 2/165 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           +MR  +Y G+FDP+T GH+DII +A++ V+ LVI +  N  K   F S++ER  +++   
Sbjct: 4   IMRIGLYPGTFDPLTLGHLDIIQRAMALVDRLVIGVAINRDKGPLF-SLEERVRMVETEC 62

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +   + V  FE L ++ A+D+ A VIVRGLR + DF+YE +M  +NR L   I 
Sbjct: 63  RAIAA-NGGEIVVHPFENLLIDCARDVGASVIVRGLRAVADFEYEFQMVGMNRALDAGIE 121

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T+ L A    + + S L++ +  +  D++SFV   V   L     
Sbjct: 122 TVFLMADARRQAIASKLVKEIARLGGDVSSFVTPDVGAALVAKYR 166


>gi|323484800|ref|ZP_08090157.1| hypothetical protein HMPREF9474_01908 [Clostridium symbiosum
           WAL-14163]
 gi|323691873|ref|ZP_08106127.1| pantetheine-phosphate adenylyltransferase [Clostridium symbiosum
           WAL-14673]
 gi|323401906|gb|EGA94247.1| hypothetical protein HMPREF9474_01908 [Clostridium symbiosum
           WAL-14163]
 gi|323504080|gb|EGB19888.1| pantetheine-phosphate adenylyltransferase [Clostridium symbiosum
           WAL-14673]
          Length = 166

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 93/165 (56%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+T GH DII ++    + L++ +  NS K+  F S++ER  ++K    
Sbjct: 1   MKTAIYPGSFDPVTLGHYDIIERSSKIFDKLIVGVLNNSAKSPLF-SVEERVNMLKDVTS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           HF         V SF GL ++  +   A VIVRGLR +TDF+YE+++  +NR + PEI T
Sbjct: 60  HFPNVE-----VQSFAGLLIDFVRSNDANVIVRGLRAITDFEYELQLAQMNRVIAPEIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L       Y++S++ + +     DI+SF+   +   ++    +
Sbjct: 115 LFLTTNLKYAYLSSSMAKEVAMYGGDISSFLSPEIAEKVREKYAA 159


>gi|94309230|ref|YP_582440.1| phosphopantetheine adenylyltransferase [Cupriavidus metallidurans
           CH34]
 gi|166216578|sp|Q1LRQ5|COAD_RALME RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|93353082|gb|ABF07171.1| pantetheine-phosphate adenylyltransferase [Cupriavidus
           metallidurans CH34]
          Length = 161

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 95/165 (57%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A +  ++LV+ +  +  K   F S++ER  + ++ + 
Sbjct: 1   MVVAVYPGTFDPMTRGHEDLVRRASNIFDELVVGVAHSPNKRPFF-SLEERIGIAREVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+       V V  F GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPN-----VRVEGFSGLLKDFVRKNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   +  ++++ T +R +  +  D++ FV   V  +L+  +  
Sbjct: 115 MFLTPSDQYQFISGTFVREIAVLGGDVSKFVFPSVERWLQEKIGK 159


>gi|312797359|ref|YP_004030281.1| phosphopantetheine adenylyltransferase [Burkholderia rhizoxinica
           HKI 454]
 gi|312169134|emb|CBW76137.1| Phosphopantetheine adenylyltransferase (EC 2.7.7.3) [Burkholderia
           rhizoxinica HKI 454]
          Length = 189

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 55/163 (33%), Positives = 98/163 (60%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F S+QER ++ ++ + 
Sbjct: 23  MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRNKKPFF-SLQERLDIAQEVLG 81

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V+SF GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 82  HYPNVK-----VMSFAGLLKDFVRANNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 136

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + +   +  ++++ T++R +  +  D++ FV   V  +LK+ V
Sbjct: 137 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVERWLKDKV 179


>gi|158337191|ref|YP_001518366.1| phosphopantetheine adenylyltransferase [Acaryochloris marina
           MBIC11017]
 gi|189082553|sp|B0CAI3|COAD_ACAM1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|158307432|gb|ABW29049.1| pantetheine-phosphate adenylyltransferase [Acaryochloris marina
           MBIC11017]
          Length = 176

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 48/163 (29%), Positives = 82/163 (50%), Gaps = 6/163 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            AVY GSFDPIT GH+DII +  +    +++A+  N  K   F S+Q+R + I+    H 
Sbjct: 2   IAVYPGSFDPITLGHLDIIERGCNLFGSVIVAVARNPNKAPLF-SVQQRIQQIQTCTQHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                +    ++         +   AQV++RGLR ++DF+YE++M   N  L P I T+ 
Sbjct: 61  ANLELDTFDTLTV-----TYTQKRQAQVLLRGLRALSDFEYELQMAHTNHSLSPHIETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           L       +++S+L++ +      +   VP+ V + L+     
Sbjct: 116 LATSNEYSFLSSSLVKEIAKFGGSVAHLVPENVAIELEECFTK 158


>gi|86609642|ref|YP_478404.1| phosphopantetheine adenylyltransferase [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|123501485|sp|Q2JJM6|COAD_SYNJB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|86558184|gb|ABD03141.1| pantetheine-phosphate adenylyltransferase [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 159

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 58/161 (36%), Positives = 86/161 (53%), Gaps = 6/161 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y GSFDPIT GH+D+I +A      +++A+  N  KT  F S ++R   I  S  H 
Sbjct: 2   IALYPGSFDPITLGHLDVIERASRLFSKVIVAVLKNPNKTPLF-SPEQRQAQISLSTAHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V +F GL V  A+   A+VIVRGLR ++DFD E++M   N+ L PE+ T+ 
Sbjct: 61  KNVE-----VDTFSGLTVAYARQRGAKVIVRGLRVLSDFDVELQMAHTNKLLAPELETLF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           L       +V+S+L++ +  +   I   VP PV   L+   
Sbjct: 116 LATASEHSFVSSSLVKEVAKLGGPIDHLVPAPVIRDLRERF 156


>gi|62182218|ref|YP_218635.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|224585525|ref|YP_002639324.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|75479874|sp|Q57IA8|COAD_SALCH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254764166|sp|C0Q1W7|COAD_SALPC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|62129851|gb|AAX67554.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|224470053|gb|ACN47883.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|322716706|gb|EFZ08277.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 159

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F ++ ER  L +++ 
Sbjct: 1   MQKRAIYPGTFDPITNGHLDIVTRATQMFDHVILAIAASPGKKPMF-TLDERVALAQKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A+D  A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHLGNVE-----VVGFSDLMANFARDRQANILIRGLRAVADFEYEMQLAHMNRHLIPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+PD V   L + + 
Sbjct: 115 SVFLIPSKEWSFISSSLVKEVARHQGDVTHFLPDNVHQALMDKLK 159


>gi|156936198|ref|YP_001440114.1| phosphopantetheine adenylyltransferase [Cronobacter sakazakii ATCC
           BAA-894]
 gi|166216545|sp|A7MQ98|COAD_ENTS8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|156534452|gb|ABU79278.1| hypothetical protein ESA_04097 [Cronobacter sakazakii ATCC BAA-894]
          Length = 159

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 91/165 (55%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH+DII +A S  ++L++A+  +  K   F S+ ER  L +Q+ 
Sbjct: 1   MTTRAIYPGTFDPITNGHLDIITRAASMFDELILAVAASPHKKTMF-SLDERVALAQQAA 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H    S     V  F  L  N A+     V+VRGLR   DF+YEM++  +NR L P + 
Sbjct: 60  AHLQNVS-----VTGFSDLMANFAQAQQGNVLVRGLRTAGDFEYEMQLAHMNRHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D++ F+P  V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVSHFLPAHVHQALLEKLR 159


>gi|206576018|ref|YP_002236004.1| pantetheine-phosphate adenylyltransferase [Klebsiella pneumoniae
           342]
 gi|288933011|ref|YP_003437070.1| pantetheine-phosphate adenylyltransferase [Klebsiella variicola
           At-22]
 gi|290511804|ref|ZP_06551172.1| pantetheine-phosphate adenylyltransferase [Klebsiella sp. 1_1_55]
 gi|226709009|sp|B5XTG9|COAD_KLEP3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|206565076|gb|ACI06852.1| pantetheine-phosphate adenylyltransferase [Klebsiella pneumoniae
           342]
 gi|288887740|gb|ADC56058.1| pantetheine-phosphate adenylyltransferase [Klebsiella variicola
           At-22]
 gi|289775594|gb|EFD83594.1| pantetheine-phosphate adenylyltransferase [Klebsiella sp. 1_1_55]
          Length = 159

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 93/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPITNGH+DI+ +A S  + +V+AI  +  K   F ++ ER  L  Q+ 
Sbjct: 1   MSTKAIYPGTFDPITNGHIDIVTRAASMFDKVVLAIAASPSKKPMF-TLDERIALATQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +        VI F  L  + A+   A +++RGLR + DF+YEM++  +NR L P + 
Sbjct: 60  AHLVNVE-----VIGFSDLMASFARAQQANILIRGLRAVADFEYEMQLAHMNRHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D++ F+P  V   L N + 
Sbjct: 115 SVFLMPCKEWSFISSSLVKEVARHQGDVSHFLPANVHQALLNKLK 159


>gi|311108736|ref|YP_003981589.1| pantetheine-phosphate adenylyltransferase [Achromobacter
           xylosoxidans A8]
 gi|310763425|gb|ADP18874.1| pantetheine-phosphate adenylyltransferase [Achromobacter
           xylosoxidans A8]
          Length = 167

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 53/162 (32%), Positives = 93/162 (57%), Gaps = 6/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A +  + +V+ I  +  K   F SI ER E+ ++ + 
Sbjct: 1   MITAVYPGTFDPLTRGHEDLVRRAATLFDKVVVGIAISRNKKPFF-SIDERVEIAREVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V SF GL  +  +D   +VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPNVE-----VQSFGGLLKDFVRDQGGRVIVRGLRAVSDFEYEFQMAGMNRHLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           + +   +  ++++ T++R +  +  D++ FV   V  +L+  
Sbjct: 115 LFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVERWLQEK 156


>gi|262273492|ref|ZP_06051306.1| phosphopantetheine adenylyltransferase [Grimontia hollisae CIP
           101886]
 gi|262222470|gb|EEY73781.1| phosphopantetheine adenylyltransferase [Grimontia hollisae CIP
           101886]
          Length = 164

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 60/170 (35%), Positives = 95/170 (55%), Gaps = 10/170 (5%)

Query: 1   MMRKAV----YTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELI 56
           M +KA+    Y G+FDPITNGH+D++ +A S  +D+V+ I  +  K   F  + ER EL 
Sbjct: 1   MSKKAITRVIYPGTFDPITNGHVDLVERAASMFDDVVVGIAASPSKKPLFE-LDERVELA 59

Query: 57  KQSIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLC 116
           K    H    S     V+ F GL V+ AK   A ++VRGLR ++DF+YE ++ ++NR L 
Sbjct: 60  KAVTDHLDNVS-----VVGFSGLLVDFAKQYQANILVRGLRAVSDFEYEFQLANMNRRLM 114

Query: 117 PEIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           PE+ ++ L   E + +++STL++ +     D   FV   V   L + +  
Sbjct: 115 PELESVFLTPSEENSFISSTLVKEVALHGGDTRGFVHPKVLEALNSRLKK 164


>gi|40063708|gb|AAR38489.1| pantetheine-phosphate adenylyltransferase [uncultured marine
           bacterium 583]
          Length = 160

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 63/160 (39%), Positives = 99/160 (61%), Gaps = 6/160 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+Y GSFDPITNGH+D+I +A    ++++IAI  N+ KT    SI +R E ++ SI
Sbjct: 1   MKTIAIYPGSFDPITNGHIDLIHRACKLFDEVLIAITQNANKTSLL-SIDQRIEAVEASI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V+ F  L V+ A+D +AQ+I+RGLR ++DF+YE +++ +N+ L P I 
Sbjct: 60  TSISN-----TRVLGFNSLLVDFARDHNAQIIIRGLRAVSDFEYEFQLSGMNKRLNPGIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           T+ +   E    ++S+L+R ++S+  DI+SFVP  V   L
Sbjct: 115 TLFMTPSEEFANISSSLVREILSLGGDISSFVPASVETIL 154


>gi|315304115|ref|ZP_07874509.1| pantetheine-phosphate adenylyltransferase [Listeria ivanovii FSL
           F6-596]
 gi|313627515|gb|EFR96254.1| pantetheine-phosphate adenylyltransferase [Listeria ivanovii FSL
           F6-596]
          Length = 161

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 57/164 (34%), Positives = 89/164 (54%), Gaps = 6/164 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + AV  G+FDPITNGH+DII +A    + L +A+  NS K   F +++ER ++IKQ   H
Sbjct: 4   KIAVIPGTFDPITNGHLDIIERAAKIFDVLYVAVLNNSSKKPLF-NVEERMKMIKQVTAH 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     V S  GL V+ A    A  IVRGLR ++DF+YEM++ S+NR L   I T 
Sbjct: 63  LPNI-----QVESASGLTVDYAAKRGATAIVRGLRAVSDFEYEMQIASMNRTLNATIETF 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            +       +++S++++ +     DI+  VP+ V   ++     
Sbjct: 118 FVMTNTKYSFLSSSMVKEVAQYQGDISELVPEVVNKAIQAKFNK 161


>gi|157373070|ref|YP_001481059.1| phosphopantetheine adenylyltransferase [Serratia proteamaculans
           568]
 gi|167009047|sp|A8GLE1|COAD_SERP5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|157324834|gb|ABV43931.1| pantetheine-phosphate adenylyltransferase [Serratia proteamaculans
           568]
          Length = 161

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 52/166 (31%), Positives = 92/166 (55%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M RKA+Y G+FDP+TNGH+D++ +A    + +++AI  +  K   F ++ ER  L  Q  
Sbjct: 1   MTRKAIYPGTFDPMTNGHLDLVTRASLMFDHVILAIAASPSKKPLF-TLDERVALASQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  + A   +A ++VRGLR ++DF+YE+++ ++NR L P + 
Sbjct: 60  SHLDNVE-----VLGFSELMAHFAAHQNANILVRGLRAVSDFEYELQLANMNRHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           ++ L   E   +++S+L++ +     DI  F+P  V   L   + +
Sbjct: 115 SVFLMPSEEWSFISSSLVKEVARHGGDIAPFLPAVVTQALFEKLAA 160


>gi|262376639|ref|ZP_06069867.1| pantetheine-phosphate adenylyltransferase [Acinetobacter lwoffii
           SH145]
 gi|262308349|gb|EEY89484.1| pantetheine-phosphate adenylyltransferase [Acinetobacter lwoffii
           SH145]
          Length = 163

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 91/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
             + +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER  L K+S+ 
Sbjct: 3   KTRVIYPGTFDPITNGHIDLVTRAARMFDEVVVAIAIGHHKNPVF-SLEERVALAKESLS 61

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H           + F+GL VN  ++  A  ++RGLR ++DF+YE ++ ++NR L      
Sbjct: 62  HLDNVE-----FVGFDGLLVNFFREQKATAVLRGLRAVSDFEYEFQLANMNRQLDSHFEA 116

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R +  +  D+T FVP  V    +  +  
Sbjct: 117 VFLTPSEQYSFISSTLVREIARLRGDVTKFVPPNVVAAFERKLQQ 161


>gi|313632465|gb|EFR99484.1| pantetheine-phosphate adenylyltransferase [Listeria seeligeri FSL
           N1-067]
 gi|313636999|gb|EFS02575.1| pantetheine-phosphate adenylyltransferase [Listeria seeligeri FSL
           S4-171]
          Length = 161

 Score =  162 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 60/164 (36%), Positives = 90/164 (54%), Gaps = 6/164 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + AV  G+FDPITNGH+DII +A    + L +++  NS K   F +++ER E+IKQ   H
Sbjct: 4   KIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSKKPLF-NVEERMEMIKQVTAH 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V V S  GL V+ A    A  IVRGLR ++DF+YEM++ S+NR L   I T 
Sbjct: 63  LPN-----VQVESASGLTVDYAAMRGATAIVRGLRAVSDFEYEMQIASMNRTLNATIETF 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            +       +++S++++ +     DI+  VPD V   +K     
Sbjct: 118 FVMTNTKYSFLSSSMVKEVAQYQGDISELVPDIVNQAIKAKFNK 161


>gi|119503520|ref|ZP_01625603.1| CheW protein [marine gamma proteobacterium HTCC2080]
 gi|119460582|gb|EAW41674.1| CheW protein [marine gamma proteobacterium HTCC2080]
          Length = 161

 Score =  162 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 58/167 (34%), Positives = 97/167 (58%), Gaps = 8/167 (4%)

Query: 2   MRK--AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           MR    VY G+FDPIT GH+D++ +A    + +V+AI  +  K   F  ++ER+ L +++
Sbjct: 1   MRTQSIVYPGTFDPITKGHIDLVERAARLFDRVVVAIAQSEKKEPLF-DLEERTTLTREA 59

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           + H      N + V SF GL  +L  +  +  ++RGLR + DF+YE ++ ++NR L P+ 
Sbjct: 60  LSH-----VNNLEVCSFTGLLTDLVTEQGSNCVLRGLRAVADFEYEYQLANMNRALKPDF 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            ++ L   E+  Y++S+L+R + S+  DIT FV   V   LKN   +
Sbjct: 115 ESVFLTPSENLAYISSSLVREIASMGGDITPFVATNVAEALKNKFSA 161


>gi|292486570|ref|YP_003529438.1| phosphopantetheine adenylyltransferase [Erwinia amylovora CFBP1430]
 gi|292897808|ref|YP_003537177.1| phosphopantetheine adenylyltransferase [Erwinia amylovora ATCC
           49946]
 gi|291197656|emb|CBJ44751.1| phosphopantetheine adenylyltransferase [Erwinia amylovora ATCC
           49946]
 gi|291551985|emb|CBA19022.1| Phosphopantetheine adenylyltransferase [Erwinia amylovora CFBP1430]
 gi|312170631|emb|CBX78894.1| Phosphopantetheine adenylyltransferase [Erwinia amylovora ATCC
           BAA-2158]
          Length = 158

 Score =  162 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 58/164 (35%), Positives = 92/164 (56%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+DI+ +A    + +V+AI  +  K   F +++ER  L  + +
Sbjct: 1   MSTKAIYPGTFDPMTNGHLDIVTRAALMFDRIVLAIAASPSKKPMF-TLEERVALAGEVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N AK   A V+VRGLR ++DF+YEM++  +NR L P + 
Sbjct: 60  AHLPNVE-----VVGFSDLLANFAKAQQANVLVRGLRAVSDFEYEMQLAQMNRHLLPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           ++ L   E   +V+S+L++ +     D+ SF+P  V   LK   
Sbjct: 115 SVFLMPSEQYSFVSSSLMKEVARHGGDVESFLPTAVYQALKARF 158


>gi|316934204|ref|YP_004109186.1| pantetheine-phosphate adenylyltransferase [Rhodopseudomonas
           palustris DX-1]
 gi|315601918|gb|ADU44453.1| pantetheine-phosphate adenylyltransferase [Rhodopseudomonas
           palustris DX-1]
          Length = 169

 Score =  162 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 56/166 (33%), Positives = 99/166 (59%), Gaps = 1/166 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+R A+Y GSFDP+TNGH+D++  A++  + LV+AIG +  K   F S +ER  ++++  
Sbjct: 1   MVRIALYPGSFDPVTNGHLDVVRHAVALCDKLVVAIGIHPGKKPLF-STEERLAMVERVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +       +++ L V  A+ + A +++RGLRD +D DYEM++  +N  + P I 
Sbjct: 60  GPVAKAAGCDFGCTTYDNLTVTAAEKVGATIMIRGLRDGSDLDYEMQIAGMNETMAPAIH 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+ L A    R +T+TL+R + ++  D+++FVP  V   L++   +
Sbjct: 120 TVFLPASVGVRPITATLVRQIAAMGGDVSAFVPAEVASALQSKFAA 165


>gi|71909335|ref|YP_286922.1| phosphopantetheine adenylyltransferase [Dechloromonas aromatica
           RCB]
 gi|71848956|gb|AAZ48452.1| Phosphopantetheine adenylyltransferase [Dechloromonas aromatica
           RCB]
          Length = 164

 Score =  162 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 50/159 (31%), Positives = 87/159 (54%), Gaps = 6/159 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y G+FDPIT GH D++ +A +  + L++AI  +  K   F          +  +  
Sbjct: 7   RVAIYPGTFDPITRGHEDLVRRASTLFDKLILAIAESPSKKPRFPLAD------RVEMAQ 60

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
            I    N V ++ F  L +N   +  A+V+VRGLR ++DF+YE +M  +NR + PE+ T+
Sbjct: 61  EILGDLNNVEIVGFNTLLMNFVHEKGAKVVVRGLRAVSDFEYEFQMAGMNRSVYPEVETV 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            L   E   ++++T++R +  +  D++ FV   V   L+
Sbjct: 121 FLTPGEQYMFISATMVREIARLGGDVSKFVQPCVEKRLR 159


>gi|110798570|ref|YP_696415.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           ATCC 13124]
 gi|123344667|sp|Q0TPM5|COAD_CLOP1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|110673217|gb|ABG82204.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           ATCC 13124]
          Length = 164

 Score =  162 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 60/167 (35%), Positives = 97/167 (58%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY GSFDPIT GH+D+I +A S  + +++A+  N  K   F SI+ER  LI++ + 
Sbjct: 1   MRVGVYPGSFDPITKGHLDLIERAASKFDKVIVAVLININKKGMF-SIEERVNLIEKCVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +         V SF GL ++  +   A VI++GLR +TDF+YE +M  +NR L  E+ T
Sbjct: 60  KYNNVE-----VKSFNGLLIDFVRKEKADVIIKGLRSVTDFEYEFQMALMNRELANEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + +    +  Y++S+ I+ + S + +I +FVP  +   L+  + SL 
Sbjct: 115 VFMVTSPNYSYISSSAIKQVASFNGEIKNFVPKEIVEDLEERISSLR 161


>gi|52696203|pdb|1VLH|A Chain A, Crystal Structure Of Phosphopantetheine
           Adenylyltransferase (Tm0741) From Thermotoga Maritima At
           2.20 A Resolution
 gi|52696204|pdb|1VLH|B Chain B, Crystal Structure Of Phosphopantetheine
           Adenylyltransferase (Tm0741) From Thermotoga Maritima At
           2.20 A Resolution
 gi|52696205|pdb|1VLH|C Chain C, Crystal Structure Of Phosphopantetheine
           Adenylyltransferase (Tm0741) From Thermotoga Maritima At
           2.20 A Resolution
 gi|52696206|pdb|1VLH|D Chain D, Crystal Structure Of Phosphopantetheine
           Adenylyltransferase (Tm0741) From Thermotoga Maritima At
           2.20 A Resolution
 gi|52696207|pdb|1VLH|E Chain E, Crystal Structure Of Phosphopantetheine
           Adenylyltransferase (Tm0741) From Thermotoga Maritima At
           2.20 A Resolution
 gi|52696208|pdb|1VLH|F Chain F, Crystal Structure Of Phosphopantetheine
           Adenylyltransferase (Tm0741) From Thermotoga Maritima At
           2.20 A Resolution
          Length = 173

 Score =  162 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 59/168 (35%), Positives = 97/168 (57%), Gaps = 7/168 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDPIT GH+DII +ALS  ++LV+ +  N  K   F +++ER +LI++ + 
Sbjct: 13  MK-AVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKKCMF-TLEERKKLIEEVLS 70

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                  + V V    GL V+  K    +V+VRGLR +TD++YE++M   N+ L  ++ T
Sbjct: 71  -----DLDGVKVDVHHGLLVDYLKKHGIKVLVRGLRAVTDYEYELQMALANKKLYSDLET 125

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + L A E   +++S+L++ +     D+T +VP  V   L   +    +
Sbjct: 126 VFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLKEGKR 173


>gi|227328066|ref|ZP_03832090.1| phosphopantetheine adenylyltransferase [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 159

 Score =  162 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+D++ +A    + +V+AI  +  K   F ++ ER  L K + 
Sbjct: 1   MTTKAIYPGTFDPLTNGHLDLLTRASRLFDHVVLAIAASPSKHTLF-TLDERVALAKGAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L V+ A+  +A ++VRGLR + DF+YE+++  +N  L P + 
Sbjct: 60  QHLSNVE-----VVGFSDLMVHFAQQQNANILVRGLRAVADFEYELQLAKMNHHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E   +++S+L++ +   D D++ F+PD +   L + + 
Sbjct: 115 SVFLMPSEEWSFISSSLVKEVARHDGDVSHFLPDAIVSALLDKLR 159


>gi|300088241|ref|YP_003758763.1| pantetheine-phosphate adenylyltransferase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527974|gb|ADJ26442.1| pantetheine-phosphate adenylyltransferase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 161

 Score =  162 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 46/162 (28%), Positives = 81/162 (50%), Gaps = 6/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDPIT GH+DI+ ++    + +++ +     K   F + +      + ++ 
Sbjct: 1   MRIALYPGSFDPITAGHIDIVRRSARLFDRVIVGVYDTPGKKLMFTTDE------RVALA 54

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    VSV  F GL V  A+      +VRGLR   DF+ E  M  +NR L P+I  
Sbjct: 55  ARAIADLPNVSVEPFSGLMVEFARRHGVTTVVRGLRVNNDFELEFDMAMINRRLAPDIEL 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           + L A    ++++S++++ +  +  D+   VP+ V   ++  
Sbjct: 115 VCLLASPEYQFLSSSILKEVARLGGDVDGLVPEFVAEAVRQK 156


>gi|295696054|ref|YP_003589292.1| pantetheine-phosphate adenylyltransferase [Bacillus tusciae DSM
           2912]
 gi|295411656|gb|ADG06148.1| pantetheine-phosphate adenylyltransferase [Bacillus tusciae DSM
           2912]
          Length = 159

 Score =  162 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 54/164 (32%), Positives = 94/164 (57%), Gaps = 6/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDPIT GH+DII +     + +V+A+  N  K+  F  ++ER +LI++S+ 
Sbjct: 1   MITAIYPGSFDPITMGHLDIIERGAQIFDAVVVAVLENPHKSALFA-VEERKQLIERSVE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F     + V V +F GL V+  K   A+V++RGLR ++DF++E++  ++NR L P   T
Sbjct: 60  GF-----DNVRVETFMGLLVDYLKQRGARVVIRGLRAVSDFEFELQNATMNRKLWPWAET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
             +    +  Y++S++++ +     D++  VP  V   L+    
Sbjct: 115 FFMPTSTNYSYLSSSIVKEIAKYGGDVSGLVPPHVEEALRAKYR 158


>gi|189218440|ref|YP_001939081.1| Phosphopantetheine adenylyltransferase [Methylacidiphilum
           infernorum V4]
 gi|226706700|sp|B3DYW1|COAD_METI4 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|189185298|gb|ACD82483.1| Phosphopantetheine adenylyltransferase [Methylacidiphilum
           infernorum V4]
          Length = 173

 Score =  162 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 53/167 (31%), Positives = 103/167 (61%), Gaps = 4/167 (2%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++ +Y G+FDPIT GH+D+I +A    +++V+ +   + K   F  ++ER EL+++++ 
Sbjct: 1   MKRVLYPGTFDPITLGHVDVISKAARLFDEVVVGVAAQTPKETLFE-LEERMELVERTLK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           HF   ++  +    + GL V+ AK+++   I+RGLR ++DF+ E ++  +NR L PEI T
Sbjct: 60  HFSFSNAIAL---PYTGLTVDFAKELNCCAIIRGLRAVSDFETEFQLALMNRRLKPEIET 116

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L  +++  Y++S+L++ +  +  +I++FVP  V   LK  +    
Sbjct: 117 LFLMPEDNHIYLSSSLVKEISRLGGEISAFVPTVVMEALKQKIGKRN 163


>gi|74316398|ref|YP_314138.1| phosphopantetheine adenylyltransferase [Thiobacillus denitrificans
           ATCC 25259]
 gi|123612338|sp|Q3SLS2|COAD_THIDA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|74055893|gb|AAZ96333.1| panththeine-phosphate adenylyltransferase [Thiobacillus
           denitrificans ATCC 25259]
          Length = 160

 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 48/165 (29%), Positives = 85/165 (51%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDPIT GH D++ +A+   + +V+A+  +  K   F   +      + ++ 
Sbjct: 1   MLTAVYPGTFDPITRGHEDLVRRAVRLFDRVVVAVAESRNKRPFFSMDE------RVAMT 54

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +     +V V  F GL ++   +  A  ++RGLR  +DF+YE ++  +NR L P+I T
Sbjct: 55  REVLADVPQVRVEGFSGLLIDFVAEQGAIAVLRGLRAASDFEYEFQLAGMNRNLKPDIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   ++++++IR +     D+T FV   V   L   +  
Sbjct: 115 LFLTPSEQYMFISASMIREIAQFGGDVTPFVHPLVARRLSEKIRE 159


>gi|242237622|ref|YP_002985803.1| phosphopantetheine adenylyltransferase [Dickeya dadantii Ech703]
 gi|242129679|gb|ACS83981.1| pantetheine-phosphate adenylyltransferase [Dickeya dadantii Ech703]
          Length = 159

 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 93/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDP+TNGH+D++ +A    + L++AI  +  K   F ++ ER  L +Q+ 
Sbjct: 1   MKTRAIYPGTFDPLTNGHLDLLTRAARMFDHLILAIAASPSKNTLF-TLDERVALARQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          VI F  L  + AK   A ++VRGLR ++DF+YE+++  +N  L P + 
Sbjct: 60  GHLKNVE-----VIGFSDLMASFAKQQHATILVRGLRAISDFEYELQLAKMNTHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E   +++STL++ +     D++ F+P P+   L   ++
Sbjct: 115 SVFLMPSEKWSFISSTLVKEVARHGGDVSHFLPAPITAALSQKLL 159


>gi|212639676|ref|YP_002316196.1| phosphopantetheine adenylyltransferase [Anoxybacillus flavithermus
           WK1]
 gi|226706683|sp|B7GGK2|COAD_ANOFW RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|212561156|gb|ACJ34211.1| Phosphopantetheine adenylyltransferase [Anoxybacillus flavithermus
           WK1]
          Length = 165

 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 91/165 (55%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDP+T GH+DII +     + + + +  NS K   F S +ER +L+++  
Sbjct: 1   MASIAVCPGSFDPVTYGHLDIIRRGAKVFDKVYVVVLNNSSKKPLF-SAEERVQLLEEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   + V V S++GL V+ AK   A  I+RGLR ++DF+YEM++TS+NR L  +I 
Sbjct: 60  K-----DLHNVVVDSYQGLLVDYAKSKHASAILRGLRAVSDFEYEMQITSMNRILNEQIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T  +       +++S++++ +   + +I+  VP  V   L+    
Sbjct: 115 TFFMMTNNQYSFLSSSIVKEVAKYNGNISELVPKVVEEALRKKFA 159


>gi|77463518|ref|YP_353022.1| phosphopantetheine adenylyltransferase [Rhodobacter sphaeroides
           2.4.1]
 gi|126462374|ref|YP_001043488.1| phosphopantetheine adenylyltransferase [Rhodobacter sphaeroides
           ATCC 17029]
 gi|123591852|sp|Q3J263|COAD_RHOS4 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|189082582|sp|A3PK50|COAD_RHOS1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|77387936|gb|ABA79121.1| pantetheine-phosphate adenylyltransferase [Rhodobacter sphaeroides
           2.4.1]
 gi|126104038|gb|ABN76716.1| pantetheine-phosphate adenylyltransferase [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 162

 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 58/164 (35%), Positives = 91/164 (55%), Gaps = 2/164 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T GH+DII +A++ V+ LVI +  N  K   F S++ER  +++    
Sbjct: 1   MRIGLYPGTFDPLTLGHLDIIQRAMALVDRLVIGVAINRDKGPLF-SLEERVRMVETECR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   + V  FE L ++ A+D+ A VIVRGLR + DF+YE +M  +NR L   I T
Sbjct: 60  AIAA-NGGEIVVHPFENLLIDCARDVGASVIVRGLRAVADFEYEFQMVGMNRALDAGIET 118

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L A    + + S L++ +  +  D++SFV   V   L     
Sbjct: 119 VFLMADARRQAIASKLVKEIARLGGDVSSFVTPDVGAALVAKYR 162


>gi|293609052|ref|ZP_06691355.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292829625|gb|EFF87987.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 163

 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 56/162 (34%), Positives = 91/162 (56%), Gaps = 6/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
             + +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER EL + S+ 
Sbjct: 3   KTRVIYPGTFDPITNGHVDLVTRASRMFDEVVVAIAIGHHKNPLF-SLEERVELAQTSLS 61

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H           + F+GL VN  K+  A  ++RGLR ++DF+YE ++ ++NR L P    
Sbjct: 62  HLSNVE-----FVGFDGLLVNFFKEQKATAVLRGLRAVSDFEYEFQLANMNRQLDPHFEA 116

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           + L   E   +++STLIR +  +  D+T FVP  V    +  
Sbjct: 117 VFLTPSEQYSFISSTLIREIARLKGDVTKFVPQAVVEAFERK 158


>gi|297568527|ref|YP_003689871.1| pantetheine-phosphate adenylyltransferase [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296924442|gb|ADH85252.1| pantetheine-phosphate adenylyltransferase [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 175

 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 59/162 (36%), Positives = 88/162 (54%), Gaps = 5/162 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPIT GH+DII +AL+  + +++AI  N  K   F S+ ER ++I+ S   
Sbjct: 15  RIAVYPGTFDPITMGHIDIIKRALTLFDRVIVAIAVNPAKQPLF-SLAERKQMIRDSFTD 73

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     V    GL V+ A    A+ IVRGLR ++DFDYE ++  +NR +  E+ T+
Sbjct: 74  VNDRIE----VDEVSGLLVDYAYRRGARAIVRGLRAVSDFDYEFQLALMNRRIEREVETV 129

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
            L       Y++S++I+       D+   VPD VC  L+   
Sbjct: 130 FLMTGFRWIYISSSIIKDAARHGGDVGGLVPDHVCDRLRERF 171


>gi|254455353|ref|ZP_05068782.1| pantetheine-phosphate adenylyltransferase [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207082355|gb|EDZ59781.1| pantetheine-phosphate adenylyltransferase [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 164

 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 51/165 (30%), Positives = 94/165 (56%), Gaps = 1/165 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y G+FDPIT GH+D+I ++L   + +V+A+   S K   F S + R +++ +++
Sbjct: 1   MNKVAIYPGTFDPITYGHIDVIKKSLKLFDKIVVAVSDVSNKNYLFNSNE-RIDIVNKAL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
           F  +  +  ++ V+SF  L  +L K   + VI+RGLR ++DF+YE ++  +NR L   I 
Sbjct: 60  FKDLKLNRKKILVVSFSSLTTDLCKKYKSNVILRGLRAVSDFEYEFQLAGMNRKLNNNIE 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           TI L +   ++ ++S  ++ ++ ++ DI  F        LK    
Sbjct: 120 TIFLMSDVENQIISSKFVKEIVKLNGDIKKFTTKSTIKSLKEKYE 164


>gi|284802497|ref|YP_003414362.1| hypothetical protein LM5578_2253 [Listeria monocytogenes 08-5578]
 gi|284995639|ref|YP_003417407.1| hypothetical protein LM5923_2204 [Listeria monocytogenes 08-5923]
 gi|284058059|gb|ADB69000.1| hypothetical protein LM5578_2253 [Listeria monocytogenes 08-5578]
 gi|284061106|gb|ADB72045.1| hypothetical protein LM5923_2204 [Listeria monocytogenes 08-5923]
          Length = 160

 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 58/163 (35%), Positives = 91/163 (55%), Gaps = 6/163 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + AV  G+FDPITNGH+DII +A    + L +++  NS K   F +I+ER E+I+Q   H
Sbjct: 4   KIAVIPGTFDPITNGHLDIIERAAKIFDLLYVSVLNNSSKKPLF-TIEERMEMIRQVTAH 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V V S  GL V+ A    A  IVRGLR ++DF+YEM++ S+NR L  +I T 
Sbjct: 63  LPN-----VQVESASGLTVDYAATRGATAIVRGLRAVSDFEYEMQIASMNRTLNADIETF 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
            +       +++S++++ +     DI+  VP+ V   ++    
Sbjct: 118 FVMTNTKYSFLSSSMVKEVAQYQGDISELVPEIVNEQVQAKFK 160


>gi|317405496|gb|EFV85805.1| phosphopantetheine adenylyltransferase [Achromobacter xylosoxidans
           C54]
          Length = 167

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 52/162 (32%), Positives = 93/162 (57%), Gaps = 6/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A +  + +V+ I  +  K   F SI ER ++ ++ + 
Sbjct: 1   MIIAVYPGTFDPLTRGHEDLVRRAATLFDKVVVGIAHSRNKKPFF-SIDERVDIAREVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V SF GL  +  +D   +VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPNVE-----VQSFGGLLKDFVRDQGGRVIVRGLRAVSDFEYEFQMAGMNRHLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           + +   +  ++++ T++R +  +  D++ FV   V  +L+  
Sbjct: 115 LFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVERWLQEK 156


>gi|312882924|ref|ZP_07742656.1| phosphopantetheine adenylyltransferase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309369443|gb|EFP96963.1| phosphopantetheine adenylyltransferase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 164

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 53/167 (31%), Positives = 93/167 (55%), Gaps = 10/167 (5%)

Query: 1   MMR----KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELI 56
           M +    + +Y G+FDPITNGH+D+I +A    ++++IA+  +  K   F S+ +R +  
Sbjct: 1   MSKKRLSRVIYPGTFDPITNGHLDLIERAADMFDEVIIAVAASPSKNTMF-SLDQRVQFA 59

Query: 57  KQSIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLC 116
           ++   H    SS       F GL V+ A    A V++RGLR   DF+YE  +T++ R L 
Sbjct: 60  QEVTQHLTSVSSK-----GFSGLMVDFASQEQANVLIRGLRTTVDFEYEFGLTNMYRRLM 114

Query: 117 PEIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           P + ++ L   E   +++ST+++ +     D+++FVPD V   L++ 
Sbjct: 115 PGLESVFLTPAEEHAFISSTIVKEVAIHGGDVSNFVPDVVAKALQSK 161


>gi|153002827|ref|YP_001368508.1| phosphopantetheine adenylyltransferase [Shewanella baltica OS185]
 gi|217975414|ref|YP_002360165.1| phosphopantetheine adenylyltransferase [Shewanella baltica OS223]
 gi|166216599|sp|A6WUF6|COAD_SHEB8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254764168|sp|B8EDR6|COAD_SHEB2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|151367445|gb|ABS10445.1| pantetheine-phosphate adenylyltransferase [Shewanella baltica
           OS185]
 gi|217500549|gb|ACK48742.1| pantetheine-phosphate adenylyltransferase [Shewanella baltica
           OS223]
          Length = 163

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 56/157 (35%), Positives = 92/157 (58%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH D+I +A    + ++I I  N  K   F +++ER EL+ +  
Sbjct: 1   MHTRAIYPGTFDPITNGHADLIERAAKLFKHVIIGIAANPSKQPRF-TLEERVELVNRVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHLDNVE-----VVGFSGLLVDFAKEQKASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E + +++STL++ +     D+  FV   V 
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVNQFVHSEVA 151


>gi|187922587|ref|YP_001894229.1| phosphopantetheine adenylyltransferase [Burkholderia phytofirmans
           PsJN]
 gi|229488127|sp|B2SXG0|COAD_BURPP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|187713781|gb|ACD15005.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           phytofirmans PsJN]
          Length = 171

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 53/167 (31%), Positives = 99/167 (59%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F +++ER ++  + + 
Sbjct: 1   MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRNKKPFF-TLEERLDIAHEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+       V V+SF+GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPN-----VQVMSFKGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + +   +  ++++ T++R +  +  D++ FV   V  +L   V ++ 
Sbjct: 115 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAMD 161


>gi|224498500|ref|ZP_03666849.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes
           Finland 1988]
 gi|254827060|ref|ZP_05231747.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           FSL N3-165]
 gi|255026466|ref|ZP_05298452.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes FSL
           J2-003]
 gi|258599442|gb|EEW12767.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           FSL N3-165]
          Length = 160

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 58/163 (35%), Positives = 91/163 (55%), Gaps = 6/163 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + AV  G+FDPITNGH+DII +A    + L +++  NS K   F +I+ER E+I+Q   H
Sbjct: 4   KIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSKKPLF-TIEERMEMIRQVTAH 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V V S  GL V+ A    A  IVRGLR ++DF+YEM++ S+NR L  +I T 
Sbjct: 63  LPN-----VQVESASGLTVDYAATRGATAIVRGLRAVSDFEYEMQIASMNRTLNADIETF 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
            +       +++S++++ +     DI+  VP+ V   ++    
Sbjct: 118 FVMTNTKYSFLSSSMVKEVAQYQGDISELVPEIVNEQVQAKFK 160


>gi|47093604|ref|ZP_00231362.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           str. 4b H7858]
 gi|254854012|ref|ZP_05243360.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           FSL R2-503]
 gi|254933480|ref|ZP_05266839.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           HPB2262]
 gi|300765487|ref|ZP_07075468.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           FSL N1-017]
 gi|47018028|gb|EAL08803.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           str. 4b H7858]
 gi|258607401|gb|EEW20009.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           FSL R2-503]
 gi|293585044|gb|EFF97076.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           HPB2262]
 gi|300513798|gb|EFK40864.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           FSL N1-017]
 gi|328466032|gb|EGF37208.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes
           1816]
          Length = 160

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 59/163 (36%), Positives = 91/163 (55%), Gaps = 6/163 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + AV  G+FDPITNGH+DII +A    + L +++  NS K   F +I+ER E+I+Q   H
Sbjct: 4   KIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSKKPLF-TIEERMEMIRQVTAH 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V V S  GL V+ A    A  IVRGLR ++DF+YEM++ S+NR L  EI T 
Sbjct: 63  LPN-----VQVESASGLTVDYAATRGATAIVRGLRAVSDFEYEMQIASMNRTLNAEIETF 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
            +       +++S++++ +     DI+  VP+ V   ++    
Sbjct: 118 FVMTNTKYSFLSSSMVKEVAQYQGDISELVPEIVNEQVQAKFK 160


>gi|256032928|pdb|3IKZ|A Chain A, Crystal Structure Of Phosphopantetheine
           Adenylyltransferase From Burkholderia Pseudomallei
 gi|262368174|pdb|3K9W|A Chain A, Crystal Structure Of Phosphopantetheine
           Adenylyltransferase From Burkholderia Pseudomallei With
           Hydrolyzed 3'-Dephospho Coenzyme A
 gi|315364797|pdb|3PXU|A Chain A, Crystal Structure Of Phosphopantetheine
           Adenylyltransferase From Burkholderia Pseudomallei Bound
           To Dephospho-Coenzyme A
          Length = 170

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 52/168 (30%), Positives = 96/168 (57%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F S++ER ++  + + 
Sbjct: 5   MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFF-SLEERLKIANEVLG 63

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V+ F GL  +  +   A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 64  HYPNVK-----VMGFTGLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 118

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + +   +  ++++ T++R +  +  D++ FV   V  +L   V ++ +
Sbjct: 119 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAMAQ 166


>gi|160872274|ref|ZP_02062406.1| pantetheine-phosphate adenylyltransferase [Rickettsiella grylli]
 gi|159121073|gb|EDP46411.1| pantetheine-phosphate adenylyltransferase [Rickettsiella grylli]
          Length = 167

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 57/165 (34%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  K +Y G+FDPITNGH+D++ +A    E +++A+  N  KT  F   +      +  +
Sbjct: 1   MKTKVIYPGTFDPITNGHLDLVQRAARLFETVIVAVAKNPPKTPLFSLKE------RMCL 54

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   N V V  F+GL  + AK+  A++I+RGLR ++DF+YE ++ S+NR + P++ 
Sbjct: 55  AKEALIDLNNVHVEGFDGLLTHYAKEQHARIILRGLRAVSDFEYEFQLASMNRNMLPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T+ L   E   ++++ L+R + S+  DITSFVP  V   L+    
Sbjct: 115 TLFLTPAEQHSFISAHLVREIASLGGDITSFVPRVVAETLQTKFK 159


>gi|27364268|ref|NP_759796.1| phosphopantetheine adenylyltransferase [Vibrio vulnificus CMCP6]
 gi|37678476|ref|NP_933085.1| phosphopantetheine adenylyltransferase [Vibrio vulnificus YJ016]
 gi|320157661|ref|YP_004190040.1| phosphopantetheine adenylyltransferase [Vibrio vulnificus MO6-24/O]
 gi|29427710|sp|Q8DDY6|COAD_VIBVU RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|61212680|sp|Q7MPS0|COAD_VIBVY RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|27360386|gb|AAO09323.1| pantetheine-phosphate adenylyltransferase [Vibrio vulnificus CMCP6]
 gi|37197216|dbj|BAC93056.1| phosphopantetheine adenylyltransferase [Vibrio vulnificus YJ016]
 gi|319932973|gb|ADV87837.1| phosphopantetheine adenylyltransferase [Vibrio vulnificus MO6-24/O]
          Length = 164

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 56/167 (33%), Positives = 93/167 (55%), Gaps = 10/167 (5%)

Query: 1   MMRKA----VYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELI 56
           M +KA    VY G+FDPITNGH+D+I +A    ++++IA+  +  K   F +++ER +  
Sbjct: 1   MSKKALSRVVYPGTFDPITNGHLDLIERAAKMFDEVIIAVAASPSKNTMF-TLEERVDFA 59

Query: 57  KQSIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLC 116
           +Q   H    ++       F GL V+ A+ + A V++RGLR   DF+YE  +T++ R L 
Sbjct: 60  RQVTRHLDNVTAQ-----GFSGLMVDFARAVDANVLIRGLRTTVDFEYEFGLTNMYRRLL 114

Query: 117 PEIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           P + ++ L   E   +++ST++R +     D+T FVP  V   L   
Sbjct: 115 PGLESVFLTPSEEHAFISSTIVREVAIHGGDVTQFVPTVVAEALHQK 161


>gi|308188652|ref|YP_003932783.1| phosphopantetheine adenylyltransferase [Pantoea vagans C9-1]
 gi|308059162|gb|ADO11334.1| Phosphopantetheine adenylyltransferase [Pantoea vagans C9-1]
          Length = 159

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 57/165 (34%), Positives = 93/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+T GH+DI+ +A    + +++AI  +  K   F S+ ER  L  Q +
Sbjct: 1   MTTKAIYPGTFDPVTLGHLDIVTRAAQMFDQVILAIAASPTKKPMF-SLDERVALAGQVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          VI F  L  N A+D  A V+VRGLR ++DF+YEM++  +NR L P + 
Sbjct: 60  AHLPNVE-----VIGFSDLMANFARDQQANVLVRGLRAVSDFEYEMQLAQMNRHLLPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E   +++S+L++ +     D+++F+P PV   L   + 
Sbjct: 115 SVFLMPSEGFSFISSSLVKEVARHSGDVSAFLPAPVHQALLAKLA 159


>gi|72161052|ref|YP_288709.1| phosphopantetheine adenylyltransferase [Thermobifida fusca YX]
 gi|123630044|sp|Q47S81|COAD_THEFY RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|71914784|gb|AAZ54686.1| Phosphopantetheine adenylyltransferase [Thermobifida fusca YX]
          Length = 164

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 54/170 (31%), Positives = 91/170 (53%), Gaps = 7/170 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+ V  GSFDP+TNGH+DII +A    E++++A+  N  K   F + ++   L + +  
Sbjct: 1   MRRVVCPGSFDPVTNGHIDIIRRAAKQNEEVIVAVLVNVNKRGLFTADEKLEMLREATKE 60

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    V+V  F+GL V+  +      IVR LR ++DFDYE+++  +N  L   I T
Sbjct: 61  FD------NVTVAKFDGLLVDFCRAHDVSAIVRSLRSVSDFDYELQIAQMNYQLS-GIDT 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYD 171
           + L A     +++S+L+R +   + D+++ VP  V   L+     L K +
Sbjct: 114 LFLTANPKYSFLSSSLVREIAQYNGDVSALVPPYVEERLRAKYAELAKKN 163


>gi|296113922|ref|YP_003627860.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           RH4]
 gi|295921616|gb|ADG61967.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           RH4]
 gi|326559361|gb|EGE09788.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           7169]
 gi|326562485|gb|EGE12803.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           46P47B1]
 gi|326564263|gb|EGE14493.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           103P14B1]
 gi|326568297|gb|EGE18379.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           BC8]
 gi|326569998|gb|EGE20045.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           BC1]
 gi|326570079|gb|EGE20125.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           BC7]
 gi|326572934|gb|EGE22919.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           CO72]
 gi|326573820|gb|EGE23773.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           O35E]
 gi|326574760|gb|EGE24696.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           101P30B1]
          Length = 164

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 91/162 (56%), Gaps = 6/162 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           RK +Y G+FDPITNGH+D++ +AL   +++VIA+     K   F    ER  L++Q   +
Sbjct: 6   RKVLYPGTFDPITNGHIDLVTRALKLFDEVVIAVAFAHHKKPIF-DFDERVALVEQYFGN 64

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               S     V+ FEGL V  AK+     ++RGLR ++DF+YE  + ++NR L  +   +
Sbjct: 65  NPKVS-----VVGFEGLLVEFAKEQGVSAVLRGLRAVSDFEYEFGLANMNRSLDDDFEAV 119

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
            L   +   +++STL+R +  +  D++ FVP+ V +  +   
Sbjct: 120 FLTPSQEYSFISSTLVREVAKLGGDVSKFVPESVLIAFEQKF 161


>gi|115524772|ref|YP_781683.1| phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           BisA53]
 gi|122296026|sp|Q07MY1|COAD_RHOP5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|115518719|gb|ABJ06703.1| Phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           BisA53]
          Length = 165

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 97/165 (58%), Gaps = 1/165 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++ +A++  + L++AIG +  K   F S +ER  +++   
Sbjct: 1   MPRIALYPGSFDPVTNGHLDVVRRAVTLCDRLIVAIGVHPGKKPLF-STEERLAMVRDVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                ++       +++ L +  A+   A ++VRGLRD TD DYEM++  +N  + P + 
Sbjct: 60  GPIAAEAGCAFDCTTYDNLTITAAQQAGATIMVRGLRDGTDLDYEMQIAGMNETMAPTVQ 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T+ + A  + R +T+TL+R + ++  D+++FVP  V   LK    
Sbjct: 120 TVFVPASVAVRPITATLVRQIAAMGGDVSAFVPPQVAALLKTKFA 164


>gi|317050103|ref|YP_004117751.1| pantetheine-phosphate adenylyltransferase [Pantoea sp. At-9b]
 gi|316951720|gb|ADU71195.1| pantetheine-phosphate adenylyltransferase [Pantoea sp. At-9b]
          Length = 161

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 57/166 (34%), Positives = 93/166 (56%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPIT GH+DI+ +A    + +V+AI  +  K   F S+ ER +L +Q  
Sbjct: 1   MSTKAIYPGTFDPITLGHLDIVTRAARMFDHIVLAIAASPSKKPLF-SLDERVDLARQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          VI F  L  N A+   A V+VRGLR ++DF+YE+++  +NR L P++ 
Sbjct: 60  AHLGNVE-----VIGFSDLMANFAQAQQANVLVRGLRAVSDFEYELQLAHMNRHLLPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           ++ L   E   +V+S+L++ +     D+ +F+P  V   L + +  
Sbjct: 115 SVFLMPSEGFSFVSSSLVKEVARHQGDVQAFLPAVVHQALLSKLAQ 160


>gi|52080105|ref|YP_078896.1| phosphopantetheine adenylyltransferase [Bacillus licheniformis ATCC
           14580]
 gi|52785479|ref|YP_091308.1| phosphopantetheine adenylyltransferase [Bacillus licheniformis ATCC
           14580]
 gi|319646120|ref|ZP_08000350.1| phosphopantetheine adenylyltransferase [Bacillus sp. BT1B_CT2]
 gi|81609181|sp|Q65JZ9|COAD_BACLD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|52003316|gb|AAU23258.1| Coenzyme A biosynthesis protein,Cytidyltransferase-related domain
           [Bacillus licheniformis ATCC 14580]
 gi|52347981|gb|AAU40615.1| YlbI [Bacillus licheniformis ATCC 14580]
 gi|317391870|gb|EFV72667.1| phosphopantetheine adenylyltransferase [Bacillus sp. BT1B_CT2]
          Length = 164

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 52/169 (30%), Positives = 88/169 (52%), Gaps = 6/169 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDP+T GH+DII +     + + + +  NS K   F +++ER  L+++  
Sbjct: 1   MASIAVCPGSFDPVTFGHLDIIRRGAKVFDKVYVCVLNNSSKKPLF-TVEERCGLLREVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     V V SF+GL ++ AK   A VI+RGLR ++DF+YEM+ TS+N+ L   I 
Sbjct: 60  QDIPN-----VQVESFQGLLIDYAKSKQANVILRGLRAVSDFEYEMQGTSMNKVLDENIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           T  +       +++S++++ +      +   VP+ V   L+       +
Sbjct: 115 TFFMMTNNQYSFLSSSIVKEVAKYKGSVAELVPEAVEAALEKKFAKNER 163


>gi|116327009|ref|YP_796729.1| pantetheine-phosphate adenylyltransferase [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
 gi|116332325|ref|YP_802043.1| pantetheine-phosphate adenylyltransferase [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
 gi|122279948|sp|Q04P85|COAD_LEPBJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|122285143|sp|Q056E9|COAD_LEPBL RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|116119753|gb|ABJ77796.1| Pantetheine-phosphate adenylyltransferase [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
 gi|116126014|gb|ABJ77285.1| Pantetheine-phosphate adenylyltransferase [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
          Length = 160

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 57/166 (34%), Positives = 96/166 (57%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+Y GSFDP+TNGH+DI+ ++L   + ++IAI  NS K+  F SI+ER E I    
Sbjct: 1   MKHLAIYPGSFDPLTNGHLDILQRSLGLFDKVIIAIAVNSNKSTLF-SIEERLEFI---- 55

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +      + + +F+GL V+    + A  I+RGLR +TDFDYE  ++ +N+ L P + 
Sbjct: 56  -HKVTQGLKGLEIDTFQGLTVDYCNKVGANSIIRGLRAVTDFDYEYAISLMNKKLAPNVE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+ L +     +++ST+++ +     D+++ VP+ V   L   +  
Sbjct: 115 TVFLMSSGEYSFISSTIVKEVARHGRDVSNQVPEIVGKALLKKLSQ 160


>gi|167745656|ref|ZP_02417783.1| hypothetical protein ANACAC_00348 [Anaerostipes caccae DSM 14662]
 gi|317472741|ref|ZP_07932054.1| pantetheine-phosphate adenylyltransferase [Anaerostipes sp.
           3_2_56FAA]
 gi|167654968|gb|EDR99097.1| hypothetical protein ANACAC_00348 [Anaerostipes caccae DSM 14662]
 gi|316899767|gb|EFV21768.1| pantetheine-phosphate adenylyltransferase [Anaerostipes sp.
           3_2_56FAA]
          Length = 165

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 59/166 (35%), Positives = 90/166 (54%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDP+T GH+DII +++   + LVI I  NS K   F S++ER E + ++  
Sbjct: 1   MSIAVYPGSFDPVTYGHLDIIKRSIRVFDKLVIGILLNSEKNPLF-SMEERVEFLTEATK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V SF GL V+ A++ +A + VRGLR +TDF+YE+++  +N  L   + T
Sbjct: 60  DMENVE-----VKSFSGLLVDFARENNADITVRGLRAVTDFEYELQIAQINNKLDSNLDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           +         Y++ST++R + S   D++  VP  V   LK      
Sbjct: 115 MFFTTSTEYAYLSSTIVREIASYHGDVSELVPPYVEQKLKQKFRER 160


>gi|109896384|ref|YP_659639.1| phosphopantetheine adenylyltransferase [Pseudoalteromonas atlantica
           T6c]
 gi|123171926|sp|Q15ZV3|COAD_PSEA6 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|109698665|gb|ABG38585.1| pantetheine-phosphate adenylyltransferase [Pseudoalteromonas
           atlantica T6c]
          Length = 160

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 60/166 (36%), Positives = 91/166 (54%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KAVY G+FDPITNGH D+I +A +    +++ I  N  K   F S+QER +LIK+  
Sbjct: 1   MHTKAVYPGTFDPITNGHADLIERAANMFAHVIVGIAANPSKKPLF-SLQERVDLIKEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          VI FEGL  + A    A V++RGLR ++DF+YE ++ ++NR L P + 
Sbjct: 60  EHLPNVE-----VIGFEGLLADFADSQGATVLIRGLRAVSDFEYEFQLANMNRRLNPNLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           +I L   E + +++STL++ +      +  F    V   LK  +  
Sbjct: 115 SIFLTPAEENSFISSTLVKEVALHRGKVDQFCHPAVQAALKEKLQQ 160


>gi|46908287|ref|YP_014676.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           str. 4b F2365]
 gi|226224658|ref|YP_002758765.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes
           Clip81459]
 gi|254826193|ref|ZP_05231194.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes FSL
           J1-194]
 gi|255522358|ref|ZP_05389595.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes FSL
           J1-175]
 gi|61212630|sp|Q71XW2|COAD_LISMF RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|259491318|sp|C1KX05|COAD_LISMC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|46881558|gb|AAT04853.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|225877120|emb|CAS05832.1| Putative phosphopantetheine adenylyltransferase [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|293595432|gb|EFG03193.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes FSL
           J1-194]
          Length = 160

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 59/163 (36%), Positives = 91/163 (55%), Gaps = 6/163 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + AV  G+FDPITNGH+DII +A    + L +++  NS K   F +I+ER E+I+Q   H
Sbjct: 4   KIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSKKPLF-TIEERMEMIRQVTAH 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V V S  GL V+ A    A  IVRGLR ++DF+YEM++ S+NR L  EI T 
Sbjct: 63  LPN-----VQVESASGLTVDYAATRGATAIVRGLRAVSDFEYEMQIASMNRTLNAEIETF 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
            +       +++S++++ +     DI+  VP+ V   ++    
Sbjct: 118 FIMTNTKYSFLSSSMVKEVAQYQGDISELVPEIVNEQVQAKFK 160


>gi|78486269|ref|YP_392194.1| coenzyme A biosynthesis protein [Thiomicrospira crunogena XCL-2]
 gi|123555013|sp|Q31EA3|COAD_THICR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|78364555|gb|ABB42520.1| Phosphopantetheine adenylyltransferase [Thiomicrospira crunogena
           XCL-2]
          Length = 159

 Score =  161 bits (407), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 60/163 (36%), Positives = 93/163 (57%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AVY G+FDPIT GH D+I +A  F + LVIA+  N  KT  F S+++R  L K+  
Sbjct: 1   MSITAVYPGTFDPITCGHFDLIERAARFYDRLVIAVADNRNKTALF-SLEKRVALAKEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       VI F GL V+  ++I   V++RGLR ++DF+YE ++ S+NR L PE+ 
Sbjct: 60  ADMPNVE-----VIGFSGLLVDFVREIDGNVLLRGLRAVSDFEYEFQLASMNRKLAPEVE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           T+ +   E   +++S+L+R + ++  D++ FV   V   L   
Sbjct: 115 TMFMTPAEQYAFISSSLVREISALGGDVSEFVHPVVAKALNEK 157


>gi|269925127|ref|YP_003321750.1| pantetheine-phosphate adenylyltransferase [Thermobaculum terrenum
           ATCC BAA-798]
 gi|269788787|gb|ACZ40928.1| pantetheine-phosphate adenylyltransferase [Thermobaculum terrenum
           ATCC BAA-798]
          Length = 162

 Score =  161 bits (407), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 62/166 (37%), Positives = 96/166 (57%), Gaps = 7/166 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AVY GSFDP+TNGH+D+I +A    + LV+A+G N  K   F S+++R +++++  
Sbjct: 1   MEAIAVYAGSFDPVTNGHLDLIERASPLFKKLVVAVGVNPRKPAAF-SLEDRLDMLRRVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V SF+GL V+ AK I A+ I+RGLR + DFDYEM+   +NR LCPEI 
Sbjct: 60  AHIPNVE-----VDSFDGLLVDYAKSIGAKAIIRGLRAVADFDYEMQQVLMNRRLCPEIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+ L       +++S+L++ +  +   +   VP  V  +L   +  
Sbjct: 115 TVFLTTSTQYSFLSSSLVKEVSILGGSVEGLVPKEVEPYL-EKLKR 159


>gi|89076365|ref|ZP_01162698.1| phosphopantetheine adenylyltransferase [Photobacterium sp. SKA34]
 gi|89047936|gb|EAR53527.1| phosphopantetheine adenylyltransferase [Photobacterium sp. SKA34]
          Length = 160

 Score =  161 bits (407), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 49/164 (29%), Positives = 90/164 (54%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDPITNGH+D+I +A +  + +++ +  N  K   F   +      K + 
Sbjct: 1   MTTRVIYPGTFDPITNGHLDLIERAAAMFDHVIVGVAFNPSKKPLFDLNERVELAGKITK 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     V ++ F GL V+ AK+ +A ++VRGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 61  HLD------NVEIVGFSGLLVDFAKEHNANILVRGLRAVSDFEYEFQLANMNRRLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           T+ L   E + +++ST+++ +     D++ FV   +   L    
Sbjct: 115 TVFLTPAEENSFISSTIVKEVALHKGDVSQFVDPLITEALLEKF 158


>gi|254831707|ref|ZP_05236362.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes
           10403S]
          Length = 160

 Score =  161 bits (407), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 58/163 (35%), Positives = 91/163 (55%), Gaps = 6/163 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + AV  G+FDPITNGH+DII +A    + L +++  NS K   F +I+ER E+I+Q   H
Sbjct: 4   KIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSKKPLF-TIEERMEMIRQVTAH 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V V S  GL V+ A    A  IVRGLR ++DF+YEM++ S+NR L  +I T 
Sbjct: 63  LPN-----VQVESASGLTVDYAATRGATAIVRGLRAVSDFEYEMQIASMNRTLNADIETF 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
            +       +++S++++ +     DI+  VP+ V   ++    
Sbjct: 118 FIMTNTKYSFLSSSMVKEVAHYQGDISELVPEIVNKAVQAKFK 160


>gi|126172324|ref|YP_001048473.1| phosphopantetheine adenylyltransferase [Shewanella baltica OS155]
 gi|304411988|ref|ZP_07393598.1| pantetheine-phosphate adenylyltransferase [Shewanella baltica
           OS183]
 gi|307305883|ref|ZP_07585629.1| pantetheine-phosphate adenylyltransferase [Shewanella baltica
           BA175]
 gi|166216598|sp|A3CYP1|COAD_SHEB5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|125995529|gb|ABN59604.1| pantetheine-phosphate adenylyltransferase [Shewanella baltica
           OS155]
 gi|304349538|gb|EFM13946.1| pantetheine-phosphate adenylyltransferase [Shewanella baltica
           OS183]
 gi|306911376|gb|EFN41802.1| pantetheine-phosphate adenylyltransferase [Shewanella baltica
           BA175]
          Length = 163

 Score =  161 bits (407), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 57/157 (36%), Positives = 92/157 (58%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH D+I +A    + +VI I  N  K   F +++ER EL+ +  
Sbjct: 1   MHTRAIYPGTFDPITNGHADLIERAAKLFKHVVIGIAANPSKQPRF-TLEERVELVNRVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHLDNVE-----VVGFSGLLVDFAKEQKASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E + +++STL++ +     D+  FV   V 
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVNQFVHSEVA 151


>gi|289523241|ref|ZP_06440095.1| pantetheine-phosphate adenylyltransferase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289503784|gb|EFD24948.1| pantetheine-phosphate adenylyltransferase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 163

 Score =  161 bits (407), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 59/163 (36%), Positives = 93/163 (57%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KAVY GSFDPITNGH+ +  +A +  ++LV+AI  N  K   F +++ER  + ++++ 
Sbjct: 1   MLKAVYPGSFDPITNGHLYVAERAAALFDELVLAILVNPQKKSTF-TVEERKTMAREALS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + V V SFEGL V+  +    +VI+RGLR ++DF+YE +M  +NR L PEI T
Sbjct: 60  H-----VSNVRVKSFEGLLVDFMRQERCRVIIRGLRALSDFEYEFQMALMNRELAPEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           I +       Y++S+ ++ +      +   VP  V   L+   
Sbjct: 115 IFIVTDAQYSYLSSSAVKEVFQFGGSVQGMVPPGVYRRLRERF 157


>gi|116750414|ref|YP_847101.1| pantetheine-phosphate adenylyltransferase [Syntrophobacter
           fumaroxidans MPOB]
 gi|116750456|ref|YP_847143.1| pantetheine-phosphate adenylyltransferase [Syntrophobacter
           fumaroxidans MPOB]
 gi|116699478|gb|ABK18666.1| pantetheine-phosphate adenylyltransferase [Syntrophobacter
           fumaroxidans MPOB]
 gi|116699520|gb|ABK18708.1| pantetheine-phosphate adenylyltransferase [Syntrophobacter
           fumaroxidans MPOB]
          Length = 168

 Score =  161 bits (407), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 63/169 (37%), Positives = 91/169 (53%), Gaps = 3/169 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + AVY GSFDPITNGH+D+I + L   + +VIA+  N  K   F + +ER E+I  SI
Sbjct: 1   MKKVAVYPGSFDPITNGHLDLIERGLKIFDSIVIAVAANPGKKPLF-TFEERLEMINASI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 S  R+ V SF GL V+    I A  I+RGLR ++DF+YE +M  +NR L  EI 
Sbjct: 60  EGHPMQS--RIQVGSFNGLLVDYVSSIKANTILRGLRAISDFEYEFQMALMNRKLSTEIE 117

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           T+ L       Y++S +I+ ++     +T  V   V   L   +    +
Sbjct: 118 TLYLMTGMRWIYISSRIIKEVVMSGGCVTGLVSPAVEKRLAERLKEPNR 166


>gi|319649690|ref|ZP_08003846.1| phosphopantetheine adenylyltransferase [Bacillus sp. 2_A_57_CT2]
 gi|317398852|gb|EFV79534.1| phosphopantetheine adenylyltransferase [Bacillus sp. 2_A_57_CT2]
          Length = 159

 Score =  161 bits (407), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 57/165 (34%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDPIT GH+DII +A    E + + +  NS K   F +++ER +LI++  
Sbjct: 1   MGGIAVCPGSFDPITYGHLDIIKRAAKVFEQVYVVVLNNSSKKPLF-TVEERIQLIEEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V SF+GL ++ AK ++A  ++RGLR ++DF+YEM++TS+NR L  E+ 
Sbjct: 60  KDLKNVK-----VDSFQGLLMDYAKSVNASAVIRGLRAVSDFEYEMQITSMNRVLNDEVE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T  +       +++S++++ +   + +I+  VPD V   LK    
Sbjct: 115 TFFIMTNNQYSFLSSSIVKEVAKYNGNISELVPDTVEKALKTKFS 159


>gi|73540044|ref|YP_294564.1| phosphopantetheine adenylyltransferase [Ralstonia eutropha JMP134]
 gi|123625951|sp|Q476G3|COAD_RALEJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|72117457|gb|AAZ59720.1| Phosphopantetheine adenylyltransferase [Ralstonia eutropha JMP134]
          Length = 161

 Score =  161 bits (407), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A +  ++LV+ +  +  K   F S++ER  + ++ + 
Sbjct: 1   MAIAVYPGTFDPMTRGHEDLVRRASNIFDELVVGVAHSPNKRPFF-SLEERISIAREVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+       V V  F GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPN-----VRVEGFAGLLKDFVRKNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   +  ++++ T +R +  +  D++ FV   V  +L   +  
Sbjct: 115 MFLTPSDQYQFISGTFVREIAVLGGDVSKFVFPSVERWLAEKISK 159


>gi|194014764|ref|ZP_03053381.1| pantetheine-phosphate adenylyltransferase [Bacillus pumilus ATCC
           7061]
 gi|194013790|gb|EDW23355.1| pantetheine-phosphate adenylyltransferase [Bacillus pumilus ATCC
           7061]
          Length = 160

 Score =  161 bits (407), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 89/165 (53%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDP+T GH+DII +     +++ + +  NS K   F +++ER ELI+++ 
Sbjct: 1   MGNIAVCPGSFDPVTLGHLDIIKRGAKIFDEVYVCVLNNSSKKPLF-TVEERCELIREAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V SF GL V+ AK   A+VI+RGLR +TDF+YEM+ TS+N+ L  +I 
Sbjct: 60  KDLPNIK-----VESFHGLLVDYAKQKEAKVILRGLRAVTDFEYEMQGTSMNKVLNDDIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T  +       +++S++++ +   D  +   VP  V   L     
Sbjct: 115 TFFMMTNNQYSFLSSSIVKEVAKYDGSVKDLVPKEVEEALIEKFK 159


>gi|326796923|ref|YP_004314743.1| phosphopantetheine adenylyltransferase [Marinomonas mediterranea
           MMB-1]
 gi|326547687|gb|ADZ92907.1| Phosphopantetheine adenylyltransferase [Marinomonas mediterranea
           MMB-1]
          Length = 162

 Score =  161 bits (407), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 55/168 (32%), Positives = 91/168 (54%), Gaps = 6/168 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AVY G+FDPITNGH D++ +A      +++A+  +  K     S   R EL +  +
Sbjct: 1   MSTIAVYPGTFDPITNGHADLVERAAKLFSKVIVAVAASPKKRPAL-SHDLRIELAENVL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F+ L     + ++ QV+VRGLR ++DF+YE ++ ++NR + P++ 
Sbjct: 60  GHL-----HNVEVVGFDNLLTEFTRSVNGQVVVRGLRAVSDFEYEFQLANMNRVIAPDVE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           ++ L   E   Y++STL+R + S+D D   FV   V   LK    +  
Sbjct: 115 SLFLTPSEKHSYISSTLVREIASLDGDFGQFVHPEVEKVLKEHYQNAK 162


>gi|218438963|ref|YP_002377292.1| phosphopantetheine adenylyltransferase [Cyanothece sp. PCC 7424]
 gi|226706690|sp|B7KEW8|COAD_CYAP7 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|218171691|gb|ACK70424.1| pantetheine-phosphate adenylyltransferase [Cyanothece sp. PCC 7424]
          Length = 157

 Score =  161 bits (407), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 50/157 (31%), Positives = 84/157 (53%), Gaps = 6/157 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y GSFDPIT GH+DII +     + +++ +  N  K   F S+++R E I++   H 
Sbjct: 2   IAIYPGSFDPITLGHLDIIERGGQLFDLVIVTVLRNPNKQPLF-SVEKRVEQIRECTQHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V SF GL V  AK  +A+V++RGLR ++DF+ E++M   N  L   I T+ 
Sbjct: 61  SNVE-----VDSFTGLTVEYAKLRNAKVLLRGLRVLSDFEKELQMAHTNVTLWDGIETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           L   +   +++S++++ +      I+  VP  V   +
Sbjct: 116 LATAKEYSFLSSSIVKEIAKFGGSISHLVPKNVAQDI 152


>gi|289435393|ref|YP_003465265.1| hypothetical protein lse_2032 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289171637|emb|CBH28183.1| coaD [Listeria seeligeri serovar 1/2b str. SLCC3954]
          Length = 161

 Score =  161 bits (407), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 59/164 (35%), Positives = 90/164 (54%), Gaps = 6/164 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + AV  G+FDPITNGH+DII +A    + L +++  NS K   F +++ER E+IKQ   H
Sbjct: 4   KIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSKKPLF-NVEERMEMIKQVTAH 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V V S  GL V+ A    A  IVRGLR ++DF+YEM++ S+NR L   I T 
Sbjct: 63  LPN-----VQVESASGLTVDYAAMRGATAIVRGLRAVSDFEYEMQIASMNRTLNATIETF 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            +       +++S++++ +     DI+  VPD V   ++     
Sbjct: 118 FVMTNTKYSFLSSSMVKEVAQYQGDISELVPDIVNQAIQAKFNK 161


>gi|255593641|ref|XP_002535918.1| Phosphopantetheine adenylyltransferase, putative [Ricinus communis]
 gi|223521532|gb|EEF26465.1| Phosphopantetheine adenylyltransferase, putative [Ricinus communis]
          Length = 162

 Score =  161 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 50/164 (30%), Positives = 92/164 (56%), Gaps = 7/164 (4%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPIT GH DI+ +A +  +++++A+  ++ K   F S+ ER  L +     
Sbjct: 5   RVAVYPGTFDPITLGHEDIVRRAANLFDEVIVAVAGSTSKQTLF-SLPERVALAESVFH- 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   + V+ F+GL +   +    Q+++RGLR  +DF+YE ++  +NR L P++ T+
Sbjct: 63  -----GGNIRVVGFDGLLMQFVQAQGGQMVIRGLRAASDFEYEFQLAGMNRKLYPKLETL 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            +   E   +++S+L+R +  +  D+  FV   V V +K  + +
Sbjct: 118 FMTPAEEFMFISSSLVREVARLGGDVNQFVSPGVEVAIKQKLAA 161


>gi|78067606|ref|YP_370375.1| phosphopantetheine adenylyltransferase [Burkholderia sp. 383]
 gi|123567612|sp|Q39CT5|COAD_BURS3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|77968351|gb|ABB09731.1| Coenzyme A biosynthesis protein [Burkholderia sp. 383]
          Length = 165

 Score =  161 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 96/166 (57%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F S++ER  +  + + 
Sbjct: 1   MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFF-SLEERLTIANEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V+SF GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPNVK-----VMSFTGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + +   +  ++++ T++R +  +  D++ FV   V  +L   V ++
Sbjct: 115 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAM 160


>gi|39996345|ref|NP_952296.1| phosphopantetheine adenylyltransferase [Geobacter sulfurreducens
           PCA]
 gi|61212654|sp|Q74DS2|COAD_GEOSL RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|39983225|gb|AAR34619.1| pantetheine-phosphate adenylyltransferase [Geobacter sulfurreducens
           PCA]
 gi|298505355|gb|ADI84078.1| pantetheine-phosphate adenylyltransferase [Geobacter sulfurreducens
           KN400]
          Length = 164

 Score =  161 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 51/163 (31%), Positives = 95/163 (58%), Gaps = 6/163 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + AVY GSFDPIT GH+DII +AL   + +++A+  NS K+  F + + R ++I++ +  
Sbjct: 4   KIAVYPGSFDPITYGHLDIIDRALRIFDQVIVAVARNSAKSALFTTDE-RVDMIQRVLA- 61

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                + R  V +F+GL ++      A VI+RGLR ++DF+YE ++  +NR +  ++ T+
Sbjct: 62  ----DNVRARVDTFDGLLIDYVLSQKATVIIRGLRAISDFEYEFQIAQMNRSISQDVETL 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
            +       Y++S++++ + S++  I   VP  V   L++   
Sbjct: 118 FMMTSVPYGYLSSSIVKEVSSLNGPIDGLVPPLVRQALRDKFA 160


>gi|330818357|ref|YP_004362062.1| phosphopantetheine adenylyltransferase [Burkholderia gladioli BSR3]
 gi|327370750|gb|AEA62106.1| phosphopantetheine adenylyltransferase [Burkholderia gladioli BSR3]
          Length = 166

 Score =  161 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 52/166 (31%), Positives = 96/166 (57%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F S++ER ++  + + 
Sbjct: 1   MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFF-SLEERLKIANEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V+ F GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPNVK-----VMGFTGLLKDFVRANNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + +   +  ++++ T++R +  +  D++ FV   V  +L   V ++
Sbjct: 115 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAM 160


>gi|163941669|ref|YP_001646553.1| phosphopantetheine adenylyltransferase [Bacillus weihenstephanensis
           KBAB4]
 gi|229488116|sp|A9VU91|COAD_BACWK RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|163863866|gb|ABY44925.1| pantetheine-phosphate adenylyltransferase [Bacillus
           weihenstephanensis KBAB4]
          Length = 163

 Score =  161 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 56/169 (33%), Positives = 90/169 (53%), Gaps = 6/169 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+ +GSFDPIT GH+DII +     +++ + +  NS K   F S++ER ELI+++ 
Sbjct: 1   MTSIAISSGSFDPITLGHLDIIKRGAKVFDEVYVVVLNNSSKKPFF-SVEERLELIREAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V S  GL V  AK  +A  I+RGLR ++DF+YEM++TS+NR L   I 
Sbjct: 60  KDIPNVK-----VDSHSGLLVEYAKMRNANAILRGLRAVSDFEYEMQITSMNRKLDESIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           T  +       +++S++++ +      +   VP  V   LK    + +K
Sbjct: 115 TFFIMTNNQYSFLSSSIVKEVARYGGSVVDLVPPIVERALKEKFKTPLK 163


>gi|253999625|ref|YP_003051688.1| pantetheine-phosphate adenylyltransferase [Methylovorus sp. SIP3-4]
 gi|253986304|gb|ACT51161.1| pantetheine-phosphate adenylyltransferase [Methylovorus sp. SIP3-4]
          Length = 171

 Score =  161 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 44/162 (27%), Positives = 89/162 (54%), Gaps = 6/162 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
             VY G+FDPIT GH DI+ +A    + +++A+  +  K+  F   +      + S+   
Sbjct: 11  TVVYPGTFDPITRGHEDIVRRAAGLFDRVIVAVAQSPGKSPFFGLDE------RVSMASE 64

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           +      V V+ F GL +   +   A+V++RGLR ++DF+YE ++  +NR + P++ T+ 
Sbjct: 65  VLQDCPNVHVMGFSGLLMEFVQAQGARVVIRGLRAVSDFEYEFQLAGMNRNMFPQVETLF 124

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           L   E   +++++L+R +  ++ D+++FV   V   ++  + 
Sbjct: 125 LTPAEQYMFISASLVREIARLNGDVSNFVSPLVQAHIQRKLD 166


>gi|320450413|ref|YP_004202509.1| pantetheine-phosphate adenylyltransferase [Thermus scotoductus
           SA-01]
 gi|320150582|gb|ADW21960.1| pantetheine-phosphate adenylyltransferase [Thermus scotoductus
           SA-01]
          Length = 161

 Score =  160 bits (406), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 49/161 (30%), Positives = 89/161 (55%), Gaps = 6/161 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKT-KGFLSIQERSELIKQSIFHF 63
            VY GSFDP+TNGH+D+I +A    + + +A+  N  K  +   + +ER  +++++  H 
Sbjct: 3   VVYPGSFDPLTNGHLDVIQRASRLFDRVTVAVLENPNKRGQYLFTAEERLNIVREATAHL 62

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               +      +F GL V+  + + AQ IV+GLR ++D++YE++M  +NR L P + T+ 
Sbjct: 63  PNVEAR-----TFSGLLVDFVRQVGAQAIVKGLRAVSDYEYELQMAHLNRQLLPGLETLF 117

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + A     +V+ST+++ +     D++  VP      LK   
Sbjct: 118 ILAATRYSFVSSTMVKEIARYGGDVSKLVPPATLRALKAKF 158


>gi|188532231|ref|YP_001906028.1| Phosphopantetheine adenylyltransferase [Erwinia tasmaniensis
           Et1/99]
 gi|229500789|sp|B2VF71|COAD_ERWT9 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|188027273|emb|CAO95116.1| Phosphopantetheine adenylyltransferase [Erwinia tasmaniensis
           Et1/99]
          Length = 158

 Score =  160 bits (406), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 56/164 (34%), Positives = 94/164 (57%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+DI+ +A    + +V+A+  +  K   F S++ER  L K+ +
Sbjct: 1   MSTKAIYPGTFDPMTNGHLDIVTRAALMFDRIVLAVAASPSKKPMF-SLEERVALAKEVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N AK   A V+VRGLR ++DF++EM++  +NR L   + 
Sbjct: 60  AHLPNVD-----VVGFSDLLANFAKAQQANVLVRGLRAVSDFEFEMQLAQMNRHLMDTLD 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           ++ L   E   +++S+L++ +     D+ +F+P PV   LK  +
Sbjct: 115 SVFLMPSEQYSFISSSLMKEVARHGGDVETFLPAPVYKALKARL 158


>gi|291459593|ref|ZP_06598983.1| pantetheine-phosphate adenylyltransferase [Oribacterium sp. oral
           taxon 078 str. F0262]
 gi|291417871|gb|EFE91590.1| pantetheine-phosphate adenylyltransferase [Oribacterium sp. oral
           taxon 078 str. F0262]
          Length = 164

 Score =  160 bits (406), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 60/163 (36%), Positives = 93/163 (57%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDP+T GH+DII ++    + L + +  NSVKT  F S++ER  +I   I 
Sbjct: 1   MRIALYPGSFDPVTFGHLDIIERSAKIFDRLFVGVLVNSVKTPLF-SMEERVRMISVLIK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V SF GL V+ A+ + A VIVRGLR +TDF+YE++++  N+ +  +I T
Sbjct: 60  GLKNVE-----VRSFSGLTVDYARSLGATVIVRGLRAVTDFEYELQLSQTNKVMAADIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L       Y++S+ ++ + S   DI  FVP+ V   +   +
Sbjct: 115 VFLTTNLKYSYLSSSTVKEIASYGGDIRPFVPENVIREIHRKL 157


>gi|241762409|ref|ZP_04760488.1| pantetheine-phosphate adenylyltransferase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373096|gb|EER62745.1| pantetheine-phosphate adenylyltransferase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 178

 Score =  160 bits (406), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 90/165 (54%), Gaps = 1/165 (0%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y G+FDP+T GH+DII +     + L+IA+  N  K+  F S + R+ +I+  I   
Sbjct: 11  IALYPGTFDPVTLGHLDIIRRGARIFDHLIIAVAENPGKSPLFSSEE-RASMIRHEISRL 69

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
              + +R+ VI +  L ++  +   A VI+RGLR + DF+YE +M  +N+ +  +I T+ 
Sbjct: 70  ENPTKSRIEVIIYNSLLMDCVESQGASVILRGLRAVADFEYEYQMAGMNQQINNKIETVF 129

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           L A    + V S L++ +   + +IT FVP  V   L+  V    
Sbjct: 130 LMADSVLQPVASRLVKEIAFYNGNITPFVPPYVAQKLQEAVTRKK 174


>gi|208819762|ref|ZP_03260082.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4042]
 gi|208739885|gb|EDZ87567.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4042]
          Length = 180

 Score =  160 bits (406), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 55/167 (32%), Positives = 96/167 (57%), Gaps = 6/167 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F +++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMF-TLEERVALAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHLGNVE-----VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           ++ L   +   +++S+L++ +     D+T F+PD V   L   +   
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPDNVHHALMAKLAYR 161


>gi|188591104|ref|YP_001795704.1| phosphopantetheine adenylyltransferase [Cupriavidus taiwanensis LMG
           19424]
 gi|229488136|sp|B2AGT3|COAD_CUPTR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|170937998|emb|CAP62982.1| CMP-deoxy-D-manno-octulosonate-lipid A transferase
           (phosphopantetheine adenylyltransferase) [Cupriavidus
           taiwanensis LMG 19424]
          Length = 161

 Score =  160 bits (406), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 95/165 (57%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A +  ++LV+ +  +  K   F S++ER  + ++ + 
Sbjct: 1   MVSAVYPGTFDPMTRGHEDLVRRASNIFDELVVGVAHSPNKRPFF-SLEERISIAREVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+       V V  F GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPN-----VRVEGFSGLLKDFVRKNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   +  ++++ T +R +  +  D++ FV   V  +L+  +  
Sbjct: 115 MFLTPSDQYQFISGTFVREIAVLGGDVSKFVFPSVERWLQEKIAK 159


>gi|160945290|ref|ZP_02092516.1| hypothetical protein FAEPRAM212_02809 [Faecalibacterium prausnitzii
           M21/2]
 gi|158443021|gb|EDP20026.1| hypothetical protein FAEPRAM212_02809 [Faecalibacterium prausnitzii
           M21/2]
 gi|295105499|emb|CBL03043.1| pantetheine-phosphate adenylyltransferase, bacterial
           [Faecalibacterium prausnitzii SL3/3]
          Length = 179

 Score =  160 bits (406), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 58/171 (33%), Positives = 92/171 (53%), Gaps = 6/171 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDP+T GH+DII +A    + L++A+  NS K   F +++ER  ++++   
Sbjct: 1   MATAVYPGSFDPVTKGHLDIIKRAAKINDHLIVAVLINSAKHPLF-TVEERVAMLQECCK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           +    +     V SF+GL V  AK   A V+VRGLR +TDF+ E+++   N  L P I T
Sbjct: 60  NIPNVT-----VESFDGLTVEFAKKRHASVMVRGLRAVTDFENEIQLAQTNHALMPGIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDS 172
           + L       Y++ST+++      +DI+ FV   V   +      L + + 
Sbjct: 115 MFLATSIKWSYLSSTIVKEAAYYGSDISKFVTPNVEKAVSEKYAQLREREK 165


>gi|148244500|ref|YP_001219194.1| phosphopantetheine adenylyltransferase [Candidatus Vesicomyosocius
           okutanii HA]
 gi|166216617|sp|A5CX55|COAD_VESOH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|146326327|dbj|BAF61470.1| pantetheine-phosphate adenylyltransferase [Candidatus
           Vesicomyosocius okutanii HA]
          Length = 158

 Score =  160 bits (406), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 64/164 (39%), Positives = 104/164 (63%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y GSFDPITNGH+D+I +A    ++++I I  NS K K FLSI +R + I  ++
Sbjct: 1   MKKIAIYPGSFDPITNGHVDLIKRASKLFDEIIIGISQNSKK-KAFLSINDRIDTINTAL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   N + ++SF+ L V+ A   +AQVI+RGLR ++DF+YE +++ +N+ L P I 
Sbjct: 60  K-----DINNIRILSFDTLLVDFASLKNAQVILRGLRAISDFEYEYQLSGINKHLNPNIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           T+ +   E    ++S+LI+ +I++  DI+ FVP  V   LK+ +
Sbjct: 115 TLFMTPTEQYANISSSLIKEIIALGGDISVFVPASVKTLLKHRL 158


>gi|154249355|ref|YP_001410180.1| phosphopantetheine adenylyltransferase [Fervidobacterium nodosum
           Rt17-B1]
 gi|154153291|gb|ABS60523.1| pantetheine-phosphate adenylyltransferase [Fervidobacterium nodosum
           Rt17-B1]
          Length = 160

 Score =  160 bits (406), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 52/166 (31%), Positives = 91/166 (54%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +AVY GSFDPIT GH+DI  +A    ++L + +  N  K   F +++ER E++++ + 
Sbjct: 1   MIRAVYPGSFDPITYGHIDIAKRAAKLFDELYVVVMENKRKNYTF-TVEERIEMVRECLK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      + SF GL V   +     V++RGLR +TDF+YE++M   N+ +C  + T
Sbjct: 60  DIPNVK-----IESFSGLLVEYTEKNKINVVIRGLRAVTDFEYELQMALANKEICNGVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + L   +S  +++S+L++ + S    I+ +VP+ V   L   +   
Sbjct: 115 VFLMTDKSYSFLSSSLVKEVASFGGPISQWVPENVAKKLSEKIQKR 160


>gi|18310711|ref|NP_562645.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           str. 13]
 gi|168207255|ref|ZP_02633260.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           E str. JGS1987]
 gi|168210639|ref|ZP_02636264.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           B str. ATCC 3626]
 gi|168217015|ref|ZP_02642640.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           NCTC 8239]
 gi|169342737|ref|ZP_02863777.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           C str. JGS1495]
 gi|182625825|ref|ZP_02953591.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           D str. JGS1721]
 gi|29427874|sp|Q8XJM7|COAD_CLOPE RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|18145392|dbj|BAB81435.1| phosphopantetheine adenylyltransferase [Clostridium perfringens
           str. 13]
 gi|169299243|gb|EDS81313.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           C str. JGS1495]
 gi|170661347|gb|EDT14030.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           E str. JGS1987]
 gi|170711276|gb|EDT23458.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           B str. ATCC 3626]
 gi|177908859|gb|EDT71351.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           D str. JGS1721]
 gi|182380939|gb|EDT78418.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           NCTC 8239]
          Length = 164

 Score =  160 bits (406), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 61/167 (36%), Positives = 98/167 (58%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY GSFDPIT GH+D+I +A S  + +++A+  N  K   F SI+ER  LI++ + 
Sbjct: 1   MRVGVYPGSFDPITKGHLDLIERAASKFDKVIVAVLININKKGMF-SIEERVNLIEKCVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +         V SF GL ++  +   A VI++GLR +TDF+YE +M  +NR L  E+ T
Sbjct: 60  KYNNVE-----VKSFNGLLIDFVRKEKADVIIKGLRSVTDFEYEFQMALMNRELANEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + +    +  Y++S+ I+ + S + +I +FVP  +   L+  +ISL 
Sbjct: 115 VFMVTSPNYSYISSSAIKQVASFNGEIKNFVPKEIVEDLEERIISLR 161


>gi|46198868|ref|YP_004535.1| phosphopantetheine adenylyltransferase [Thermus thermophilus HB27]
 gi|55980898|ref|YP_144195.1| phosphopantetheine adenylyltransferase [Thermus thermophilus HB8]
 gi|61212639|sp|Q72K87|COAD_THET2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|81600459|sp|Q5SJS9|COAD_THET8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|29726926|pdb|1OD6|A Chain A, The Crystal Structure Of Phosphopantetheine
           Adenylyltransferase From Thermus Thermophilus In Complex
           With 4'-Phosphopantetheine
 gi|46196491|gb|AAS80908.1| phosphopantetheine adenylyltransferase [Thermus thermophilus HB27]
 gi|55772311|dbj|BAD70752.1| phosphopantetheine adenylyltransferase [Thermus thermophilus HB8]
          Length = 160

 Score =  160 bits (406), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 52/161 (32%), Positives = 90/161 (55%), Gaps = 6/161 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKT-KGFLSIQERSELIKQSIFHF 63
            VY GSFDP+TNGH+D+I +A    E + +A+  N  K  +   S +ER  +I+++  H 
Sbjct: 3   VVYPGSFDPLTNGHLDVIQRASRLFEKVTVAVLENPSKRGQYLFSAEERLAIIREATAHL 62

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               +      +F GL V+  + + AQ IV+GLR ++D++YE++M  +NR L P + T+ 
Sbjct: 63  ANVEAA-----TFSGLLVDFVRRVGAQAIVKGLRAVSDYEYELQMAHLNRQLYPGLETLF 117

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + A     +V+ST+++ +     D++  VP      LK  +
Sbjct: 118 ILAATRYSFVSSTMVKEIARYGGDVSKLVPPATLRALKAKL 158


>gi|220905297|ref|YP_002480609.1| pantetheine-phosphate adenylyltransferase [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
 gi|219869596|gb|ACL49931.1| pantetheine-phosphate adenylyltransferase [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
          Length = 179

 Score =  160 bits (406), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 55/179 (30%), Positives = 92/179 (51%), Gaps = 12/179 (6%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y G+FDP+TNGH+ +I +     + +++A+  N+ K   F S +ER  + ++++ 
Sbjct: 1   MRVAMYPGTFDPLTNGHLSLIRRGCEVFDQIIVAVADNTPKRPLF-SHEERVNMAREALK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                   R  V  F GL V  A    A  ++RGLR  +DF+YE ++  +NR L   I T
Sbjct: 60  -----DEPRARVEPFSGLTVEYAAQRGACALLRGLRAASDFEYEFQLALMNRRLQRHIQT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTI 180
           + L       +++ST+++   S  ADI   VP+ V       +  L KY+  ++   T 
Sbjct: 115 VFLMTDYQWLFISSTIVKAAASHGADIKGLVPENV------RLALLEKYEKGEVAKGTP 167


>gi|167758116|ref|ZP_02430243.1| hypothetical protein CLOSCI_00454 [Clostridium scindens ATCC 35704]
 gi|167664013|gb|EDS08143.1| hypothetical protein CLOSCI_00454 [Clostridium scindens ATCC 35704]
          Length = 162

 Score =  160 bits (406), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 94/167 (56%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M K +Y GSFDP+T GH+D+I ++   V++L++ +  N  K+  F S +ER  ++ +   
Sbjct: 1   MLKGIYPGSFDPVTYGHLDVIERSSKLVDELIVGVLNNKAKSPLF-SAEERVRMLNEVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +     V+ FEGL V+ A+ + A +++RGLR +TDF+YE++M   N  + P++ T
Sbjct: 60  DMPNVT-----VVPFEGLLVDFARKMDAGLVIRGLRAITDFEYELQMAQTNHKMEPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L       Y++ST ++ + +   DI+ FVP  V   ++  +    
Sbjct: 115 VFLTTSLDYSYLSSTTVKEVAAFGGDISQFVPGIVADLIEEKMNKRR 161


>gi|114332301|ref|YP_748523.1| pantetheine-phosphate adenylyltransferase [Nitrosomonas eutropha
           C91]
 gi|122313041|sp|Q0ADM4|COAD_NITEC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|114309315|gb|ABI60558.1| Phosphopantetheine adenylyltransferase [Nitrosomonas eutropha C91]
          Length = 164

 Score =  160 bits (406), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 51/167 (30%), Positives = 93/167 (55%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M K +Y G+FDPIT+GH D++ +A      +++A+  +S K   F S++ER ++ +  + 
Sbjct: 1   MDKVIYPGTFDPITHGHEDLVYRASRLFGKVIVAVAVSSGKAPFF-SLEERVKMARNVLT 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +         V  F GL +  A+   A +I+RGLR ++DF+YE ++  +NR L P++ T
Sbjct: 60  GYSNVE-----VTGFSGLLMEFARQQDAHIIIRGLRAVSDFEYEFQLAGMNRGLYPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           I L   E   ++++T++R +  +  D++ FV   V   L+   I + 
Sbjct: 115 IFLTPSEQYMFISATIVREIARLGGDVSKFVHPLVIERLRQKKIEMN 161


>gi|16125828|ref|NP_420392.1| lipopolysaccharide core biosynthesis protein KdtB [Caulobacter
           crescentus CB15]
 gi|221234589|ref|YP_002517025.1| phosphopantetheine adenylyltransferase [Caulobacter crescentus
           NA1000]
 gi|14194502|sp|P58103|COAD_CAUCR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254763940|sp|B8GVE7|COAD_CAUCN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|13422972|gb|AAK23560.1| lipopolysaccharide core biosynthesis protein KdtB [Caulobacter
           crescentus CB15]
 gi|220963761|gb|ACL95117.1| phosphopantetheine adenylyltransferase [Caulobacter crescentus
           NA1000]
          Length = 163

 Score =  160 bits (406), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 63/165 (38%), Positives = 99/165 (60%), Gaps = 3/165 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+TNGH+DII +A+  V+ LVI +  N  K   F S++ER E++++   
Sbjct: 1   MRVGLYPGTFDPVTNGHLDIIGRAVKLVDKLVIGVAINIGKGPLF-SLEERVEILERETA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H    +     V  F+ L ++ A+D++AQ+IVRGLR + DF+YE +MT++N+ L  EI T
Sbjct: 60  HLKKIAEIE--VRPFDSLLMHFARDVNAQMIVRGLRAVADFEYEFQMTAMNQQLDREIET 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A    + + S L++ + ++  DI  FVP  V   L   V  
Sbjct: 118 VFLMADPRHQAIASRLVKEIATLGGDIGKFVPPGVAQQLLAKVGK 162


>gi|262280054|ref|ZP_06057839.1| phosphopantetheine adenylyltransferase [Acinetobacter calcoaceticus
           RUH2202]
 gi|262260405|gb|EEY79138.1| phosphopantetheine adenylyltransferase [Acinetobacter calcoaceticus
           RUH2202]
          Length = 163

 Score =  160 bits (406), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 56/162 (34%), Positives = 91/162 (56%), Gaps = 6/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
             + +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER EL + S+ 
Sbjct: 3   KTRVIYPGTFDPITNGHVDLVTRASRMFDEVVVAIAIGHHKNPLF-SLEERVELAQSSLS 61

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H           + F+GL VN  K+  A  ++RGLR ++DF+YE ++ ++NR L P    
Sbjct: 62  HLSNVE-----FVGFDGLLVNFFKEQKATAVLRGLRAVSDFEYEFQLANMNRQLDPYFEA 116

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           + L   E   +++STLIR +  +  D+T FVP  V    +  
Sbjct: 117 VFLTPSEQYSFISSTLIREIARLKGDVTKFVPQAVVEAFERK 158


>gi|329896520|ref|ZP_08271578.1| Phosphopantetheine adenylyltransferase [gamma proteobacterium
           IMCC3088]
 gi|328921737|gb|EGG29110.1| Phosphopantetheine adenylyltransferase [gamma proteobacterium
           IMCC3088]
          Length = 161

 Score =  160 bits (406), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 56/163 (34%), Positives = 93/163 (57%), Gaps = 6/163 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
             VY G+FDPITNGH+D+  +A    + +V+ I  +  KT  F S++ER EL +QS+ H 
Sbjct: 5   TVVYPGTFDPITNGHVDLTERASRLFKRVVVGIAYSEKKTPMF-SLEERIELCQQSLAHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V+ F  L ++  +   A  ++RGLR ++DF+YE+++ ++NR + PE  ++ 
Sbjct: 64  PNVE-----VVGFNNLLIDFVRSQGANCVLRGLRAVSDFEYELQLANMNRAMHPEFESVF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           L   E   +++S+L+R +  ++ DIT FVP PV   L      
Sbjct: 119 LTPSEHLGFISSSLVREIAVLNGDITPFVPKPVAERLIARYQR 161


>gi|319789468|ref|YP_004151101.1| pantetheine-phosphate adenylyltransferase [Thermovibrio
           ammonificans HB-1]
 gi|317113970|gb|ADU96460.1| pantetheine-phosphate adenylyltransferase [Thermovibrio
           ammonificans HB-1]
          Length = 163

 Score =  160 bits (405), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 52/166 (31%), Positives = 85/166 (51%), Gaps = 3/166 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+++A+Y G+FDP+T GH+DI+ + L    +L++ I  N  K   F   + R   I+   
Sbjct: 1   MIKRAIYPGTFDPVTLGHLDIVRRGLKLFPELIVGIAENPRKRPLFSLEERREMFIESLK 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +        V +F  L V  AK   A  I+RG+R ++D D+E  M S+NR L PEI 
Sbjct: 61  EVGLNGKVQ---VKTFNSLLVEFAKREGAVAILRGIRIVSDMDHEFTMASLNRKLYPEIE 117

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+ L   +   Y++S+ +R +     D++ FV + V   L+     
Sbjct: 118 TVFLMPSDDYAYLSSSAVREIAYYGGDVSQFVTEFVRKKLEEKFKR 163


>gi|78356826|ref|YP_388275.1| phosphopantetheine adenylyltransferase [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|123552462|sp|Q310R6|COAD_DESDG RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|78219231|gb|ABB38580.1| Coenzyme A biosynthesis protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 170

 Score =  160 bits (405), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 53/164 (32%), Positives = 91/164 (55%), Gaps = 6/164 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + A+Y G+FDP+TNGH  +I +     + +V+A+  ++ KT  F +I ER ++ ++++  
Sbjct: 7   KIAIYPGTFDPLTNGHASLIQRGCQIFDHIVVAVANDTPKTPLF-TIDERVQMAQEALE- 64

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   ++V  F GL V+ A+   A VI+RGLR ++DF+YE ++  +NR +   I T+
Sbjct: 65  ----GVGSITVEPFSGLLVDYAERRGAGVILRGLRAVSDFEYEFQLALMNRKMKRHIQTV 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            L       Y++ST+I+   S+  DI   VPD V   L+     
Sbjct: 121 FLMTDYKWLYISSTIIKAAASLGGDIKGLVPDNVYRRLREKYGY 164


>gi|16331739|ref|NP_442467.1| phosphopantetheine adenylyltransferase [Synechocystis sp. PCC 6803]
 gi|8469197|sp|Q55435|COAD_SYNY3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|1673325|dbj|BAA10537.1| KdtB protein [Synechocystis sp. PCC 6803]
          Length = 159

 Score =  160 bits (405), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 50/157 (31%), Positives = 85/157 (54%), Gaps = 6/157 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y GSFDPIT GH+DII +     E +++A+ CN  K   F S+++R E I+    H 
Sbjct: 2   IAIYPGSFDPITLGHLDIIERGSGLFEQIIVAVLCNPSKQPLF-SVEKRLEQIRHCTQHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
              +     V SF GL V+ AK   A V++RGLR ++DF+ E++M   N+ L   + T+ 
Sbjct: 61  TNVT-----VDSFNGLTVDYAKQKQATVLLRGLRVLSDFEKELQMAHTNQTLWDGVETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           L   +   +++S++++ +      +   VP  +   +
Sbjct: 116 LATAKEYSFLSSSIVKEIAKFGGSVDHLVPPSILADI 152


>gi|257453943|ref|ZP_05619219.1| pantetheine-phosphate adenylyltransferase [Enhydrobacter aerosaccus
           SK60]
 gi|257448608|gb|EEV23575.1| pantetheine-phosphate adenylyltransferase [Enhydrobacter aerosaccus
           SK60]
          Length = 174

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 53/161 (32%), Positives = 96/161 (59%), Gaps = 4/161 (2%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
            K +Y G+FDPIT GH+D+I +A    +++++A+     K   F +++ER  L++++   
Sbjct: 13  TKIIYPGTFDPITKGHLDLIKRACRLFDEVIVAVAIGHHKKPLF-TLEERIGLVEKACH- 70

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                 + +SVI F+GL V+LAK+  A  ++RGLR M+DF+YE ++ ++NR L P    +
Sbjct: 71  --DKDLSNISVIGFDGLLVDLAKNQQATGVLRGLRAMSDFEYEFQLANLNRELDPNFEAV 128

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            L   +   +++STL+R +  ++ D++ FVP  V    +  
Sbjct: 129 FLTPSQQYSFISSTLVREIGKLEGDVSKFVPPCVEEAFERK 169


>gi|302874762|ref|YP_003843395.1| pantetheine-phosphate adenylyltransferase [Clostridium
           cellulovorans 743B]
 gi|307690623|ref|ZP_07633069.1| phosphopantetheine adenylyltransferase [Clostridium cellulovorans
           743B]
 gi|302577619|gb|ADL51631.1| pantetheine-phosphate adenylyltransferase [Clostridium
           cellulovorans 743B]
          Length = 166

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 57/169 (33%), Positives = 98/169 (57%), Gaps = 6/169 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR AVY GSFDPITNGH+DII +++   +++++ +  N  K KG  + +ER ELIK+ + 
Sbjct: 1   MRVAVYPGSFDPITNGHLDIIKRSVKVFDEVIVTVLINPEK-KGLFTPEERVELIKKVVK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    V V SF GL V+  ++ ++ +I++GLR ++DF+YE +M  +N  L   + T
Sbjct: 60  DIPN-----VRVESFFGLLVDFMREKNSNIIIKGLRAVSDFEYEFQMALINNTLDANVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKY 170
           + +     + +++S+ ++ +   + DIT  VP+ V   LK  +    K 
Sbjct: 115 LFMMTSAQNLFLSSSSVKQVAMFNGDITGLVPEVVAEELKAKIKETRKK 163


>gi|117924734|ref|YP_865351.1| phosphopantetheine adenylyltransferase [Magnetococcus sp. MC-1]
 gi|117608490|gb|ABK43945.1| Phosphopantetheine adenylyltransferase [Magnetococcus sp. MC-1]
          Length = 164

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 61/166 (36%), Positives = 100/166 (60%), Gaps = 6/166 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y G+FDP+T GH+DII +A    + LV+ +  N  K   F  ++ER  L++QS+  
Sbjct: 5   RTAIYPGTFDPVTLGHVDIIRRASKLFDRLVVGVAVNMRKQPLFA-VEERVRLLEQSLA- 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                 + V+V+  +GL V  A+ + A  IVRGLR +TDFDYE +M ++NR L P+I T+
Sbjct: 63  ----DLHNVTVLPMDGLLVRSARQVGACAIVRGLRVVTDFDYEFQMGTMNRKLAPDIETV 118

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
            L A + + +++S++++ +  +  DIT FVP  V   L+  ++   
Sbjct: 119 FLMADDINTFLSSSMVKEVAIMGGDITPFVPAVVAEPLRQALLQRA 164


>gi|169796970|ref|YP_001714763.1| phosphopantetheine adenylyltransferase [Acinetobacter baumannii
           AYE]
 gi|184157118|ref|YP_001845457.1| phosphopantetheine adenylyltransferase [Acinetobacter baumannii
           ACICU]
 gi|260555739|ref|ZP_05827959.1| pantetheine-phosphate adenylyltransferase [Acinetobacter baumannii
           ATCC 19606]
 gi|294839938|ref|ZP_06784621.1| phosphopantetheine adenylyltransferase [Acinetobacter sp. 6013113]
 gi|301346831|ref|ZP_07227572.1| phosphopantetheine adenylyltransferase [Acinetobacter baumannii
           AB056]
 gi|229488109|sp|B2HUN5|COAD_ACIBC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229488111|sp|B0V8I3|COAD_ACIBY RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|169149897|emb|CAM87790.1| phosphopantetheine adenylyltransferase [Acinetobacter baumannii
           AYE]
 gi|183208712|gb|ACC56110.1| Phosphopantetheine adenylyltransferase [Acinetobacter baumannii
           ACICU]
 gi|260410650|gb|EEX03948.1| pantetheine-phosphate adenylyltransferase [Acinetobacter baumannii
           ATCC 19606]
          Length = 163

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 55/162 (33%), Positives = 90/162 (55%), Gaps = 6/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
             + +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER  L + S+ 
Sbjct: 3   KTRVIYPGTFDPITNGHVDLVTRASRMFDEVVVAIAIGHHKNPLF-SLEERVALAQSSLG 61

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H           + F+GL VN  K+  A  ++RGLR ++DF+YE ++ ++NR L P    
Sbjct: 62  HLSNVE-----FVGFDGLLVNFFKEQKATAVLRGLRAVSDFEYEFQLANMNRQLDPHFEA 116

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           + L   E   +++STLIR +  +  D+T FVP  V    +  
Sbjct: 117 VFLTPSEQYSFISSTLIREIARLKGDVTKFVPQAVVEAFERK 158


>gi|264680032|ref|YP_003279941.1| pantetheine-phosphate adenylyltransferase [Comamonas testosteroni
           CNB-2]
 gi|299531840|ref|ZP_07045241.1| pantetheine-phosphate adenylyltransferase [Comamonas testosteroni
           S44]
 gi|262210547|gb|ACY34645.1| pantetheine-phosphate adenylyltransferase [Comamonas testosteroni
           CNB-2]
 gi|298720160|gb|EFI61116.1| pantetheine-phosphate adenylyltransferase [Comamonas testosteroni
           S44]
          Length = 164

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 52/157 (33%), Positives = 89/157 (56%), Gaps = 6/157 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            AVY G+FDPIT GH D++ +A      +++A+     K   F S++ER  ++++S  ++
Sbjct: 6   IAVYPGTFDPITLGHEDVVRRAAQLFGKVIVAVAAGHHKKTLF-SLEERIAMVRESCANY 64

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V SF+GL  +      A+ +VRGLR +TDFDYE ++  +NR L PE+ T+ 
Sbjct: 65  PQVE-----VESFDGLLAHFVLARGAKAMVRGLRAVTDFDYEFQLAGMNRTLMPEVETVF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           L   +  ++++ST +R + +++ D+  FV   V   L
Sbjct: 120 LTPSDRYQFISSTFVREIATLNGDVDKFVSKGVHERL 156


>gi|33594350|ref|NP_881994.1| phosphopantetheine adenylyltransferase [Bordetella pertussis Tohama
           I]
 gi|33595532|ref|NP_883175.1| phosphopantetheine adenylyltransferase [Bordetella parapertussis
           12822]
 gi|33599930|ref|NP_887490.1| phosphopantetheine adenylyltransferase [Bordetella bronchiseptica
           RB50]
 gi|61212734|sp|Q7VTP4|COAD_BORPE RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|61212735|sp|Q7W154|COAD_BORPA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|61212741|sp|Q7WNU4|COAD_BORBR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|33564425|emb|CAE43734.1| phosphopantetheine adenylyltransferase [Bordetella pertussis Tohama
           I]
 gi|33565610|emb|CAE40256.1| phosphopantetheine adenylyltransferase [Bordetella parapertussis]
 gi|33567527|emb|CAE31440.1| phosphopantetheine adenylyltransferase [Bordetella bronchiseptica
           RB50]
          Length = 169

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 50/162 (30%), Positives = 95/162 (58%), Gaps = 6/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A +  + +V+ I  +  K   F +I+ER ++ ++ + 
Sbjct: 1   MIIAVYPGTFDPLTRGHEDLVRRAATLFDKVVVGIAHSRNKKPFF-TIEERVDIAREVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V SF GL  +  +D + +VI+RGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPNVE-----VHSFGGLLKDFVRDQNGRVIIRGLRAVSDFEYEFQMAGMNRHLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           + +   +  ++++ T++R +  +  D++ FV   V  +L+  
Sbjct: 115 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVERWLQAK 156


>gi|8469201|sp|Q9X980|COAD_SERMA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|4753138|gb|AAD28804.1| phosphopantetheine adenylyltransferase CoaD [Serratia marcescens]
 gi|18762511|gb|AAL78079.1| phosphopantetheine adenyltransferase [Yersinia enterocolitica]
          Length = 161

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 92/166 (55%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+D++ +A    + +++AI  +  K   F S+ ER  L  Q  
Sbjct: 1   MTSKAIYPGTFDPMTNGHLDLVTRASLMFDHVILAIAASPSKKPLF-SLDERVALATQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  + A   +A ++VRGLR ++DF+YE+++ ++NR L P + 
Sbjct: 60  SHLDNVE-----VLGFSELMAHFAAHQNANILVRGLRAVSDFEYELQLANMNRHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           ++ L   E   +++S+L++ +     DI  F+PD V   L   + +
Sbjct: 115 SVFLMPSEEWSFISSSLVKEVARHGGDIAPFLPDVVTQALMAKLAA 160


>gi|315125900|ref|YP_004067903.1| phosphopantetheine adenylyltransferase (PPAT) (dephospho-CoA
           pyrophosphorylase) [Pseudoalteromonas sp. SM9913]
 gi|315014414|gb|ADT67752.1| phosphopantetheine adenylyltransferase (PPAT) (dephospho-CoA
           pyrophosphorylase) [Pseudoalteromonas sp. SM9913]
          Length = 181

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 55/168 (32%), Positives = 99/168 (58%), Gaps = 6/168 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+Y G+FDP+TNGH D+I +A    + +++AI  N  K   F +++ER +L  + +
Sbjct: 19  MKVTAIYPGTFDPLTNGHTDLIQRAAKMFDTVIVAIAHNPSKKPCF-TLEERVDLANEIL 77

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          VI F GL  +LA+D +A V++RG+R ++DFDYE ++ ++NR L P++ 
Sbjct: 78  SHLDNVK-----VIGFSGLLADLARDHNANVLIRGIRAVSDFDYEFQLANMNRRLNPDLE 132

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           ++ L   E + +++STL++ +   + D++ FV   V   L++ +    
Sbjct: 133 SVFLTPAERNTFISSTLVKEVARHNGDVSEFVDTIVMKALQSRLGKTK 180


>gi|187477072|ref|YP_785096.1| phosphopantetheine adenylyltransferase [Bordetella avium 197N]
 gi|123514426|sp|Q2KY40|COAD_BORA1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|115421658|emb|CAJ48168.1| phosphopantetheine adenylyltransferase [Bordetella avium 197N]
          Length = 167

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 52/162 (32%), Positives = 95/162 (58%), Gaps = 6/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A +  + +V+A+  +  K   F +I ER E+ ++ + 
Sbjct: 1   MITAVYPGTFDPLTRGHEDLVRRAAALFDKVVVAVAYSRNKKPFF-NIDERVEIAREVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V SF GL  +  ++ + +VIVRGLR M+DF+YE +M  +NR L P++ T
Sbjct: 60  HYPNVE-----VRSFGGLLRDFVREQNGRVIVRGLRAMSDFEYEFQMAGMNRHLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           + +   +  ++++ T++R +  +  D++ FV   V  +L+  
Sbjct: 115 LFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVERWLQAK 156


>gi|53718156|ref|YP_107142.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           K96243]
 gi|53724089|ref|YP_104609.1| phosphopantetheine adenylyltransferase [Burkholderia mallei ATCC
           23344]
 gi|67643443|ref|ZP_00442189.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei GB8
           horse 4]
 gi|76810814|ref|YP_332162.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           1710b]
 gi|83721501|ref|YP_441027.1| phosphopantetheine adenylyltransferase [Burkholderia thailandensis
           E264]
 gi|121600724|ref|YP_991444.1| phosphopantetheine adenylyltransferase [Burkholderia mallei SAVP1]
 gi|124385558|ref|YP_001027480.1| phosphopantetheine adenylyltransferase [Burkholderia mallei NCTC
           10229]
 gi|126438597|ref|YP_001057617.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           668]
 gi|126449072|ref|YP_001082446.1| phosphopantetheine adenylyltransferase [Burkholderia mallei NCTC
           10247]
 gi|126453101|ref|YP_001064863.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           1106a]
 gi|134279804|ref|ZP_01766516.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 305]
 gi|167001050|ref|ZP_02266851.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei
           PRL-20]
 gi|167579756|ref|ZP_02372630.1| phosphopantetheine adenylyltransferase [Burkholderia thailandensis
           TXDOH]
 gi|167617832|ref|ZP_02386463.1| phosphopantetheine adenylyltransferase [Burkholderia thailandensis
           Bt4]
 gi|167718010|ref|ZP_02401246.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           DM98]
 gi|167737027|ref|ZP_02409801.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           14]
 gi|167822661|ref|ZP_02454132.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           9]
 gi|167844232|ref|ZP_02469740.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           B7210]
 gi|167892742|ref|ZP_02480144.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           7894]
 gi|167901238|ref|ZP_02488443.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           NCTC 13177]
 gi|167909456|ref|ZP_02496547.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           112]
 gi|167917484|ref|ZP_02504575.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           BCC215]
 gi|217419679|ref|ZP_03451185.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 576]
 gi|226199572|ref|ZP_03795129.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei Pakistan 9]
 gi|237810767|ref|YP_002895218.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei MSHR346]
 gi|242314120|ref|ZP_04813136.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 1106b]
 gi|254175299|ref|ZP_04881960.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei ATCC
           10399]
 gi|254181870|ref|ZP_04888467.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 1655]
 gi|254187804|ref|ZP_04894316.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254201696|ref|ZP_04908060.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei FMH]
 gi|254207030|ref|ZP_04913381.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei JHU]
 gi|254260707|ref|ZP_04951761.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 1710a]
 gi|254296078|ref|ZP_04963535.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 406e]
 gi|254357509|ref|ZP_04973783.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei
           2002721280]
 gi|257140320|ref|ZP_05588582.1| phosphopantetheine adenylyltransferase [Burkholderia thailandensis
           E264]
 gi|61212521|sp|Q62FB8|COAD_BURMA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|61212527|sp|Q63XM3|COAD_BURPS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|123538063|sp|Q2T1C2|COAD_BURTA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|123600328|sp|Q3JW91|COAD_BURP1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216064|sp|A3MQB0|COAD_BURM7 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216065|sp|A2S6B1|COAD_BURM9 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216066|sp|A1UZP1|COAD_BURMS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216067|sp|A3NR92|COAD_BURP0 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216068|sp|A3N5J6|COAD_BURP6 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|52208570|emb|CAH34506.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           K96243]
 gi|52427512|gb|AAU48105.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei ATCC
           23344]
 gi|76580267|gb|ABA49742.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 1710b]
 gi|83655326|gb|ABC39389.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           thailandensis E264]
 gi|121229534|gb|ABM52052.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei
           SAVP1]
 gi|124293578|gb|ABN02847.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei NCTC
           10229]
 gi|126218090|gb|ABN81596.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 668]
 gi|126226743|gb|ABN90283.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 1106a]
 gi|126241942|gb|ABO05035.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei NCTC
           10247]
 gi|134249004|gb|EBA49086.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 305]
 gi|147747590|gb|EDK54666.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei FMH]
 gi|147752572|gb|EDK59638.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei JHU]
 gi|148026573|gb|EDK84658.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei
           2002721280]
 gi|157805868|gb|EDO83038.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 406e]
 gi|157935484|gb|EDO91154.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160696344|gb|EDP86314.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei ATCC
           10399]
 gi|184212408|gb|EDU09451.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 1655]
 gi|217396983|gb|EEC36999.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 576]
 gi|225928453|gb|EEH24483.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei Pakistan 9]
 gi|237506052|gb|ACQ98370.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei MSHR346]
 gi|238524795|gb|EEP88226.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei GB8
           horse 4]
 gi|242137359|gb|EES23761.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 1106b]
 gi|243063121|gb|EES45307.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei
           PRL-20]
 gi|254219396|gb|EET08780.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 1710a]
          Length = 166

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 52/168 (30%), Positives = 96/168 (57%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F S++ER ++  + + 
Sbjct: 1   MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFF-SLEERLKIANEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V+ F GL  +  +   A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPNVK-----VMGFTGLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + +   +  ++++ T++R +  +  D++ FV   V  +L   V ++ +
Sbjct: 115 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAMAQ 162


>gi|319779120|ref|YP_004130033.1| Phosphopantetheine adenylyltransferase [Taylorella equigenitalis
           MCE9]
 gi|317109144|gb|ADU91890.1| Phosphopantetheine adenylyltransferase [Taylorella equigenitalis
           MCE9]
          Length = 172

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 50/167 (29%), Positives = 92/167 (55%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y G+FDPIT GH D++ +A    +++V+ +  +  K   F +++ER E+ ++ + 
Sbjct: 1   MITAIYPGTFDPITRGHEDLVRRASKLFDNVVVGVAESRAKKPFF-TLEERLEIAREVLS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V SF GL  +  +    +VIVRGLR ++DF+YE ++  +NR L PE+ T
Sbjct: 60  HYQNVE-----VKSFTGLLKDFVRQEGGKVIVRGLRAVSDFEYEFQLAGMNRYLLPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + +   E  ++++ T +R +  +  +++ FV   V   L   V  + 
Sbjct: 115 LFMTPSEQYQFISGTFVREVAILGGNVSDFVFPLVEKRLSEKVALIN 161


>gi|262373256|ref|ZP_06066535.1| pantetheine-phosphate adenylyltransferase [Acinetobacter junii
           SH205]
 gi|262313281|gb|EEY94366.1| pantetheine-phosphate adenylyltransferase [Acinetobacter junii
           SH205]
          Length = 163

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 55/162 (33%), Positives = 92/162 (56%), Gaps = 6/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
             + +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER EL K S+ 
Sbjct: 3   KTRVIYPGTFDPITNGHVDLVARASKMFDEVVVAIAIGHHKNPVF-SLEERVELAKASLS 61

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H           + F+GL VN  ++  A  ++RGLR ++DF+YE ++ ++NR L P   +
Sbjct: 62  HLTNVE-----FVGFDGLLVNFFREQRATAVLRGLRAISDFEYEFQLANMNRQLDPHFES 116

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           + L   E   +++STL+R +  +  D+T FVP  V    +  
Sbjct: 117 VFLTPSEQYSFISSTLVREIARLKGDVTKFVPAVVVQAFERK 158


>gi|162148107|ref|YP_001602568.1| putative phosphopantetheine adenylyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209542721|ref|YP_002274950.1| pantetheine-phosphate adenylyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786684|emb|CAP56267.1| putative phosphopantetheine adenylyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209530398|gb|ACI50335.1| pantetheine-phosphate adenylyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 169

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 58/163 (35%), Positives = 91/163 (55%), Gaps = 5/163 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R   Y G+FDP+TNGH+DI+ +A   V+ LV+ +  N+ K    + + ER   ++     
Sbjct: 7   RTGFYPGTFDPMTNGHLDIVERAARLVDRLVVGVAENTGKQP-LMPLDERVACVQAETRA 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               +   + V+ F  L V +A+   A VIVRGLR + DFDYE++M  +N  L P+I T+
Sbjct: 66  VAQRNGTTIDVVGFGNLLVEVARSHGATVIVRGLRAVVDFDYEVQMFGMNHHLAPDIETV 125

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPD----PVCVFLK 161
            L A E ++Y++S L++ +  +  DIT FVP      V   L+
Sbjct: 126 FLMATERNQYISSRLVKEVARLGGDITGFVPPFTRRHVLARLE 168


>gi|268611481|ref|ZP_06145208.1| phosphopantetheine adenylyltransferase [Ruminococcus flavefaciens
           FD-1]
          Length = 163

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 50/166 (30%), Positives = 88/166 (53%), Gaps = 5/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R AV  GSFDP+T GH+DII +A    + +++ I  N+ K +   +  ER  +I+Q  
Sbjct: 1   MRRIAVCPGSFDPVTLGHLDIITRASKLFDKVIVLISRNAGKAQPSFTATERMLMIQQVT 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   + V +   +GL  +  + + A  IV+GLR ++DF+YE +M   N+ L     
Sbjct: 61  K-----DLDNVVIDILDGLLADYVESVGAIAIVKGLRAVSDFEYEFQMALANKKLYSGAE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+ L     + Y++S++++ +     DI+ FVP+ +   +K  +I 
Sbjct: 116 TVFLTTAAENMYLSSSVVKQIAYFGGDISHFVPESILEDIKQRLIK 161


>gi|295689997|ref|YP_003593690.1| pantetheine-phosphate adenylyltransferase [Caulobacter segnis ATCC
           21756]
 gi|295431900|gb|ADG11072.1| pantetheine-phosphate adenylyltransferase [Caulobacter segnis ATCC
           21756]
          Length = 163

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 62/159 (38%), Positives = 98/159 (61%), Gaps = 3/159 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+TNGH+DII +A+  V+ LVI +  N  K   F S+ ER  ++++   
Sbjct: 1   MRVGLYPGTFDPVTNGHLDIIGRAVKLVDKLVIGVAVNIGKGPLF-SLDERVAILERETA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H       ++ V  FE L ++ A+D++AQ+IVRGLR + DF+YE +MT++N+ L  EI T
Sbjct: 60  HLTK--IAQIEVKPFESLLMHFARDVNAQMIVRGLRAVADFEYEFQMTAMNQQLDREIET 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           + L A    + + S L++ + ++  DI+ FVP  V   L
Sbjct: 118 VFLMADPRHQAIASRLVKEIAALGGDISKFVPAGVAEQL 156


>gi|114768824|ref|ZP_01446450.1| pantetheine-phosphate adenylyltransferase [alpha proteobacterium
           HTCC2255]
 gi|114549741|gb|EAU52622.1| pantetheine-phosphate adenylyltransferase [alpha proteobacterium
           HTCC2255]
          Length = 165

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 58/164 (35%), Positives = 96/164 (58%), Gaps = 2/164 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A   V+ LVI +  N  K   F S++ER E+I++++ 
Sbjct: 1   MRIGLYPGTFDPITRGHLDIIKRACVLVDKLVIGVAINRDKNPLF-SLEERVEMIERNLS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F   +   + V  FE L ++ A ++ AQ+I+RGLR ++DF+YE ++  +NR +   I T
Sbjct: 60  KF-EHNETNIIVEPFENLLIDKATEVGAQIIIRGLRAVSDFEYEYQLVGMNRAMNDNIET 118

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
             L A+   + + S L++ +  ++ D++ FV   V   LK    
Sbjct: 119 TFLMAEAKHQAIASRLVKEIARLNGDVSKFVTPGVETSLKEKFK 162


>gi|169634070|ref|YP_001707806.1| phosphopantetheine adenylyltransferase [Acinetobacter baumannii
           SDF]
 gi|229488110|sp|B0VTH7|COAD_ACIBS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|169152862|emb|CAP01892.1| phosphopantetheine adenylyltransferase [Acinetobacter baumannii]
          Length = 163

 Score =  160 bits (405), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 56/164 (34%), Positives = 91/164 (55%), Gaps = 7/164 (4%)

Query: 1   MMRK-AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           M +   +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER  L + S
Sbjct: 1   MSKTSVIYPGTFDPITNGHVDLVTRASRMFDEVVVAIAIGHHKNPLF-SLEERVALAQSS 59

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           + H           + F+GL VN  K+  A  ++RGLR ++DF+YE ++ ++NR L P  
Sbjct: 60  LGHLSNVE-----FVGFDGLLVNFFKEQKATAVLRGLRAVSDFEYEFQLANMNRQLDPHF 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
             + L   E   +++STLIR +  +  D+T FVP  V    +  
Sbjct: 115 EAVFLTPSEQYSFISSTLIREIARLKGDVTKFVPQAVVEAFERK 158


>gi|254431152|ref|ZP_05044855.1| pantetheine-phosphate adenylyltransferase [Cyanobium sp. PCC 7001]
 gi|197625605|gb|EDY38164.1| pantetheine-phosphate adenylyltransferase [Cyanobium sp. PCC 7001]
          Length = 167

 Score =  160 bits (405), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 92/165 (55%), Gaps = 7/165 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDP+T GH+D+I +A    + +V+A+  N  K   F  +++R E I+ +  
Sbjct: 1   MR-ALYPGSFDPLTLGHLDLIERASRLFDGVVVAVLQNPSKQPAF-PLEQRLEQIRGATG 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H        V V SF+GL V  A+   AQVI+RGLR M+DF++E+++   N+ L PE+ T
Sbjct: 59  HL-----QGVEVGSFDGLTVECARRCGAQVILRGLRAMSDFEFELQIAHTNQSLEPEVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L       +++S++++ +     D+   VP  V   L  +   
Sbjct: 114 LFLATAVHHSFLSSSVVKEVARFGGDVHHMVPPGVAQDLAKLFNR 158


>gi|115352918|ref|YP_774757.1| phosphopantetheine adenylyltransferase [Burkholderia ambifaria
           AMMD]
 gi|134297003|ref|YP_001120738.1| phosphopantetheine adenylyltransferase [Burkholderia vietnamiensis
           G4]
 gi|161523674|ref|YP_001578686.1| phosphopantetheine adenylyltransferase [Burkholderia multivorans
           ATCC 17616]
 gi|170701092|ref|ZP_02892068.1| pantetheine-phosphate adenylyltransferase [Burkholderia ambifaria
           IOP40-10]
 gi|172061766|ref|YP_001809418.1| phosphopantetheine adenylyltransferase [Burkholderia ambifaria
           MC40-6]
 gi|189351557|ref|YP_001947185.1| phosphopantetheine adenylyltransferase [Burkholderia multivorans
           ATCC 17616]
 gi|221199979|ref|ZP_03573022.1| pantetheine-phosphate adenylyltransferase [Burkholderia multivorans
           CGD2M]
 gi|221206866|ref|ZP_03579878.1| pantetheine-phosphate adenylyltransferase [Burkholderia multivorans
           CGD2]
 gi|221211187|ref|ZP_03584166.1| pantetheine-phosphate adenylyltransferase [Burkholderia multivorans
           CGD1]
 gi|254251375|ref|ZP_04944693.1| Coenzyme A biosynthesis protein [Burkholderia dolosa AUO158]
 gi|122322179|sp|Q0BBQ0|COAD_BURCM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216530|sp|A4JI00|COAD_BURVG RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229488122|sp|B1YN57|COAD_BURA4 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229488125|sp|A9AEW9|COAD_BURM1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|115282906|gb|ABI88423.1| pantetheine-phosphate adenylyltransferase [Burkholderia ambifaria
           AMMD]
 gi|124893984|gb|EAY67864.1| Coenzyme A biosynthesis protein [Burkholderia dolosa AUO158]
 gi|134140160|gb|ABO55903.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           vietnamiensis G4]
 gi|160341103|gb|ABX14189.1| pantetheine-phosphate adenylyltransferase [Burkholderia multivorans
           ATCC 17616]
 gi|170133993|gb|EDT02345.1| pantetheine-phosphate adenylyltransferase [Burkholderia ambifaria
           IOP40-10]
 gi|171994283|gb|ACB65202.1| pantetheine-phosphate adenylyltransferase [Burkholderia ambifaria
           MC40-6]
 gi|189335579|dbj|BAG44649.1| pantetheine-phosphate adenylyltransferase [Burkholderia multivorans
           ATCC 17616]
 gi|221168548|gb|EEE01016.1| pantetheine-phosphate adenylyltransferase [Burkholderia multivorans
           CGD1]
 gi|221173521|gb|EEE05956.1| pantetheine-phosphate adenylyltransferase [Burkholderia multivorans
           CGD2]
 gi|221180218|gb|EEE12622.1| pantetheine-phosphate adenylyltransferase [Burkholderia multivorans
           CGD2M]
 gi|325524748|gb|EGD02730.1| phosphopantetheine adenylyltransferase [Burkholderia sp. TJI49]
          Length = 165

 Score =  160 bits (405), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 52/166 (31%), Positives = 97/166 (58%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F S++ER ++  + + 
Sbjct: 1   MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFF-SLEERLKIANEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V+ F+GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPNVK-----VMGFKGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + +   +  ++++ T++R +  +  D++ FV   V  +L   V ++
Sbjct: 115 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAM 160


>gi|77919239|ref|YP_357054.1| phosphopantetheine adenylyltransferase [Pelobacter carbinolicus DSM
           2380]
 gi|123574129|sp|Q3A423|COAD_PELCD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|77545322|gb|ABA88884.1| Phosphopantetheine adenylyltransferase [Pelobacter carbinolicus DSM
           2380]
          Length = 166

 Score =  160 bits (405), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 58/170 (34%), Positives = 102/170 (60%), Gaps = 6/170 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
            R AVY GSFDPITNGH+DII++ L+  ++L++A+  N  KT  F SI ER +LI++++ 
Sbjct: 3   KRIAVYPGSFDPITNGHLDIILRGLNIFDELIVAVAHNVAKTGLF-SIDERLDLIRETVK 61

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +      +V V +F+GL V+     +A++++RGLR ++DF+ E ++  +N  +  ++ T
Sbjct: 62  DYP-----QVRVDTFKGLLVDYLTRQNARIVLRGLRAVSDFENEFQLAQMNHTMNTQLET 116

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYD 171
           + +    S  Y++S++++ + +   DI  FVP  V   LK       + D
Sbjct: 117 LFMMTSVSYGYLSSSIVKEVAAWGGDIDDFVPPCVKDALKTKFPDAPRID 166


>gi|266623326|ref|ZP_06116261.1| pantetheine-phosphate adenylyltransferase [Clostridium hathewayi
           DSM 13479]
 gi|288864903|gb|EFC97201.1| pantetheine-phosphate adenylyltransferase [Clostridium hathewayi
           DSM 13479]
          Length = 161

 Score =  160 bits (405), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 58/167 (34%), Positives = 96/167 (57%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDP+T GH+DII ++    + L+I +  N+ KT  F S+QER  ++K+   
Sbjct: 1   MKTAVYPGSFDPVTLGHLDIIERSARMSDQLIIGVLNNNSKTPLF-SVQERVNMLKEITK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V +F GL ++  +D  A V++RGLR +TDF+YE+++   NR + PE+ T
Sbjct: 60  DLGNVE-----VKAFAGLLIDFVRDNQADVVIRGLRAVTDFEYELQLAQTNRVIAPEVDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           I L       Y++S++++ +   D DI++FVP  V   ++  +    
Sbjct: 115 IFLTTNLKYSYLSSSIVKEIAFYDGDISAFVPASVAECIRRKMADRK 161


>gi|323495236|ref|ZP_08100318.1| phosphopantetheine adenylyltransferase [Vibrio brasiliensis LMG
           20546]
 gi|323310496|gb|EGA63678.1| phosphopantetheine adenylyltransferase [Vibrio brasiliensis LMG
           20546]
          Length = 164

 Score =  160 bits (404), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 54/160 (33%), Positives = 89/160 (55%), Gaps = 6/160 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D+I +A    ++++IA+  +  K   F ++ ER    ++   H 
Sbjct: 8   RVIYPGTFDPITNGHLDLIERAADMFDEVIIAVAASPSKNTMF-TLDERVHFAQEVTKHL 66

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
              +S       F GL V+ AK   A V++RGLR   DF+YE  +T++ R L P + ++ 
Sbjct: 67  DNVTSK-----GFSGLMVDFAKQEQANVLIRGLRTTVDFEYEFGLTNMYRRLMPGLESVF 121

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L   E   +++ST++R +     D+T+FVP  V   LK  
Sbjct: 122 LTPAEEHAFISSTIVREVAIHGGDVTNFVPQVVAEALKEK 161


>gi|218885280|ref|YP_002434601.1| phosphopantetheine adenylyltransferase [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756234|gb|ACL07133.1| pantetheine-phosphate adenylyltransferase [Desulfovibrio vulgaris
           str. 'Miyazaki F']
          Length = 253

 Score =  160 bits (404), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 52/164 (31%), Positives = 88/164 (53%), Gaps = 6/164 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y G+FDP+TNGH+ +I +     +++V+A+  ++ KT  F S+ ER  + ++    
Sbjct: 10  RLAIYPGTFDPLTNGHVSLIRRGCQIFDNVVVAVAADTPKTPLF-SLDERVRMAEEVFAG 68

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               +     V  F GL V+  +   A VI+RGLR ++DF+YE ++  +NR L   I T+
Sbjct: 69  HPSIT-----VEPFTGLLVDYVERRGANVILRGLRAVSDFEYEFQLALMNRKLKRHIQTV 123

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            L       Y++ST+I+   S+  DI   VP+ +   L+     
Sbjct: 124 FLMTDYQWLYISSTIIKAAASLGGDIKGLVPENIYRKLREKYGY 167


>gi|153004927|ref|YP_001379252.1| pantetheine-phosphate adenylyltransferase [Anaeromyxobacter sp.
           Fw109-5]
 gi|166216054|sp|A7HC22|COAD_ANADF RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|152028500|gb|ABS26268.1| pantetheine-phosphate adenylyltransferase [Anaeromyxobacter sp.
           Fw109-5]
          Length = 165

 Score =  160 bits (404), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 52/162 (32%), Positives = 89/162 (54%), Gaps = 6/162 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y GSFDP+TNGH+ II + L   + L++A+  N  K+  F + +ER  LI +++ +
Sbjct: 4   RTAIYPGSFDPLTNGHLAIIQRGLKVFDRLIVAVANNPQKSPLF-TAEERKALISEAVGN 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     V SF  L V+  +      ++RGLR ++DF+YE ++ ++NR L PE   +
Sbjct: 63  DPRVE-----VDSFNALLVDYVRTKGVYTVIRGLRAVSDFEYEFQLANMNRKLLPEFEAV 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
            +   E   +V++ L+R + +   D+T  VP  V   L+  +
Sbjct: 118 FVMTGEDYFFVSAQLVREVATFGGDVTGLVPPNVAQELRRKL 159


>gi|238028674|ref|YP_002912905.1| phosphopantetheine adenylyltransferase [Burkholderia glumae BGR1]
 gi|237877868|gb|ACR30201.1| Phosphopantetheine adenylyltransferase [Burkholderia glumae BGR1]
          Length = 166

 Score =  160 bits (404), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 52/166 (31%), Positives = 96/166 (57%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F S++ER ++  + + 
Sbjct: 1   MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFF-SLEERLKIANEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V+ F GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPNVK-----VMGFTGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + +   +  ++++ T++R +  +  D++ FV   V  +L   V ++
Sbjct: 115 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVSAM 160


>gi|53802731|ref|YP_112606.1| pantetheine-phosphate adenylyltransferase [Methylococcus capsulatus
           str. Bath]
 gi|61212520|sp|Q60CN9|COAD_METCA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|53756492|gb|AAU90783.1| pantetheine-phosphate adenylyltransferase [Methylococcus capsulatus
           str. Bath]
          Length = 162

 Score =  160 bits (404), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 90/165 (54%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+Y G+FDPIT GH D++ +A    + +++A+  +  KT  F   + R  L ++++
Sbjct: 1   MNVTAIYPGTFDPITLGHADLVGRASRIFDRVILAVAESKAKTPLFDFGE-RLALAREAV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V+ F  L V+ A+   A VI+RGLR ++DF++E +M  +NR L PEI 
Sbjct: 60  AEMPNVE-----VVGFNSLLVDCARTHGATVILRGLRAVSDFEFEFQMAGMNRSLGPEIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           TI L   ES  +++S++IR +     D+++FVP  V   L     
Sbjct: 115 TIFLTPGESYAFLSSSVIREIAKFGGDVSAFVPGHVRAALMRKFA 159


>gi|258592144|emb|CBE68449.1| Phosphopantetheine adenylyltransferase (Pantetheine-phosphate
           adenylyltransferase) (PPAT) (Dephospho-CoA
           pyrophosphorylase) [NC10 bacterium 'Dutch sediment']
          Length = 161

 Score =  160 bits (404), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 60/167 (35%), Positives = 91/167 (54%), Gaps = 6/167 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AVY G+FDP T GH+DI  +A      +VIA+  N  K   F S+ ER  +I+ ++
Sbjct: 1   MTTLAVYAGTFDPFTVGHIDIARRARRLFSRVVIAVSTNPEKAALF-SLVERQRIIRDAV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     VS+ SF+GL V+      A+V++RGLR ++DF+YE +M  +NR L  EI 
Sbjct: 60  -----RDMRGVSIDSFDGLLVDYMHQRGARVVIRGLRALSDFEYEFQMALMNRKLNEEIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           T+ L   E   Y++S L++ +  +  D++ FV   V   LK  + S 
Sbjct: 115 TVFLMPHEQYSYLSSRLVKEVALLGGDVSQFVTPMVERMLKERISSR 161


>gi|254196836|ref|ZP_04903260.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei S13]
 gi|169653579|gb|EDS86272.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei S13]
          Length = 174

 Score =  160 bits (404), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 52/168 (30%), Positives = 96/168 (57%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F S++ER ++  + + 
Sbjct: 9   MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFF-SLEERLKIANEVLG 67

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V+ F GL  +  +   A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 68  HYPNVK-----VMGFTGLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 122

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + +   +  ++++ T++R +  +  D++ FV   V  +L   V ++ +
Sbjct: 123 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAMAQ 170


>gi|22298708|ref|NP_681955.1| phosphopantetheine adenylyltransferase [Thermosynechococcus
           elongatus BP-1]
 gi|29427715|sp|Q8DJQ7|COAD_THEEB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|22294889|dbj|BAC08717.1| phosphopantetheine adenylyltransferase [Thermosynechococcus
           elongatus BP-1]
          Length = 168

 Score =  160 bits (404), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 54/160 (33%), Positives = 90/160 (56%), Gaps = 6/160 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY GSFDPIT GH+DII +      ++++AI  N  K K   S+ +R + ++ +  H  
Sbjct: 3   AVYPGSFDPITLGHLDIIERGARLFSEVIVAIAHNPQK-KALFSVGQRIKQVQAATSHLK 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                 V V +F+GL V  A+   A+V++RGLR ++DF+YE++M+  N+ L PEI T+ L
Sbjct: 62  N-----VRVDTFDGLTVEYARSQRARVLLRGLRVLSDFEYELQMSHTNKSLWPEIETVFL 116

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
                  +++S+L++ +     ++   VP  V   L+   
Sbjct: 117 TTSNEYSFLSSSLVKEIARFGGNVRHLVPANVAKDLEACF 156


>gi|153949256|ref|YP_001399066.1| phosphopantetheine adenylyltransferase [Yersinia pseudotuberculosis
           IP 31758]
 gi|170026358|ref|YP_001722863.1| phosphopantetheine adenylyltransferase [Yersinia pseudotuberculosis
           YPIII]
 gi|186893396|ref|YP_001870508.1| phosphopantetheine adenylyltransferase [Yersinia pseudotuberculosis
           PB1/+]
 gi|167009049|sp|A7FCT8|COAD_YERP3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541056|sp|B2JYN7|COAD_YERPB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541057|sp|B1JQW9|COAD_YERPY RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|152960751|gb|ABS48212.1| pantetheine-phosphate adenylyltransferase [Yersinia
           pseudotuberculosis IP 31758]
 gi|169752892|gb|ACA70410.1| pantetheine-phosphate adenylyltransferase [Yersinia
           pseudotuberculosis YPIII]
 gi|186696422|gb|ACC87051.1| pantetheine-phosphate adenylyltransferase [Yersinia
           pseudotuberculosis PB1/+]
          Length = 159

 Score =  160 bits (404), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+ KA+Y G+FDPITNGH+D++ +A +    +++AI  +S K   F ++ ER  L K+  
Sbjct: 1   MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPMF-TLDERVALAKKVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V+ F  L    AK  +A ++VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  APLKNVE-----VLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E   +++S+L++ +     DIT F+P PV   L   + 
Sbjct: 115 SVFLMPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA 159


>gi|154504975|ref|ZP_02041713.1| hypothetical protein RUMGNA_02485 [Ruminococcus gnavus ATCC 29149]
 gi|153794858|gb|EDN77278.1| hypothetical protein RUMGNA_02485 [Ruminococcus gnavus ATCC 29149]
          Length = 163

 Score =  160 bits (404), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 56/168 (33%), Positives = 102/168 (60%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A+Y GSFDP+T GH+DII ++   V++LV+ +  N+ K   F S++ER ++++++  
Sbjct: 1   MLRAIYPGSFDPVTYGHLDIIRRSCKIVDELVVGVLNNNAKMPLF-SVEERVKMLEEATK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    V ++ F GL ++ A+ + A VI+RGLR +TDF+YE++M+  N  L P++ T
Sbjct: 60  DLTN-----VRIVPFHGLLIDFARQMDAFVIIRGLRAITDFEYELQMSQTNHKLEPDLET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + L       Y++ST +R + +   D++ FVP+ V   L+  + +  +
Sbjct: 115 MFLTTSIEYSYLSSTTVREIAAYGGDVSQFVPEAVAGELEAKMKAKRR 162


>gi|116626315|ref|YP_828471.1| pantetheine-phosphate adenylyltransferase [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116229477|gb|ABJ88186.1| pantetheine-phosphate adenylyltransferase [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 172

 Score =  160 bits (404), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 58/165 (35%), Positives = 101/165 (61%), Gaps = 6/165 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y GSFDPITNGH+D+I +     + L+++I  N  K   F S++ER+E++++ +  +
Sbjct: 9   IAIYPGSFDPITNGHLDLIQRGSRMFDRLIVSILRNDAKEPLF-SLEERTEMLREVLHVY 67

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V SF+GL V+ A   SA V++RG+R ++D++YE++M  +NR L P+I T+ 
Sbjct: 68  PNVE-----VDSFDGLLVDHAAARSATVLLRGIRAISDYEYELQMALMNRRLGPQIETVF 122

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + A E+  +++S LI+ + S+  +IT  VP  V + L+  +    
Sbjct: 123 MMAHEAYSFISSRLIKEVFSLGGNITGLVPPSVEIRLQARLSRNK 167


>gi|124514748|gb|EAY56260.1| phosphopantetheine adenylyltransferase [Leptospirillum rubarum]
 gi|206602457|gb|EDZ38938.1| Phosphopantetheine adenylyltransferase [Leptospirillum sp. Group II
           '5-way CG']
          Length = 166

 Score =  160 bits (404), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 62/163 (38%), Positives = 98/163 (60%), Gaps = 5/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
            +KAVY G+FDP+T GH+D++ +AL+  ++++IA+  N  K+  F S++ER ELI+Q   
Sbjct: 3   KKKAVYPGTFDPVTFGHLDMLNRALTIFDEILIAVAENPRKSPLF-SLEERIELIRQVAP 61

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
              P     V V+ F  L V+  +  + QVI+RG+R ++DFDYE+RM  +N+ L  +I T
Sbjct: 62  APPP----AVQVVGFHSLLVDFVRKNNCQVILRGVRAVSDFDYELRMALINQTLARDIET 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L   E   ++TST+IR +  +  D+   VP  V   LK   
Sbjct: 118 VFLMPSEKYMFITSTMIREISELGGDLAMLVPPTVEEALKKKF 160


>gi|254449089|ref|ZP_05062541.1| pantetheine-phosphate adenylyltransferase [gamma proteobacterium
           HTCC5015]
 gi|198261281|gb|EDY85574.1| pantetheine-phosphate adenylyltransferase [gamma proteobacterium
           HTCC5015]
          Length = 161

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 62/165 (37%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+Y GSFDPITNGH D++ +A    + ++ AIG NS K   F S++ER  L +Q +
Sbjct: 1   MSSIAIYPGSFDPITNGHADLVRRACQVFDKVIFAIGVNSKKQPLF-SLEERVALAQQVL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F         V+SF+ L V+ A ++ AQVIVRGLR ++D+++E+++ S NR L  +I 
Sbjct: 60  ADFPNVE-----VMSFDNLMVDFAAEVGAQVIVRGLRAVSDYEFELQLASTNRRLNNQID 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T+ L   E   +V+STL++ +     D++SF    V   L   + 
Sbjct: 115 TVFLTPSEEHSFVSSTLVKEVARHRGDVSSFCHPVVEKALVERLA 159


>gi|254420338|ref|ZP_05034062.1| pantetheine-phosphate adenylyltransferase [Brevundimonas sp. BAL3]
 gi|196186515|gb|EDX81491.1| pantetheine-phosphate adenylyltransferase [Brevundimonas sp. BAL3]
          Length = 162

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 55/166 (33%), Positives = 96/166 (57%), Gaps = 5/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+TNGH DII +AL  V+ +VI +  N  K   F + + R E+++  + 
Sbjct: 1   MRIGLYPGTFDPVTNGHTDIIKRALKLVDRVVIGVAQNDDKGPLFTTAE-RVEMLQAEVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           +        + V  F  L ++ A++++A VI+RGLR + DF+YE +MT++N+ L  +I T
Sbjct: 60  NL----GGDIVVQPFSTLLMHFAEELNANVIIRGLRAVADFEYEFQMTAMNQRLNQDIET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + L A    + + S L++ +  +D  I SFV   +   +++ V + 
Sbjct: 116 VFLMADPRHQAIASRLVKEIARLDGAIDSFVSPAIAARVRDKVKNR 161


>gi|87120922|ref|ZP_01076814.1| phosphopantetheine adenylyltransferase [Marinomonas sp. MED121]
 gi|86163760|gb|EAQ65033.1| phosphopantetheine adenylyltransferase [Marinomonas sp. MED121]
          Length = 171

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 54/168 (32%), Positives = 88/168 (52%), Gaps = 6/168 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AVY G+FDPITNGH D++ +A      +V+A+  +  K         R  L +  +
Sbjct: 4   MSAIAVYPGTFDPITNGHADLVERAARLFSKVVVAVAASPKKRPVL-DHDVRIALARNVL 62

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F+ L     + ++ QV+VRGLR ++DF+YE ++ ++NR + P++ 
Sbjct: 63  GHLPNVE-----VVGFDNLLTEFTRSVNGQVVVRGLRAVSDFEYEFQLANMNRVIAPDVE 117

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           ++ L   E   Y++STL+R + S+  D   FV   V   LK   +SL 
Sbjct: 118 SLFLTPSEKHSYISSTLVREIASLGGDFGLFVHPEVESVLKARYLSLK 165


>gi|168214205|ref|ZP_02639830.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           CPE str. F4969]
 gi|170714275|gb|EDT26457.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           CPE str. F4969]
          Length = 164

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 62/167 (37%), Positives = 98/167 (58%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY GSFDPIT GH+D+I +A S  + +++A+  N  K   F SI+ER  LI++ + 
Sbjct: 1   MRVGVYPGSFDPITKGHLDLIERAASKFDKVIVAVLININKKGMF-SIEERVNLIEKCVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +         V SF GL ++  +   A VI++GLR +TDF+YE +M  +NR L  E+ T
Sbjct: 60  KYNNVE-----VKSFNGLLIDFVRKEKADVIIKGLRSVTDFEYEFQMALMNRELANEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           I +    +  Y++S+ I+ + S + +I +FVP  +   L+  +ISL 
Sbjct: 115 IFMVTSPNYSYISSSAIKQIASFNGEIKNFVPKEIVEDLEERIISLR 161


>gi|319786797|ref|YP_004146272.1| pantetheine-phosphate adenylyltransferase [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465309|gb|ADV27041.1| pantetheine-phosphate adenylyltransferase [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 166

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 50/152 (32%), Positives = 89/152 (58%), Gaps = 6/152 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +++ +  +  K     S++ R +L ++++  
Sbjct: 5   RIAVYPGTFDPITNGHIDLVDRAAPLFEKVIVGVAASQAKGPTL-SLELRVKLAREALAG 63

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     V  F+ L  +  +D+ A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 64  HPNVE-----VRGFDSLLAHFVRDVGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 118

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPD 154
            L   E   +++S+L+R +  +  D++ FV  
Sbjct: 119 FLTPAEQYSFISSSLVREIARLGGDVSGFVTP 150


>gi|51594408|ref|YP_068599.1| phosphopantetheine adenylyltransferase [Yersinia pseudotuberculosis
           IP 32953]
 gi|61212549|sp|Q66GD2|COAD_YERPS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|51587690|emb|CAH19290.1| phosphopantetheine adenylyltransferase [Yersinia pseudotuberculosis
           IP 32953]
          Length = 159

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+ KA+Y G+FDPITNGH+D++ +A +    +++AI  +S K   F ++ ER  L K+  
Sbjct: 1   MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPMF-TLDERVALAKKVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V+ F  L    AK  +A ++VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  ALLKNVE-----VLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E   +++S+L++ +     DIT F+P PV   L   + 
Sbjct: 115 SVFLMPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA 159


>gi|27379804|ref|NP_771333.1| phosphopantetheine adenylyltransferase [Bradyrhizobium japonicum
           USDA 110]
 gi|31563017|sp|Q89L55|COAD_BRAJA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|27352957|dbj|BAC49958.1| phosphopantetheine adenylyltransferase [Bradyrhizobium japonicum
           USDA 110]
          Length = 165

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 60/165 (36%), Positives = 95/165 (57%), Gaps = 1/165 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A Y GSFDPITNGH+D++  A+   + LV+AIG +  K   F S +ER  +++   
Sbjct: 1   MPRIAFYPGSFDPITNGHLDVVRHAVPLCDRLVVAIGVHPGKKPLF-STEERLRMLEDVC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +   +  ++F+ L+V  A+   A +++RGLRD TD DYEM++  +N  + PE+ 
Sbjct: 60  GPVATQAGCVLEAVTFDDLSVTAARKHGATIMIRGLRDGTDLDYEMQLAGMNEAMAPEVH 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T+ L A    R +T+TL+R +  +  D+++FVP  V   LK    
Sbjct: 120 TVFLPASPMVRPITATLVRQIAGMGGDVSTFVPPLVASLLKAKFA 164


>gi|171320169|ref|ZP_02909231.1| pantetheine-phosphate adenylyltransferase [Burkholderia ambifaria
           MEX-5]
 gi|171094583|gb|EDT39635.1| pantetheine-phosphate adenylyltransferase [Burkholderia ambifaria
           MEX-5]
          Length = 165

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 52/166 (31%), Positives = 97/166 (58%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F S++ER ++  + + 
Sbjct: 1   MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFF-SLEERLKIANEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V+ F+GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPNVK-----VMGFKGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + +   +  ++++ T++R +  +  D++ FV   V  +L   V ++
Sbjct: 115 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVDAM 160


>gi|328543839|ref|YP_004303948.1| Phosphopantetheine adenylyltransferase [Polymorphum gilvum
           SL003B-26A1]
 gi|326413583|gb|ADZ70646.1| Phosphopantetheine adenylyltransferase [Polymorphum gilvum
           SL003B-26A1]
          Length = 168

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 70/168 (41%), Positives = 103/168 (61%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+R A+Y GSFDP+TNGH+DI+ Q+L+  + +V+AIG +  K+  F   +    +   + 
Sbjct: 1   MIRTALYPGSFDPVTNGHLDILHQSLALADRVVVAIGIHPGKSPMFGFEERVEMIHASAR 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F    S R+SVISF+ L V  A+ + A+ +VRGLRD TD DYEM+M  +N  L P+I 
Sbjct: 61  DAFGEADSERISVISFDNLVVETARRLGARYLVRGLRDGTDLDYEMQMAGMNATLAPDIR 120

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           T+ + A    R++T+TL+R +  +  DIT+FVP PV   LK     L 
Sbjct: 121 TVFMPASPEVRHITATLVRQIAKMGGDITAFVPGPVAGRLKARAQGLE 168


>gi|327441175|dbj|BAK17540.1| phosphopantetheine adenylyltransferase [Solibacillus silvestris
           StLB046]
          Length = 161

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 57/164 (34%), Positives = 93/164 (56%), Gaps = 6/164 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + AV  GSFDPITNGH+DII +A    + + +A+  NS K   F SI+ER+ LIK+    
Sbjct: 4   KIAVVPGSFDPITNGHIDIIRRAADVFDTVYVAVLNNSSKKPLF-SIEERTALIKEVTKD 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     + +  GL ++ A++  A+ IVRGLR ++DF+YEM++TS+NR L   I T 
Sbjct: 63  LPNI-----RIETSSGLLIDYAREKKAKAIVRGLRAVSDFEYEMQITSMNRVLDENIETF 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            + +K    +++S++++ +     +++  VP  V   LK     
Sbjct: 118 FIMSKNQYSFLSSSIVKEVAKYGGNVSELVPAIVEQALKEKFAK 161


>gi|253997115|ref|YP_003049179.1| pantetheine-phosphate adenylyltransferase [Methylotenera mobilis
           JLW8]
 gi|253983794|gb|ACT48652.1| pantetheine-phosphate adenylyltransferase [Methylotenera mobilis
           JLW8]
          Length = 166

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 51/164 (31%), Positives = 91/164 (55%), Gaps = 6/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
            R AVY G+FDPIT GH D++ +A    +++V+A+  ++ K+  F   +      + ++ 
Sbjct: 6   KRIAVYPGTFDPITLGHEDLVRRAAYLFDEVVVAVAGSTSKSTLFNLEE------RVALA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +  S + V V+ F GL +   +D SAQV++RGLR  +DF+YE ++  +NR L P++ T
Sbjct: 60  QDLFTSYDNVKVVGFSGLLMQFVQDQSAQVVIRGLRAASDFEYEFQLAGMNRKLYPKLET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L   E   +V+S+L+R +  +   +  FV   V   +   + 
Sbjct: 120 LFLTPSEQYMFVSSSLVREVAKLGGAVDQFVSKSVEDAIVKKLK 163


>gi|167561481|ref|ZP_02354397.1| phosphopantetheine adenylyltransferase [Burkholderia oklahomensis
           EO147]
 gi|167568711|ref|ZP_02361585.1| phosphopantetheine adenylyltransferase [Burkholderia oklahomensis
           C6786]
          Length = 166

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 52/168 (30%), Positives = 96/168 (57%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F S++ER ++  + + 
Sbjct: 1   MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFF-SLEERLKIANEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V+ F GL  +  +   A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPNVK-----VMGFTGLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + +   +  ++++ T++R +  +  D++ FV   V  +L   V ++ +
Sbjct: 115 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVSAMAQ 162


>gi|291278591|ref|YP_003495426.1| phosphopantetheine adenylyltransferase [Deferribacter desulfuricans
           SSM1]
 gi|290753293|dbj|BAI79670.1| phosphopantetheine adenylyltransferase [Deferribacter desulfuricans
           SSM1]
          Length = 162

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 94/167 (56%), Gaps = 6/167 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y G+FDP+TNGH+DII +     + L++A+  +  K   F  + +R  +I++S+ H 
Sbjct: 2   IAIYPGTFDPLTNGHLDIIERGAKMFDRLIVAVAESKRKKPLF-DLNDRVTMIEESVLHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V SF  L V+  K+ +A VI+RGLR ++DF+YE+++  +NR L     T+ 
Sbjct: 61  PNVE-----VESFSNLLVDFMKEKNADVILRGLRVVSDFEYELQLALMNRKLNANCETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKY 170
           L   +   +++S+++R +  +  D++ FVP PV  F+   +    + 
Sbjct: 116 LMPNKKYIFLSSSMVREIALLGGDVSCFVPKPVNDFILRKINDKGRT 162


>gi|325263995|ref|ZP_08130728.1| pantetheine-phosphate adenylyltransferase [Clostridium sp. D5]
 gi|324031033|gb|EGB92315.1| pantetheine-phosphate adenylyltransferase [Clostridium sp. D5]
          Length = 163

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 51/168 (30%), Positives = 96/168 (57%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A+Y GSFDP+T GH+D+I ++   V++L++ +  N+ K   F S +ER +++++   
Sbjct: 1   MLRAIYPGSFDPVTYGHLDVIKRSCKIVDELIVGVLNNNAKMPLF-SAEERVKMLEEVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                         F+GL ++ A+   A +++RGLR +TDF+YE++M+  N  L P + T
Sbjct: 60  DLTNVKIVL-----FQGLLIDFARQQGADLVIRGLRAITDFEYELQMSQTNHKLEPSVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + L       Y++ST ++ + +   DI+ FVP+ V   L+  + +  +
Sbjct: 115 MFLTTSIEYSYLSSTTVKEIAAFGGDISQFVPEAVSEELEKKMKAKRR 162


>gi|262198142|ref|YP_003269351.1| pantetheine-phosphate adenylyltransferase [Haliangium ochraceum DSM
           14365]
 gi|262081489|gb|ACY17458.1| pantetheine-phosphate adenylyltransferase [Haliangium ochraceum DSM
           14365]
          Length = 170

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 55/164 (33%), Positives = 86/164 (52%), Gaps = 5/164 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
             AVY G+FDP+TNGH+DI+ ++L+  + +++A+  N  K   F S+ ER   I+  +  
Sbjct: 7   TIAVYPGTFDPVTNGHLDILERSLALFDRVIVALAENVRKEPVF-SVSERVAFIEGGVGE 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                S        +GL V   K + A+ IVRGLR + DF+YE +   +NR L P + T+
Sbjct: 66  HGGKLSFDAF----DGLLVEYCKRVGARFIVRGLRALADFEYEFQFAHMNRRLAPGLDTV 121

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
                E + YV+S+L++ +     DIT  VP  V   L     +
Sbjct: 122 FFMTDERNHYVSSSLVKEVARFGGDITGLVPPQVAEALAAKYSN 165


>gi|322514989|ref|ZP_08068001.1| pantetheine-phosphate adenylyltransferase [Actinobacillus ureae
           ATCC 25976]
 gi|322119042|gb|EFX91206.1| pantetheine-phosphate adenylyltransferase [Actinobacillus ureae
           ATCC 25976]
          Length = 158

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 57/163 (34%), Positives = 88/163 (53%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M    +Y G+FDPITNGH+DII +A     ++++A+  N  K   F S++ER+ L+KQS 
Sbjct: 1   MSYTVIYAGTFDPITNGHLDIIERAAKLFGNVIVAVAKNPSKQPLF-SLEERTLLVKQSC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V  + F GL  + A    A+ ++RG+R   D +YE+++  +N  L   + 
Sbjct: 60  VHLSN-----VQAVGFSGLLADFAVQHQAKALIRGIRGSDDIEYEIQLAQLNEQLEEGLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           TI L      RY++ST++R +     D+T FVP  V   LK  
Sbjct: 115 TIFLPPAVQWRYLSSTMVREIYRHQGDVTQFVPPFVLNALKEK 157


>gi|284055782|pdb|3L92|A Chain A, Phosphopantetheine Adenylyltransferase From Yersinia
           Pestis Complexed With Coenzyme A.
 gi|284055783|pdb|3L93|A Chain A, Phosphopantetheine Adenylyltransferase From Yersinia
           Pestis
          Length = 162

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+ KA+Y G+FDPITNGH+D++ +A +    +++AI  +S K   F ++ ER  L K+  
Sbjct: 4   MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPMF-TLDERVALAKKVT 62

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V+ F  L    AK  +A ++VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 63  APLKNVE-----VLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLE 117

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E   +++S+L++ +     DIT F+P PV   L   + 
Sbjct: 118 SVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA 162


>gi|107023740|ref|YP_622067.1| phosphopantetheine adenylyltransferase [Burkholderia cenocepacia AU
           1054]
 gi|116690827|ref|YP_836450.1| phosphopantetheine adenylyltransferase [Burkholderia cenocepacia
           HI2424]
 gi|170734152|ref|YP_001766099.1| phosphopantetheine adenylyltransferase [Burkholderia cenocepacia
           MC0-3]
 gi|206559192|ref|YP_002229952.1| phosphopantetheine adenylyltransferase [Burkholderia cenocepacia
           J2315]
 gi|254247172|ref|ZP_04940493.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related
           [Burkholderia cenocepacia PC184]
 gi|123244640|sp|Q1BTG1|COAD_BURCA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216063|sp|A0KAN0|COAD_BURCH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229488123|sp|B1JYQ4|COAD_BURCC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229488124|sp|B4EAQ8|COAD_BURCJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|105893929|gb|ABF77094.1| Coenzyme A biosynthesis protein [Burkholderia cenocepacia AU 1054]
 gi|116648916|gb|ABK09557.1| pantetheine-phosphate adenylyltransferase [Burkholderia cenocepacia
           HI2424]
 gi|124871948|gb|EAY63664.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related
           [Burkholderia cenocepacia PC184]
 gi|169817394|gb|ACA91977.1| pantetheine-phosphate adenylyltransferase [Burkholderia cenocepacia
           MC0-3]
 gi|198035229|emb|CAR51103.1| phosphopantetheine adenylyltransferase [Burkholderia cenocepacia
           J2315]
          Length = 165

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 96/166 (57%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A S  + LV+ +  +  K   F S++ER  +  + + 
Sbjct: 1   MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFF-SLEERLTIANEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V+SF GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPNVK-----VMSFTGLLKDFVRVNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + +   +  ++++ T++R +  +  D++ FV   V  +L   V ++
Sbjct: 115 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVTAM 160


>gi|56551750|ref|YP_162589.1| pantetheine-phosphate adenylyltransferase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|260752678|ref|YP_003225571.1| pantetheine-phosphate adenylyltransferase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|8469198|sp|Q9RME4|COAD_ZYMMO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|6466228|gb|AAF12844.1|AF203881_17 lipopolysaccharide core biosynthesis protein [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|56543324|gb|AAV89478.1| pantetheine-phosphate adenylyltransferase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|258552041|gb|ACV74987.1| pantetheine-phosphate adenylyltransferase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 178

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 90/165 (54%), Gaps = 1/165 (0%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y G+FDP+T GH+DII +     + L+IA+  N  K+  F S + R+ +I+  I   
Sbjct: 11  IALYPGTFDPVTLGHLDIIRRGARIFDHLIIAVAENPGKSPLFSSEE-RASMIRHEISRL 69

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
              + +R+ VI +  L ++  +   A VI+RGLR + DF+YE +M  +N+ +  +I T+ 
Sbjct: 70  ENPTKSRIEVIIYNSLLMDCVESQGASVILRGLRAVADFEYEYQMAGMNQQINNKIETVF 129

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           L A    + V S L++ +   + +IT FVP  V   L+  V    
Sbjct: 130 LMADSVLQPVASRLVKEIAFYNGNITPFVPPYVVQKLQEAVTRKK 174


>gi|241766315|ref|ZP_04764204.1| pantetheine-phosphate adenylyltransferase [Acidovorax delafieldii
           2AN]
 gi|241363548|gb|EER58987.1| pantetheine-phosphate adenylyltransferase [Acidovorax delafieldii
           2AN]
          Length = 166

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 53/164 (32%), Positives = 91/164 (55%), Gaps = 6/164 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDPIT GH D++ +A    E +++A+     K   F S++ER E+++ ++  + 
Sbjct: 7   AVYPGTFDPITLGHEDVVRRATQLFERVIVAVAAGHHKKTLF-SLEERIEMVRDAVRQYP 65

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                +V V SF GL  +       + +VRGLR +TDFDYE ++  +NR L PE+ T+ L
Sbjct: 66  -----QVQVESFSGLLRDFVVARGGKAMVRGLRAVTDFDYEFQLAGMNRSLMPEVETVFL 120

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
              +  ++++ST +R +  +  ++  FV   V   L   V ++ 
Sbjct: 121 TPSDKYQFISSTFVREIAVLGGEVHKFVSPEVQQRLAAKVEAMA 164


>gi|312127710|ref|YP_003992584.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           hydrothermalis 108]
 gi|312135043|ref|YP_004002381.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           owensensis OL]
 gi|312793406|ref|YP_004026329.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312877019|ref|ZP_07736992.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311775094|gb|ADQ04581.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           owensensis OL]
 gi|311777729|gb|ADQ07215.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311796160|gb|EFR12516.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|312180546|gb|ADQ40716.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 168

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 57/156 (36%), Positives = 92/156 (58%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  VY GSFDP+TNGH+DII +A    + L++A+  N  KT  F  I+ER EL+K++  
Sbjct: 1   MKIGVYPGSFDPVTNGHLDIIERASKIFDKLIVAVLVNPNKTPVF-DIEERVELLKETTE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V +F+GL ++  K  +A+VIV+GLR ++DF+YE +M  +N+ L P I T
Sbjct: 60  HLPNVE-----VKAFKGLLIDFMKQENAKVIVKGLRAVSDFEYEFQMALLNKKLEPSIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I +       Y++S++++ +      I   VP+ + 
Sbjct: 115 IFMMTNSKYSYLSSSMVKEVARFGGCIEDLVPEKIA 150


>gi|239928709|ref|ZP_04685662.1| phosphopantetheine adenylyltransferase [Streptomyces ghanaensis
           ATCC 14672]
 gi|291437033|ref|ZP_06576423.1| phosphopantetheine adenylyltransferase [Streptomyces ghanaensis
           ATCC 14672]
 gi|291339928|gb|EFE66884.1| phosphopantetheine adenylyltransferase [Streptomyces ghanaensis
           ATCC 14672]
          Length = 159

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 93/165 (56%), Gaps = 7/165 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GSFDPITNGH+DII +A    +++ +A+  N  K   F  I+ER +LI++   
Sbjct: 1   MRRAVCPGSFDPITNGHLDIIARASRLYDEVYVAVMINQSKKGLFE-IEERIDLIRRVTS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +       V V +F GL V+  K+     IV+GLR ++DFDYE++M  +N  L   + T
Sbjct: 60  EYGN-----VRVEAFHGLLVDFCKERDIPAIVKGLRAVSDFDYELQMAQMNNGLS-GVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + +    +  +++S+L++ + +   D++  VP+ V   L   +  
Sbjct: 114 LFVPTNPTYSFLSSSLVKEVAAWGGDVSHLVPEEVLAALTERLRR 158


>gi|317485390|ref|ZP_07944269.1| pantetheine-phosphate adenylyltransferase [Bilophila wadsworthia
           3_1_6]
 gi|316923349|gb|EFV44556.1| pantetheine-phosphate adenylyltransferase [Bilophila wadsworthia
           3_1_6]
          Length = 198

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 51/163 (31%), Positives = 92/163 (56%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
            R A+Y G+FDP+TNGH +II + L   +++++A+  ++ K+  F S++ER  + ++   
Sbjct: 5   KRVAIYPGTFDPLTNGHANIIRRGLRMFDNIIVAVAADTGKSPLF-SLEERVAMAEKVFA 63

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                S     V  F+GL V      +   ++RGLR ++DF+YE ++  +NR L P+I T
Sbjct: 64  KEPNIS-----VEPFQGLLVEYVARRNVHTVLRGLRAVSDFEYEFQIALMNRKLRPDIET 118

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L +     Y++ST+++ + S+  D+   VPD V   L+   
Sbjct: 119 LFLISDYRWLYISSTIVKTVASLGGDVRGLVPDHVLSCLRERF 161


>gi|312143897|ref|YP_003995343.1| pantetheine-phosphate adenylyltransferase [Halanaerobium sp.
           'sapolanicus']
 gi|311904548|gb|ADQ14989.1| pantetheine-phosphate adenylyltransferase [Halanaerobium sp.
           'sapolanicus']
          Length = 163

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 56/164 (34%), Positives = 88/164 (53%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+ K VY GSFDP+TNGH+DI+ +A +  + +V+A+  N  K   F S++ER +++  + 
Sbjct: 1   MINKVVYPGSFDPVTNGHLDIVERAANMFDQVVVAVFFNPNKEPIF-SMEERVKMLDLAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +     V SF GL       I    I+RGLR ++DF+ E +M S+N+ L  +I 
Sbjct: 60  ESLDNVT-----VDSFSGLTTKYVHSIGGGAILRGLRAVSDFEGEFQMASMNKHLDEDIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           TI L       +++S++I+     D DI   VP  V   LK  +
Sbjct: 115 TIFLMTDTKYAFLSSSVIKEAAYFDGDIKELVPKFVYKKLKERI 158


>gi|29653640|ref|NP_819332.1| phosphopantetheine adenylyltransferase [Coxiella burnetii RSA 493]
 gi|153208656|ref|ZP_01946908.1| pantetheine-phosphate adenylyltransferase [Coxiella burnetii 'MSU
           Goat Q177']
 gi|154706702|ref|YP_001425125.1| phosphopantetheine adenylyltransferase [Coxiella burnetii Dugway
           5J108-111]
 gi|161830002|ref|YP_001596238.1| phosphopantetheine adenylyltransferase [Coxiella burnetii RSA 331]
 gi|165919777|ref|ZP_02219520.1| pantetheine-phosphate adenylyltransferase [Coxiella burnetii RSA
           334]
 gi|212213203|ref|YP_002304139.1| phosphopantetheine adenylyltransferase [Coxiella burnetii
           CbuG_Q212]
 gi|212218123|ref|YP_002304910.1| phosphopantetheine adenylyltransferase [Coxiella burnetii
           CbuK_Q154]
 gi|61212752|sp|Q83EM7|COAD_COXBU RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|189082564|sp|A9KCX4|COAD_COXBN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|189082565|sp|A9NB23|COAD_COXBR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226709001|sp|B6J5S3|COAD_COXB1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229488135|sp|B6J216|COAD_COXB2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|29540902|gb|AAO89846.1| phosphopantetheine adenylyltransferase [Coxiella burnetii RSA 493]
 gi|120575842|gb|EAX32466.1| pantetheine-phosphate adenylyltransferase [Coxiella burnetii 'MSU
           Goat Q177']
 gi|154355988|gb|ABS77450.1| phosphopantetheine adenylyltransferase [Coxiella burnetii Dugway
           5J108-111]
 gi|161761869|gb|ABX77511.1| pantetheine-phosphate adenylyltransferase [Coxiella burnetii RSA
           331]
 gi|165916860|gb|EDR35464.1| pantetheine-phosphate adenylyltransferase [Coxiella burnetii RSA
           334]
 gi|212011613|gb|ACJ18994.1| phosphopantetheine adenylyltransferase [Coxiella burnetii
           CbuG_Q212]
 gi|212012385|gb|ACJ19765.1| phosphopantetheine adenylyltransferase [Coxiella burnetii
           CbuK_Q154]
          Length = 159

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 62/163 (38%), Positives = 93/163 (57%), Gaps = 7/163 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+Y G+FDP+TNGH+DII +AL     +++A    S K      ++ER  LI   +
Sbjct: 1   MKPIAIYPGTFDPLTNGHVDIIERALPLFNKIIVACAPTSRKDPHLK-LEERVNLIADVL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +  RV V+   GL V+ AK   A  I+RGLR ++DFDYE ++  +N  L PEI 
Sbjct: 60  ------TDERVEVLPLTGLLVDFAKTHQANFILRGLRAVSDFDYEFQLAHMNYQLSPEIE 113

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           TI L A+E   YV+ T++R ++++  D++ FVP  V   L+  
Sbjct: 114 TIFLPAREGYSYVSGTMVREIVTLGGDVSPFVPPLVARHLQKR 156


>gi|45644627|gb|AAS73015.1| predicted phosphopantetheine adenylyltransferase [uncultured marine
           gamma proteobacterium EBAC20E09]
          Length = 160

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 65/165 (39%), Positives = 98/165 (59%), Gaps = 5/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDPIT GHMDII +A    + ++IA+  +  K   F ++++R +L K    
Sbjct: 1   MRVAIYPGSFDPITYGHMDIIDRASGLFDKIIIAVAKSEAKKPLF-TLEDRMKLAKT--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               D+     V     L V++AK+ SA  I+RGLR ++DF+YE ++ ++NR L P+I +
Sbjct: 57  -IYGDNEKVDVVGFPRQLTVDVAKEHSACAIIRGLRAVSDFEYEFQLATMNRSLAPDIES 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           I L  KES  YV+S+LI+ +  +  DI+ FV   V   LK  + S
Sbjct: 116 IFLTPKESLIYVSSSLIKEICDLKGDISKFVHPSVEQALKAKLGS 160


>gi|15615152|ref|NP_243455.1| lipopolysaccharide core biosynthesis [Bacillus halodurans C-125]
 gi|14194521|sp|Q9K9Q6|COAD_BACHD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|10175210|dbj|BAB06308.1| pantetheine-phosphate adenylyltransferase [Bacillus halodurans
           C-125]
          Length = 165

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 56/166 (33%), Positives = 96/166 (57%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDP+T GH+DII +  +  +++++A+  N  K   F S++ER EL+K++ 
Sbjct: 1   MTSIAVCPGSFDPVTLGHLDIIQRGANVFDEVIVAVLHNRNKVPLF-SVEERLELLKKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H    +     + SF GL ++  K   A+ I+RGLR ++DF+YEM+  S+N+ L P++ 
Sbjct: 60  EHIPNVT-----IDSFNGLLIDYVKQKQAKAIIRGLRAVSDFEYEMQAASINKKLGPDVE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T  +       Y++S++++ +   +AD++  VP  V   LK    S
Sbjct: 115 TFFMMTSNQYSYLSSSIVKEVAKYEADVSDIVPPVVAEALKAKFSS 160


>gi|89099579|ref|ZP_01172454.1| phosphopantetheine adenylyltransferase [Bacillus sp. NRRL B-14911]
 gi|89085732|gb|EAR64858.1| phosphopantetheine adenylyltransferase [Bacillus sp. NRRL B-14911]
          Length = 164

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 60/165 (36%), Positives = 89/165 (53%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDPIT GH+DII +A    + + + +  NS K   F S+ ER  LI +  
Sbjct: 3   MASIAVCPGSFDPITYGHLDIIKRASKVFDQIHVVLLNNSSKNPLF-SVDERISLISEVT 61

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F         V SF+GL V+ AK + A  I+RGLR ++DF+YEM++TS+NR L  EI 
Sbjct: 62  REFPNVK-----VDSFQGLLVDYAKGVGASAIIRGLRAVSDFEYEMQITSMNRVLNEEIE 116

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T  +       +++S++++ +     DI+  VP+ V   L     
Sbjct: 117 TFFMMTNNQFSFLSSSIVKEVAKYGGDISELVPEAVQKALSGKFS 161


>gi|56476193|ref|YP_157782.1| coenzyme A biosynthesis protein: phosphopantetheine
           adenylylyltransferase [Aromatoleum aromaticum EbN1]
 gi|81598946|sp|Q5P730|COAD_AZOSE RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|56312236|emb|CAI06881.1| Coenzyme A biosynthesis protein: phosphopantetheine
           adenylylyltransferase [Aromatoleum aromaticum EbN1]
          Length = 163

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 50/166 (30%), Positives = 90/166 (54%), Gaps = 8/166 (4%)

Query: 2   MR--KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           M+   A+Y G+FDP T GH D++ +A      +V+A+  +  K   F ++ ER E+ +  
Sbjct: 1   MKEGVAIYPGTFDPFTRGHEDLVRRASLLFNKVVVAVAESHGKAPIF-TLAERVEIARDV 59

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           +  F         V  F+GL ++  +   A++I+RGLR ++DF+YE +M  +NR L P++
Sbjct: 60  LAPFPNVE-----VTGFDGLLMDFLRQRDARLILRGLRAVSDFEYEFQMAGMNRKLFPDV 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
            T+ L   E   ++++T++R +  +  D++ FV   V   L   V 
Sbjct: 115 ETVFLTPAEEYMFISATMVREIARLGGDVSKFVQPAVNERLLQKVS 160


>gi|317121772|ref|YP_004101775.1| phosphopantetheine adenylyltransferase [Thermaerobacter marianensis
           DSM 12885]
 gi|315591752|gb|ADU51048.1| Phosphopantetheine adenylyltransferase [Thermaerobacter marianensis
           DSM 12885]
          Length = 163

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 54/155 (34%), Positives = 91/155 (58%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+  GSFDPITNGH+DII +A    + +++ +  NS K   F + +ER EL +Q+  
Sbjct: 1   MTIALCPGSFDPITNGHLDIIERASRLFDRVLVTVFVNSSKQPWF-TPEERVELARQATA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H    +     V +++GL V  A+   A+VIV+GLR ++DF+YE +M  +N+ L  E+ T
Sbjct: 60  HLPNVT-----VDAYDGLLVEYARRHGARVIVKGLRAISDFEYEFQMAQINKHLAGELET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + +  +  + Y++S++++ L     D    VP+ V
Sbjct: 115 LFMMTRPENAYLSSSIVKELARYGVDPAGLVPEVV 149


>gi|171464204|ref|YP_001798317.1| pantetheine-phosphate adenylyltransferase [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|229500852|sp|B1XS68|COAD_POLNS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|171193742|gb|ACB44703.1| pantetheine-phosphate adenylyltransferase [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 165

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 98/165 (59%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP T GH D++ +A S  ++L++ +  +  K   F +++ER ++ K+ + 
Sbjct: 1   MTVAVYPGTFDPFTRGHEDLVRRASSIFKELIVGVADSRSKHPFF-TLEERIDIAKEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           ++         V+ F GL  + A++ +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  YYPNVK-----VVGFSGLLKDFAREHNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   +  ++++ T +R + S+  D++ FV   V  +L   + S
Sbjct: 115 LFLTPSDQYQFISGTFVREIASMGGDVSKFVFPSVEKWLVKKIAS 159


>gi|296100498|ref|YP_003610644.1| phosphopantetheine adenylyltransferase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295054957|gb|ADF59695.1| phosphopantetheine adenylyltransferase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 159

 Score =  159 bits (402), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 92/165 (55%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPITNGH+DII +A    + +++AI  +  K   F  + ER  L  ++I
Sbjct: 1   MSTKAIYPGTFDPITNGHLDIITRAACMFDKVILAIAASPSKKPMF-DLNERVALATEAI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A+   A +++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHLPNVE-----VVGFSDLMANFARAQQATILIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++STL++ +     D+T F+P  V   L + + 
Sbjct: 115 SVFLMPSKEWSFISSTLVKEVARHHGDVTHFLPVNVHQALMDKLK 159


>gi|229541220|ref|ZP_04430280.1| pantetheine-phosphate adenylyltransferase [Bacillus coagulans 36D1]
 gi|229325640|gb|EEN91315.1| pantetheine-phosphate adenylyltransferase [Bacillus coagulans 36D1]
          Length = 161

 Score =  159 bits (402), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 87/165 (52%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+  GSFDPITNGH+DII +     + + +A+  N  K   F  I+ER  LI++  
Sbjct: 1   MGKTAICPGSFDPITNGHLDIIKRGAKVFDKVYVAVLNNISKQPLF-DIEERKALIREVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V SF+GL +  A+   A VI+RGLR ++DF+YE+++TS+NR L   I 
Sbjct: 60  KDIPNVE-----VDSFQGLLMEYAESKKADVIIRGLRAVSDFEYELQLTSMNRVLNDRIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T  +       +++S++++ +     +I   VP  V   LK    
Sbjct: 115 TFFIMTNNQYSFLSSSIVKEIAKYHGNIAELVPPVVHEALKKKFQ 159


>gi|326330640|ref|ZP_08196944.1| pantetheine-phosphate adenylyltransferase [Nocardioidaceae
           bacterium Broad-1]
 gi|325951481|gb|EGD43517.1| pantetheine-phosphate adenylyltransferase [Nocardioidaceae
           bacterium Broad-1]
          Length = 163

 Score =  159 bits (402), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 55/168 (32%), Positives = 87/168 (51%), Gaps = 6/168 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R+AV  GSFDP T GH+DI  +A +  +++VIA+G N  K+K   + +ER E+I +  
Sbjct: 1   MTRRAVCPGSFDPPTFGHLDIFTRASAIFDEVVIAVGVNPSKSKRLFTPEERMEMITEIT 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     V V +F GL  +   +I AQ IV+GLR   D +YE  M  +N  +   + 
Sbjct: 61  APLGN-----VRVQAFTGLVTDFCVEIDAQAIVKGLRGAPDLEYEAPMAQMNAHMTR-VE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           T+ L        V+S+LI+ + +   D+++F+P  V   L   +    
Sbjct: 115 TVFLLNDPRWAAVSSSLIKEMATFGGDVSAFLPPDVLARLTKRLAERS 162


>gi|326318563|ref|YP_004236235.1| pantetheine-phosphate adenylyltransferase [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323375399|gb|ADX47668.1| pantetheine-phosphate adenylyltransferase [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 167

 Score =  159 bits (402), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 93/165 (56%), Gaps = 6/165 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            AVY G+FDPIT GH D++ +A      +++A+     K   F S++ER E++++++  +
Sbjct: 6   IAVYPGTFDPITLGHEDVVRRATQLFGSVIVAVAAGHHKKTLF-SLEERIEMVREAVRPY 64

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                 +V V SF GL  +       + +VRGLR +TDFDYE ++  +NR L PE+ T+ 
Sbjct: 65  P-----QVQVESFSGLLRDFVVARGGKAMVRGLRAVTDFDYEFQLAGMNRSLMPEVETVF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           L   +  ++++ST +R +  +  ++  FV   VC  L + V ++ 
Sbjct: 120 LTPSDKYQFISSTFVREIAVLGGEVDKFVSPGVCQRLTDRVRAMS 164


>gi|134299930|ref|YP_001113426.1| phosphopantetheine adenylyltransferase [Desulfotomaculum reducens
           MI-1]
 gi|172044317|sp|A4J698|COAD_DESRM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|134052630|gb|ABO50601.1| Phosphopantetheine adenylyltransferase [Desulfotomaculum reducens
           MI-1]
          Length = 161

 Score =  159 bits (402), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 90/165 (54%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY GSFDP+TNGHMDI+ +++   + L++A+  N+ K   F S++ER E++K  + 
Sbjct: 1   MRIGVYPGSFDPVTNGHMDIVERSVGLFDRLIVAVAKNAQKKPLF-SVEERVEILKNVLK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +         V +F+GL V  A    A  IVRGLR  +DF+ E      N+ L P++ T
Sbjct: 60  KYPNI-----VVDTFDGLTVTYALQQGAIAIVRGLRAFSDFENEFIFALTNKKLAPDLET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L  +    +++ST ++ + S    ++  VP+ V   +++    
Sbjct: 115 VYLMTRAEYSFISSTTVKEVASFKGSLSGMVPEIVAQKIQDKYGY 159


>gi|222150996|ref|YP_002560149.1| phosphopantetheine adenyltransferase homolog [Macrococcus
           caseolyticus JCSC5402]
 gi|259491319|sp|B9EB42|COAD_MACCJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|222120118|dbj|BAH17453.1| phosphopantetheine adenyltransferase homolog [Macrococcus
           caseolyticus JCSC5402]
          Length = 165

 Score =  159 bits (402), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 54/170 (31%), Positives = 96/170 (56%), Gaps = 6/170 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDPIT GH+DII ++    + + +++  N+ K  GF +I+ER E+I +++
Sbjct: 1   MKNIAVIPGSFDPITLGHLDIIKRSAGLFDVVHVSVLNNASKQ-GFFTIEERIEMISEAV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V  F+GL V+    + A+ IVRGLR ++DF+YEM++TS+N+ L  ++ 
Sbjct: 60  KDIPNVE-----VEYFQGLLVDYCNKVGAKQIVRGLRAVSDFEYEMQLTSMNKKLDDDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKY 170
           T+ +       +++S++ + +     D++S VP  V + LK     + + 
Sbjct: 115 TLYMMTNNQYSFISSSMTKDVAKYGGDVSSIVPPNVELALKQKYAEINRR 164


>gi|326387411|ref|ZP_08209020.1| coenzyme A biosynthesis protein [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208067|gb|EGD58875.1| coenzyme A biosynthesis protein [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 179

 Score =  159 bits (402), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 82/167 (49%), Gaps = 4/167 (2%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R  VY G+FDPIT GH+DII +    V+ L+I +  N  K   F   +  + + ++    
Sbjct: 13  RIGVYPGTFDPITLGHLDIIRRGAKLVDRLIIGVTTNPSKDPLFTPEERIAMVTREVAEQ 72

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V V+ F  L +  A+   A VI+RGLR + DF+YE +M  +N+ L   I T+
Sbjct: 73  ----GIENVEVVGFNALLMKFAEKQGASVIIRGLRAVADFEYEYQMAGMNQQLNNRIETV 128

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
            L A  S + + S L++ +     DI+ FV D V   +   +    +
Sbjct: 129 FLMADVSLQPIASKLVKEIAQFGGDISHFVTDKVRDDVVERIEMQGR 175


>gi|292492245|ref|YP_003527684.1| pantetheine-phosphate adenylyltransferase [Nitrosococcus halophilus
           Nc4]
 gi|291580840|gb|ADE15297.1| pantetheine-phosphate adenylyltransferase [Nitrosococcus halophilus
           Nc4]
          Length = 160

 Score =  159 bits (402), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 53/161 (32%), Positives = 93/161 (57%), Gaps = 6/161 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            AVY G+FDPIT GH D++ +A    E +++A+  + VK   F S++ER  L ++ +   
Sbjct: 5   TAVYPGTFDPITRGHSDLVARAAPLFERIIVAVAASPVKAPCF-SLEERVSLAEEVLADH 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V  F+ L  + A+D  A+V++RGLR ++DF+YE ++ S+NR L PE+ T+ 
Sbjct: 64  PNVE-----VQGFDSLLADFARDCGARVLLRGLRAVSDFEYEFQLASMNRHLVPEVETLF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           L   E   +++++L+R + ++  D++ FV   V   L   +
Sbjct: 119 LTPAEQYAFISASLVREVAALGGDVSPFVHPSVLAALTEKL 159


>gi|294501043|ref|YP_003564743.1| pantetheine-phosphate adenylyltransferase [Bacillus megaterium QM
           B1551]
 gi|295706392|ref|YP_003599467.1| pantetheine-phosphate adenylyltransferase [Bacillus megaterium DSM
           319]
 gi|294350980|gb|ADE71309.1| pantetheine-phosphate adenylyltransferase [Bacillus megaterium QM
           B1551]
 gi|294804051|gb|ADF41117.1| pantetheine-phosphate adenylyltransferase [Bacillus megaterium DSM
           319]
          Length = 164

 Score =  159 bits (402), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 58/170 (34%), Positives = 93/170 (54%), Gaps = 6/170 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDP+TNGH DII +  +  + + + +  NS K+  F + +ER  L+K+  
Sbjct: 1   MGSIAVCPGSFDPVTNGHFDIIKRGANVFDTIYVVVLNNSSKSPLF-TGEERVALLKEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     V V S+ GL +  AK+  A+ I+RGLR ++DF+YEM++TSVNR L  EI 
Sbjct: 60  KSLPN-----VVVESYSGLLMEYAKEKQAKTILRGLRAVSDFEYEMQITSVNRVLDKEIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKY 170
           T+ +       +++S++++ +     +I+  VP PV   L      L + 
Sbjct: 115 TLFMMTNNQYSFLSSSIVKEVAKYGGNISELVPPPVREALAEKFEQLSQK 164


>gi|160879470|ref|YP_001558438.1| pantetheine-phosphate adenylyltransferase [Clostridium
           phytofermentans ISDg]
 gi|189082563|sp|A9KNU8|COAD_CLOPH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|160428136|gb|ABX41699.1| pantetheine-phosphate adenylyltransferase [Clostridium
           phytofermentans ISDg]
          Length = 163

 Score =  159 bits (402), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 53/163 (32%), Positives = 97/163 (59%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y GSFDP+T GH+D+I ++   +++LVI +  NS KT  F +++ER +L++  + 
Sbjct: 1   MKIGIYPGSFDPVTLGHLDVIRRSAKIMDELVIGVLANSSKTPLF-TVEERVKLLECVVK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V++F+GL V+ AK + A+ ++RGLR +TDF+YE+++   N  L  EI T
Sbjct: 60  DIPNVK-----VVAFDGLTVDFAKKLGAKFLIRGLRAITDFEYELQIAQTNHKLDEEIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           +         Y++S++++ + S   DI+ FVP+ +   + +  
Sbjct: 115 VFFTTSVEYSYLSSSIVKEIASYGGDISKFVPNSIIQVIYDKY 157


>gi|225572197|ref|ZP_03781061.1| hypothetical protein RUMHYD_00491 [Blautia hydrogenotrophica DSM
           10507]
 gi|225040369|gb|EEG50615.1| hypothetical protein RUMHYD_00491 [Blautia hydrogenotrophica DSM
           10507]
          Length = 175

 Score =  159 bits (402), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 95/165 (57%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KAVY GSFDP+T GH+D+I++     +++++ +  NS K+  F S++ER  ++K++  
Sbjct: 13  MSKAVYPGSFDPVTYGHLDVIVRGSKSFDEVIVGVLQNSAKSPLF-SVEERVNILKEATK 71

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                     + +S      N A++  A VI+RGLR +TDF+YE++M   NR L P++ T
Sbjct: 72  ELPNVKICAFNGLSV-----NFAREHQANVILRGLRAITDFEYELQMAQTNRVLAPDVDT 126

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L       Y++ST+++ + S   DI++FVP      + + +  
Sbjct: 127 VFLTTGLKYAYLSSTIVKEVASFGGDISNFVPPQALEAILSKMQR 171


>gi|261250520|ref|ZP_05943095.1| phosphopantetheine adenylyltransferase [Vibrio orientalis CIP
           102891]
 gi|260939089|gb|EEX95076.1| phosphopantetheine adenylyltransferase [Vibrio orientalis CIP
           102891]
          Length = 160

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 92/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y G+FDP+TNGH D++ +A S  + LVI +  +  K   F S++ER  L++++  
Sbjct: 1   MRIAIYPGTFDPVTNGHYDLVKRAASMFDHLVIGVAESPSKNTLF-SLEERVALLRETCS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                S     V  F GL V+ A +  A ++VRGLR   DF+YE  +T++ R L PE+ +
Sbjct: 60  ELNNVS-----VDGFSGLLVDFATEKKATILVRGLRTTMDFEYEFGLTTMYRRLKPELES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++STL+R +     ++  FVP  V   +   + +
Sbjct: 115 LFLTPAEEYAFLSSTLVREVAIHGGEVEQFVPKCVHRAITQKLAA 159


>gi|221135338|ref|ZP_03561641.1| phosphopantetheine adenylyltransferase [Glaciecola sp. HTCC2999]
          Length = 163

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 54/164 (32%), Positives = 92/164 (56%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH D+I +     E +++ I  N  K   F S++ER E+I +  
Sbjct: 1   MKTRAIYPGTFDPITNGHADLIERGADMFEHIIVGIASNPTKKPLF-SLEERVEMITEIT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V  F GL  + A+  +A V++RGLR ++DF+YE ++ ++NR L P + 
Sbjct: 60  HHLPNVE-----VKGFTGLLADFAQHENATVLIRGLRAVSDFEYEFQLANMNRRLNPNLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           ++ L   E + +++STL++ +     D++ FV   V   L + +
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHHGDVSQFVHPVVKAALLSRL 158


>gi|330998994|ref|ZP_08322719.1| pantetheine-phosphate adenylyltransferase [Parasutterella
           excrementihominis YIT 11859]
 gi|329575736|gb|EGG57262.1| pantetheine-phosphate adenylyltransferase [Parasutterella
           excrementihominis YIT 11859]
          Length = 165

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 55/169 (32%), Positives = 95/169 (56%), Gaps = 6/169 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y G+FDP+TNGH+D+I +A      L++A+  +  K   F +++ER ++ K+++ 
Sbjct: 1   MITATYPGTFDPLTNGHLDLIRRACWIFPKLIVAVAESKRKHTLF-TLEERVQMAKEAVK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F         V+ FEGL V+  +   +  IVRG R ++DF+YE +M  +N+ L PE+ T
Sbjct: 60  GFPNVE-----VVGFEGLLVDFVRRHGSTCIVRGARAVSDFEYEFQMAGMNQKLMPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKY 170
           I L   E  ++++ T +R +  +  D++ FVP  +   L+   I L + 
Sbjct: 115 IFLTPAEQFQFISGTFVREIAMMGGDVSGFVPQNIRAALERKRIELKQT 163


>gi|148255732|ref|YP_001240317.1| phosphopantetheine adenylyltransferase [Bradyrhizobium sp. BTAi1]
 gi|166216060|sp|A5EJR7|COAD_BRASB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|146407905|gb|ABQ36411.1| Phosphopantetheine adenylyltransferase [Bradyrhizobium sp. BTAi1]
          Length = 164

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 56/164 (34%), Positives = 96/164 (58%), Gaps = 1/164 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++ QA+   + L++A+G +  K   F S +ER  ++ + +
Sbjct: 1   MQRIALYPGSFDPVTNGHLDVVRQAVHLCDRLIVAVGVHHGKKPLF-STEERLAMVHEVL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +       +++ L V  A+   A +++RGLRD TDFDYEM++  +N+ + P I 
Sbjct: 60  EPVAAAAGCGFEASTYDDLTVTAAQKAGAIMMIRGLRDGTDFDYEMQLAGMNQTMVPGIQ 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           T+ + A  + R + +TL+R + ++  D++ FVP  V   LK   
Sbjct: 120 TVFVPASVAVRPIAATLVRQIAAMGGDVSHFVPAAVAASLKAKF 163


>gi|332041918|gb|EGI78262.1| pantetheine-phosphate adenylyltransferase [Hylemonella gracilis
           ATCC 19624]
          Length = 166

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 52/168 (30%), Positives = 91/168 (54%), Gaps = 8/168 (4%)

Query: 1   MMR--KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQ 58
           M R   A+Y G+FDP+T GH D++ +A    + +V+ +     K   F ++ ER +L+++
Sbjct: 1   MSRPVIAIYPGTFDPLTLGHSDVVRRAAQLFDRVVVGVAAAHHKKTLF-TLDERMDLVRE 59

Query: 59  SIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPE 118
            +        + VSV SF GL  +       +V++RGLR +TDFDYE ++  +NR L PE
Sbjct: 60  VL-----HDQSNVSVESFTGLLRDFVVGHGGKVVIRGLRAVTDFDYEFQLAGMNRTLMPE 114

Query: 119 IATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + T+ L    + ++++STL+R + ++  +   FV   V   L   +  
Sbjct: 115 VETVFLTPGLNYQFISSTLVREIAALGGEAEKFVDPAVARRLAEKIRR 162


>gi|303328441|ref|ZP_07358878.1| pantetheine-phosphate adenylyltransferase [Desulfovibrio sp.
           3_1_syn3]
 gi|302861435|gb|EFL84372.1| pantetheine-phosphate adenylyltransferase [Desulfovibrio sp.
           3_1_syn3]
          Length = 179

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 50/165 (30%), Positives = 90/165 (54%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y G+FDP+TNGH+ +I +     + +++A+  N+ K   F S +ER E+ ++++ 
Sbjct: 1   MKTALYPGTFDPLTNGHLSLIRRGCDVFDRIIVAVADNTPKFPLF-SHEERVEMAREALK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                + +RV V  F GL V  A       ++RGLR ++DF+YE ++  +NR L   I T
Sbjct: 60  -----NESRVVVEPFSGLTVEYAAQRGVCALLRGLRAVSDFEYEFQLALMNRRLQRHIQT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + +       +++ST+++   S  AD+   VP+ V   L     +
Sbjct: 115 VFMMTDYQWLFISSTIVKAAASHGADVKGLVPENVRRKLLEKYAN 159


>gi|225568061|ref|ZP_03777086.1| hypothetical protein CLOHYLEM_04134 [Clostridium hylemonae DSM
           15053]
 gi|225163157|gb|EEG75776.1| hypothetical protein CLOHYLEM_04134 [Clostridium hylemonae DSM
           15053]
          Length = 162

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 61/167 (36%), Positives = 97/167 (58%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +AVY GSFDP+T GH+DII ++   V++L+I +  N  KT  F S +ER  ++K+   
Sbjct: 1   MLRAVYPGSFDPVTYGHLDIIERSSKLVDELIIGVLNNKAKTPLF-SAEERVRMLKEVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +     ++ F+GL V  A+ + A +IVRGLR +TDF+YE++M+  N  L PEI T
Sbjct: 60  GMPKLT-----IVPFDGLLVEFARRMEATMIVRGLRAITDFEYELQMSQTNHKLEPEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L       Y++ST ++ + +   DI+ FVPD V   ++  +    
Sbjct: 115 VFLTTSLDYSYLSSTTVKEVAAFGGDISQFVPDFVADTIREKMNRRR 161


>gi|46579943|ref|YP_010751.1| phosphopantetheine adenylyltransferase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602643|ref|YP_967043.1| phosphopantetheine adenylyltransferase [Desulfovibrio vulgaris DP4]
 gi|61212636|sp|Q72BV2|COAD_DESVH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216544|sp|A1VDV0|COAD_DESVV RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|46449359|gb|AAS96010.1| pantetheine-phosphate adenylyltransferase [Desulfovibrio vulgaris
           str. Hildenborough]
 gi|120562872|gb|ABM28616.1| Phosphopantetheine adenylyltransferase [Desulfovibrio vulgaris DP4]
 gi|311234059|gb|ADP86913.1| pantetheine-phosphate adenylyltransferase [Desulfovibrio vulgaris
           RCH1]
          Length = 186

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 52/164 (31%), Positives = 87/164 (53%), Gaps = 6/164 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + AVY G+FDP+T GH+ +I +     + +++A+  ++ KT  F S+ ER  + ++    
Sbjct: 7   KLAVYPGTFDPLTMGHVSLIRRGRQIFDRVIVAVAMDTPKTPLF-SLDERVRMAEEVFAD 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               +     V  F GL V+ A+   A VI+RGLR ++DF+YE ++  +NR L   + T+
Sbjct: 66  HEGIT-----VEPFSGLLVDYAERRGANVILRGLRAVSDFEYEFQLALMNRKLKRHVQTV 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            L       Y++ST+I+   S+  DI   VPD V   L+     
Sbjct: 121 FLMTDYQWLYISSTIIKAAASLGGDIKGLVPDNVYRRLREKYGY 164


>gi|295095220|emb|CBK84310.1| Phosphopantetheine adenylyltransferase [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 159

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 89/165 (53%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPITNGH+DII +A    + +++AI  +  K   F   +      +  +
Sbjct: 1   MSTKAIYPGTFDPITNGHLDIITRAACMFDKVILAIAASPSKKPMFDLNE------RVQL 54

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   + V V+ F  L  N A+D  A +++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 55  ATDAISHLSNVEVVGFSDLMANFARDRQANILIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P  V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHHGDVTHFLPVNVHQALMEKLK 159


>gi|163858289|ref|YP_001632587.1| phosphopantetheine adenylyltransferase [Bordetella petrii DSM
           12804]
 gi|229488120|sp|A9I6L9|COAD_BORPD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|163262017|emb|CAP44319.1| pantetheine-phosphate adenylyltransferase [Bordetella petrii]
          Length = 170

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 53/162 (32%), Positives = 94/162 (58%), Gaps = 6/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A +  + +V+ I  +  K   F SI ER E+ ++ + 
Sbjct: 1   MITAVYPGTFDPLTRGHEDLVRRAAALFDKVVVGIAHSRNKKPFF-SIDERVEIAREVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V SF GL  +  ++ + +VIVRGLR ++DF+YE +M  +NR L PE+ T
Sbjct: 60  HYPNVE-----VRSFAGLLKDFVREQNGRVIVRGLRAVSDFEYEFQMAGMNRHLLPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           + +   +  ++++ T++R +  +  D++ FV   V  +L+  
Sbjct: 115 MFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVERWLQAK 156


>gi|254467055|ref|ZP_05080466.1| pantetheine-phosphate adenylyltransferase [Rhodobacterales
           bacterium Y4I]
 gi|206687963|gb|EDZ48445.1| pantetheine-phosphate adenylyltransferase [Rhodobacterales
           bacterium Y4I]
          Length = 166

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 60/165 (36%), Positives = 91/165 (55%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH DII +A + V+ LVI +  N  K   F  ++ER  +I+    
Sbjct: 1   MRVGLYPGTFDPITIGHTDIIRRASALVDKLVIGVAINRDKGPLF-PLEERVAMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               ++   +    FE L +N A+D+ AQ+IVRGLR + DF+YE +M  +NR L   I T
Sbjct: 60  KLSEETGTEIVAHPFENLLINCARDVGAQIIVRGLRAVADFEYEFQMVGMNRVLDSSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A+   + V S L++ +  +D D++ FV   V   L   +  
Sbjct: 120 VFLMAEARHQAVASKLVKEIARLDGDVSKFVSPLVKEKLLERLGK 164


>gi|328954572|ref|YP_004371906.1| Phosphopantetheine adenylyltransferase [Desulfobacca acetoxidans
           DSM 11109]
 gi|328454896|gb|AEB10725.1| Phosphopantetheine adenylyltransferase [Desulfobacca acetoxidans
           DSM 11109]
          Length = 161

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 56/164 (34%), Positives = 93/164 (56%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y GSFDPITNGH+D+I + L   +++++AI  N +K   F +I+ER ELI++ +
Sbjct: 1   MGKIAIYPGSFDPITNGHLDLINRGLKVFDEIIVAIAVNPIKQPLF-TIEERVELIREVL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       +  F GL V+  +     VI+RGLR ++DFDYE ++  +NR L PEI 
Sbjct: 60  NEHPRVK-----IDHFTGLLVDYVRQQGTNVILRGLRAVSDFDYEFQLALMNRRLAPEIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           T+ L       +++S++++  +S+   +   VP  V   L+   
Sbjct: 115 TVFLMTSLKWVFLSSSILKEAVSLGGVVQDIVPPVVFQRLREKF 158


>gi|22124008|ref|NP_667431.1| phosphopantetheine adenylyltransferase [Yersinia pestis KIM 10]
 gi|45439919|ref|NP_991458.1| phosphopantetheine adenylyltransferase [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108809480|ref|YP_653396.1| phosphopantetheine adenylyltransferase [Yersinia pestis Antiqua]
 gi|108813957|ref|YP_649724.1| phosphopantetheine adenylyltransferase [Yersinia pestis Nepal516]
 gi|145601092|ref|YP_001165168.1| phosphopantetheine adenylyltransferase [Yersinia pestis Pestoides
           F]
 gi|150260883|ref|ZP_01917611.1| phosphopantetheine adenylyltransferase [Yersinia pestis CA88-4125]
 gi|162421465|ref|YP_001604699.1| phosphopantetheine adenylyltransferase [Yersinia pestis Angola]
 gi|165926191|ref|ZP_02222023.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165936149|ref|ZP_02224718.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166011500|ref|ZP_02232398.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166213697|ref|ZP_02239732.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167419199|ref|ZP_02310952.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167426659|ref|ZP_02318412.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167469343|ref|ZP_02334047.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis FV-1]
 gi|218927274|ref|YP_002345149.1| phosphopantetheine adenylyltransferase [Yersinia pestis CO92]
 gi|229836166|ref|ZP_04456334.1| phosphopantetheine adenylyltransferase [Yersinia pestis Pestoides
           A]
 gi|229839902|ref|ZP_04460061.1| phosphopantetheine adenylyltransferase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229841984|ref|ZP_04462139.1| phosphopantetheine adenylyltransferase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229904487|ref|ZP_04519598.1| phosphopantetheine adenylyltransferase [Yersinia pestis Nepal516]
 gi|270488486|ref|ZP_06205560.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis KIM D27]
 gi|294502158|ref|YP_003566220.1| phosphopantetheine adenylyltransferase [Yersinia pestis Z176003]
 gi|29427901|sp|Q8ZJN9|COAD_YERPE RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|122979352|sp|Q1C271|COAD_YERPA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|122979882|sp|Q1CD06|COAD_YERPN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216619|sp|A4TSD3|COAD_YERPP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541058|sp|A9R678|COAD_YERPG RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|21956750|gb|AAM83682.1|AE013609_7 putative enzyme of lipopolysaccharide synthesis [Yersinia pestis
           KIM 10]
 gi|45434774|gb|AAS60335.1| phosphopantetheine adenylyltransferase [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108777605|gb|ABG20124.1| Phosphopantetheine adenylyltransferase [Yersinia pestis Nepal516]
 gi|108781393|gb|ABG15451.1| Phosphopantetheine adenylyltransferase [Yersinia pestis Antiqua]
 gi|115345885|emb|CAL18743.1| phosphopantetheine adenylyltransferase [Yersinia pestis CO92]
 gi|145212788|gb|ABP42195.1| Phosphopantetheine adenylyltransferase [Yersinia pestis Pestoides
           F]
 gi|149290291|gb|EDM40368.1| phosphopantetheine adenylyltransferase [Yersinia pestis CA88-4125]
 gi|162354280|gb|ABX88228.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis Angola]
 gi|165915763|gb|EDR34371.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165922051|gb|EDR39228.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165989646|gb|EDR41947.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166205099|gb|EDR49579.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166963193|gb|EDR59214.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167054348|gb|EDR64165.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|229678605|gb|EEO74710.1| phosphopantetheine adenylyltransferase [Yersinia pestis Nepal516]
 gi|229690294|gb|EEO82348.1| phosphopantetheine adenylyltransferase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229696268|gb|EEO86315.1| phosphopantetheine adenylyltransferase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229706614|gb|EEO92620.1| phosphopantetheine adenylyltransferase [Yersinia pestis Pestoides
           A]
 gi|262360237|gb|ACY56958.1| phosphopantetheine adenylyltransferase [Yersinia pestis D106004]
 gi|262364184|gb|ACY60741.1| phosphopantetheine adenylyltransferase [Yersinia pestis D182038]
 gi|270336990|gb|EFA47767.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis KIM D27]
 gi|294352617|gb|ADE62958.1| phosphopantetheine adenylyltransferase [Yersinia pestis Z176003]
 gi|320013407|gb|ADV96978.1| phosphopantetheine adenylyltransferase [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 159

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+ KA+Y G+FDPITNGH+D++ +A +    +++AI  +S K   F ++ ER  L K+  
Sbjct: 1   MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPMF-TLDERVALAKKVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V+ F  L    AK  +A ++VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  APLKNVE-----VLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E   +++S+L++ +     DIT F+P PV   L   + 
Sbjct: 115 SVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA 159


>gi|260553987|ref|ZP_05826252.1| phosphopantetheine adenylyltransferase [Acinetobacter sp. RUH2624]
 gi|260404873|gb|EEW98378.1| phosphopantetheine adenylyltransferase [Acinetobacter sp. RUH2624]
          Length = 163

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 55/158 (34%), Positives = 89/158 (56%), Gaps = 6/158 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
             + +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER  L + S+ 
Sbjct: 3   KTRVIYPGTFDPITNGHVDLVTRASRMFDEVVVAIAIGHHKNPLF-SLEERVALAQSSLG 61

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H           + F+GL VN  K+  A  ++RGLR ++DF+YE ++ ++NR L P    
Sbjct: 62  HLSNVE-----FVGFDGLLVNFFKEQKATAVLRGLRAVSDFEYEFQLANMNRQLDPHFEA 116

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVF 159
           + L   E   +++STLIR +  +  D+T FVP  V   
Sbjct: 117 VFLTPSEQYSFISSTLIREIARLKGDVTKFVPQAVVEA 154


>gi|239817335|ref|YP_002946245.1| pantetheine-phosphate adenylyltransferase [Variovorax paradoxus
           S110]
 gi|239803912|gb|ACS20979.1| pantetheine-phosphate adenylyltransferase [Variovorax paradoxus
           S110]
          Length = 167

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 55/166 (33%), Positives = 94/166 (56%), Gaps = 5/166 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            AVY G+FDPIT GH D++ +A      +++A+     K K   S+QER E+ ++++  +
Sbjct: 6   IAVYPGTFDPITLGHEDVVRRATQLFSKVIVAVAAGHHK-KALFSLQERIEMAREAVKPY 64

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               S++V+V SF GL  +       + +VRGLR +TDFDYE ++  +NR L P++ T+ 
Sbjct: 65  ----SDQVTVESFSGLLRDFVVARGGKAMVRGLRAVTDFDYEFQLAGMNRSLMPDVETVF 120

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           L   +  ++++ST +R +  +  ++  FV   V   L   V SL +
Sbjct: 121 LTPSDKYQFISSTFVREIAMLGGEVHKFVSPDVEKQLAAKVRSLGR 166


>gi|24216866|ref|NP_714347.1| pantetheine-phosphate adenylyltransferase [Leptospira interrogans
           serovar Lai str. 56601]
 gi|45659144|ref|YP_003230.1| phosphopantetheine adenylyltransferase [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
 gi|29427772|sp|Q8EYP6|COAD_LEPIN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|59797798|sp|Q72M66|COAD_LEPIC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|24198243|gb|AAN51365.1| pantetheine-phosphate adenylyltransferase [Leptospira interrogans
           serovar Lai str. 56601]
 gi|45602390|gb|AAS71867.1| phosphopantetheine adenylyltransferase [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
          Length = 160

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 54/166 (32%), Positives = 94/166 (56%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+Y GSFDP+T GH+DI+ ++L   + ++IAI  NS K+  F SI+ER   I++  
Sbjct: 1   MKHLAIYPGSFDPLTKGHLDILQRSLGLFDKVIIAIAVNSNKSTLF-SIEERLGFIREVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     + + +F+GL V+    + A  I+RGLR +TDFDYE  ++ +N+ L P + 
Sbjct: 60  K-----GMKGLEIDTFQGLTVDYCNKVGANSIIRGLRAVTDFDYEYAISLMNKKLAPNVE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+ L +     +++ST+++ +     D+++ VP+ V   L   +  
Sbjct: 115 TVFLMSSGEYSFISSTIVKEVARHGRDVSNQVPEIVSKALLKKLSQ 160


>gi|160933339|ref|ZP_02080727.1| hypothetical protein CLOLEP_02184 [Clostridium leptum DSM 753]
 gi|156867216|gb|EDO60588.1| hypothetical protein CLOLEP_02184 [Clostridium leptum DSM 753]
          Length = 159

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 51/163 (31%), Positives = 96/163 (58%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+  GSFDP+T GH+DII +A    + +++A+  N  K   F S++ER  L+K++  
Sbjct: 1   MTTAICPGSFDPVTVGHVDIIRRARKMFDHVIVAVLVNPTKNPSF-SLEERIGLLKRATK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                  + + ++ F+GL  + A+   A V+V+GLR ++DF+YE +M+  N+ L PE+ T
Sbjct: 60  -----EIDGLEIVGFDGLLADYARTRKATVLVKGLRAVSDFEYEFQMSLTNKKLNPELET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L     + Y++S++++ +     DI+ FVP  +   +++ +
Sbjct: 115 VFLTTSAENMYLSSSIVKQIAMFGGDISDFVPACILKDIQDRL 157


>gi|307153226|ref|YP_003888610.1| pantetheine-phosphate adenylyltransferase [Cyanothece sp. PCC 7822]
 gi|306983454|gb|ADN15335.1| pantetheine-phosphate adenylyltransferase [Cyanothece sp. PCC 7822]
          Length = 157

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 51/157 (32%), Positives = 83/157 (52%), Gaps = 6/157 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y GSFDPIT GH+DII +     E +++ + CN  K   F  +++R E I+Q   H 
Sbjct: 2   IAIYPGSFDPITLGHLDIITRGGQLFERVIVTVSCNPNKNPLF-PVEKRVEQIRQCTQHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V SF GL V  AK   A V++RGLR ++DF+ E++M   N  L   I T+ 
Sbjct: 61  TNVE-----VDSFTGLTVEYAKLRKANVLLRGLRVLSDFEKELQMAHTNVTLWDGIETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           L   +   +++S++++ +      ++  VP+ V   +
Sbjct: 116 LATAKEYSFLSSSIVKEIAKFGGSVSHLVPENVARDI 152


>gi|171060172|ref|YP_001792521.1| pantetheine-phosphate adenylyltransferase [Leptothrix cholodnii
           SP-6]
 gi|170777617|gb|ACB35756.1| pantetheine-phosphate adenylyltransferase [Leptothrix cholodnii
           SP-6]
          Length = 166

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 49/161 (30%), Positives = 88/161 (54%), Gaps = 6/161 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y G+FDP+T GH D++ +A      L++A+     K   F S++ER E+ ++    +
Sbjct: 9   TAIYPGTFDPMTLGHQDLMRRASRLFSRLIVAVAAGHHKRTMF-SVEERLEIARELAAKY 67

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V++F GL  +   +   +V+VRGLR ++DF+YE +M  +NR L PE+ T+ 
Sbjct: 68  PNVE-----VVAFRGLLRDFVVEHGGKVVVRGLRAVSDFEYEFQMAGMNRQLMPEVETLF 122

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           L   +  ++++ T +R +  +  D++ FV   V   L+  V
Sbjct: 123 LTPSDQYQFISGTFVREIAVLGGDVSKFVAPSVLERLQRRV 163


>gi|223934956|ref|ZP_03626875.1| pantetheine-phosphate adenylyltransferase [bacterium Ellin514]
 gi|223896409|gb|EEF62851.1| pantetheine-phosphate adenylyltransferase [bacterium Ellin514]
          Length = 162

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 55/162 (33%), Positives = 101/162 (62%), Gaps = 6/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y GSFDP+TNGH+D+I +A    + +++A+  N  K+  F ++ ER +L+ Q + 
Sbjct: 1   MRTVIYPGSFDPLTNGHLDVIQRATKLFDRVIVAVAKNESKSPLF-TLSERLDLVSQCVK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H     ++     +F+GL V+ A+  SAQ I+RGLR ++DF++E ++  +NR L   + T
Sbjct: 60  HLPNVEAD-----TFDGLLVDYAEKQSAQAIIRGLRAVSDFEFEFQLALMNRKLNERVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           I +  K++  +++S +++ +  +  +I++FVP PV V L + 
Sbjct: 115 IFMMPKDTYTFLSSRIVKEIARLGGNISTFVPSPVQVALHSK 156


>gi|283798041|ref|ZP_06347194.1| pantetheine-phosphate adenylyltransferase [Clostridium sp. M62/1]
 gi|291074343|gb|EFE11707.1| pantetheine-phosphate adenylyltransferase [Clostridium sp. M62/1]
 gi|295091820|emb|CBK77927.1| pantetheine-phosphate adenylyltransferase, bacterial [Clostridium
           cf. saccharolyticum K10]
          Length = 163

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 57/169 (33%), Positives = 97/169 (57%), Gaps = 6/169 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+T GH DII ++    + L++ +  NS K+  F S++ER +++K    
Sbjct: 1   MKTAIYPGSFDPVTLGHYDIIERSSQIFDRLIVGVLNNSAKSPLF-SVEERVKMLKDVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      + SF+GL ++ A++  AQVIVRGLR +TDF+YE++M  +NR + PEI T
Sbjct: 60  ELPNVE-----IKSFDGLLIDFARENQAQVIVRGLRAVTDFEYELQMAQMNRVIAPEIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKY 170
           + L       Y++S++ + +     DI++F+   V   ++     + K 
Sbjct: 115 LFLTTNLKYAYLSSSIAKEVAMYGGDISAFLDPAVEREVQKKCSVIQKR 163


>gi|119356842|ref|YP_911486.1| phosphopantetheine adenylyltransferase [Chlorobium phaeobacteroides
           DSM 266]
 gi|166216534|sp|A1BF85|COAD_CHLPD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|119354191|gb|ABL65062.1| pantetheine-phosphate adenylyltransferase [Chlorobium
           phaeobacteroides DSM 266]
          Length = 167

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 61/172 (35%), Positives = 100/172 (58%), Gaps = 5/172 (2%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M RKA+Y G+FDP TNGH+D++ +AL+  +++ + IG NS K   F ++ ER E+I++ +
Sbjct: 1   MKRKAIYPGTFDPFTNGHLDVLDRALNIFDEVEVVIGENSQKKTLF-TVNERLEMIREIV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F   +   +     +GL  N A+ + A+ IVRG+R + DF+YE +M+ +NR L PE+ 
Sbjct: 60  IEFPGVTVAVLH----DGLLANYARQVEARAIVRGVRQVKDFEYEFQMSLLNRHLYPEVT 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDS 172
           T+ L       YV S++IR +  +  D++ FV   V   L   +    K +S
Sbjct: 116 TVFLMPNVKYTYVASSIIREVAMLGGDVSKFVHPCVLAMLHKKLQENKKSNS 167


>gi|299133973|ref|ZP_07027167.1| pantetheine-phosphate adenylyltransferase [Afipia sp. 1NLS2]
 gi|298591809|gb|EFI52010.1| pantetheine-phosphate adenylyltransferase [Afipia sp. 1NLS2]
          Length = 165

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 65/166 (39%), Positives = 101/166 (60%), Gaps = 1/166 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++ QA + V+ L++AIG +  K   F SI ER  +I +  
Sbjct: 1   MARVALYPGSFDPVTNGHVDVVRQACTLVDRLIVAIGVHPGKAPLF-SIDERRAMIVEVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F   S   +  ++F+ L V  A+   A +++RGLRD TD DYEM++  +N+ L P++ 
Sbjct: 60  APFAAASGCGIECVTFDNLTVAAAQKAGASILIRGLRDGTDLDYEMQIAGMNQTLVPDVQ 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           TI + A  + R +T+TL+R + S+  D+++FVP  V   LK     
Sbjct: 120 TIFIPASPTVRPITATLVRQIASMGGDVSAFVPKAVATRLKAKFSQ 165


>gi|237747435|ref|ZP_04577915.1| phosphopantetheine adenylyltransferase [Oxalobacter formigenes
           HOxBLS]
 gi|229378786|gb|EEO28877.1| phosphopantetheine adenylyltransferase [Oxalobacter formigenes
           HOxBLS]
          Length = 165

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 96/167 (57%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A    ++L++ +  +  K   F S++ER  + K+ + 
Sbjct: 1   MVIAVYPGTFDPLTRGHEDLVRRASGLFDELIVGVADSRTKKPFF-SMEERMAIAKEVLE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+       V V SF GL  +  ++ +A VI+RGLR ++DF+YE +M  +NR L PE  T
Sbjct: 60  HYPN-----VRVESFTGLLKDFVREHNASVIIRGLRAVSDFEYEFQMAGMNRYLMPEAET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + +   +  ++++ +++R +  +  D++ FV   V  +L+  V  + 
Sbjct: 115 LFMTPSDQYQFISGSIVREIAFLGGDVSKFVFPSVEKWLRKKVTEIR 161


>gi|301631287|ref|XP_002944731.1| PREDICTED: phosphopantetheine adenylyltransferase-like [Xenopus
           (Silurana) tropicalis]
          Length = 164

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 91/158 (57%), Gaps = 6/158 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            AVY G+FDPIT GH D++ +A    +++++A+     K   F S+ +R  L+++ +  +
Sbjct: 5   IAVYPGTFDPITLGHEDLVERAARLFDEVIVAVAVGHHKKTLF-SLDDRMALVREVVQPW 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                 +V V SF+GL  +  +   A+ +VRG+R +TDFDYE ++  +NR L P++ T+ 
Sbjct: 64  P-----QVRVQSFDGLVRDFVRAHGARAMVRGVRSVTDFDYERQLAGMNRHLMPDVETVF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           L   +   +++S+ +R + ++  D+ + V   V   L+
Sbjct: 119 LTPSDRFAHLSSSFVREIHTLGGDVQALVSPTVLQKLR 156


>gi|124268408|ref|YP_001022412.1| phosphopantetheine adenylyltransferase [Methylibium petroleiphilum
           PM1]
 gi|124261183|gb|ABM96177.1| Phosphopantetheine adenylyltransferase [Methylibium petroleiphilum
           PM1]
          Length = 166

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 50/162 (30%), Positives = 85/162 (52%), Gaps = 6/162 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A +    L++A+     K   F   +      +  I   +
Sbjct: 9   AVYPGTFDPMTLGHQDLVRRASALFPRLIVAVAAGHHKRTMFTIAE------RLEIAQEL 62

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
             S   V VI+F GL  +   +   +V+VRGLR ++DF+YE +M  +NR L P + T+ L
Sbjct: 63  LASHRNVEVIAFRGLLRDFVVEHGGKVVVRGLRAVSDFEYEFQMAGMNRQLMPNVETVFL 122

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
              +  ++++ T +R + ++  D++ FV   V   LK  V  
Sbjct: 123 TPSDQYQFISGTFVREIATLGGDVSKFVAPSVLQRLKQRVSQ 164


>gi|323705487|ref|ZP_08117062.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535389|gb|EGB25165.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 159

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 53/164 (32%), Positives = 93/164 (56%), Gaps = 6/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDP+TNGH+D+I +A    + L++A+  N  KT  F S++ER E++K+   
Sbjct: 1   MNIAVYPGSFDPVTNGHLDVIKRAAKVFDKLIVAVLVNPSKTPMF-SLEERVEMLKEVTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      + SF GL +   + +++++IV+GLR ++DF+YE +M  +N+ L PE+ T
Sbjct: 60  DIENVE-----IDSFSGLLIEYLEKVNSKIIVKGLRMVSDFEYEFQMALINKKLNPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           I         Y++S++++ +      ++  VPD V   +   + 
Sbjct: 115 IFFMTSNKYGYLSSSIVKEVARFGGFLSDLVPDSVIEKILQKIK 158


>gi|295101908|emb|CBK99453.1| Phosphopantetheine adenylyltransferase [Faecalibacterium
           prausnitzii L2-6]
          Length = 167

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 59/167 (35%), Positives = 90/167 (53%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDP+T GH+DII +A    + L++A+  NS K   F +++ER  L+++   
Sbjct: 1   MATAVYPGSFDPVTRGHLDIIKRAAKINDRLIVAVLINSAKNPLF-TVEERVALLRECCK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +     V SF+GL V  AK   A V+VRGLR +TDF+ E+++   N  L P I T
Sbjct: 60  DIPNVT-----VESFDGLTVEFAKKRHASVMVRGLRAVTDFENEIQLAQTNHALMPGIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L       Y++ST+++      ++I+ FV   V   +   V  L 
Sbjct: 115 MFLATSIKWSYLSSTIVKEAARYGSNISKFVTPNVEDAIHAKVERLR 161


>gi|93005190|ref|YP_579627.1| coenzyme A biosynthesis protein [Psychrobacter cryohalolentis K5]
 gi|92392868|gb|ABE74143.1| Phosphopantetheine adenylyltransferase [Psychrobacter
           cryohalolentis K5]
          Length = 170

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 53/164 (32%), Positives = 91/164 (55%), Gaps = 6/164 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
            K +Y G+FDPITNGH+D++ +A    +++VIA+     K   F + +ER  L++     
Sbjct: 12  TKILYPGTFDPITNGHVDLVTRATKLFDEVVIAVASGHHKKPLF-NFEERVALVETVFVD 70

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               S     VI FEGL V+  ++ +A  ++RGLR M+DF+YE ++ ++NR L      +
Sbjct: 71  LPQVS-----VIGFEGLLVDFMREKNATAVLRGLRAMSDFEYEFQLANMNRELDENFEAV 125

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            L   ++  +++ST+IR +  +  D+T FVP  V       + +
Sbjct: 126 FLTPSQNYSFISSTMIREIAKLGGDVTKFVPPCVSAAFIQKLGN 169


>gi|317132995|ref|YP_004092309.1| pantetheine-phosphate adenylyltransferase [Ethanoligenens
           harbinense YUAN-3]
 gi|315470974|gb|ADU27578.1| pantetheine-phosphate adenylyltransferase [Ethanoligenens
           harbinense YUAN-3]
          Length = 167

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 54/168 (32%), Positives = 90/168 (53%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+  GSFDP+T GH+DII +A    + +V+ +  NS K+  F +++ER   I++S+ 
Sbjct: 1   MSLAICPGSFDPLTLGHLDIISRAARMFDSVVVVVMFNSGKSPAF-TVEERYAFIRKSVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V ++EGL  +      A  +VRGLR M+DF+YE +M   N  L P+  T
Sbjct: 60  GIPNVE-----VDTYEGLLADYCALRGADAVVRGLRVMSDFEYEFQMALTNNSLHPQTET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           I L A     +++S+++R +     DI+ FVP  + + ++  +    K
Sbjct: 115 IFLPANREYMFLSSSVVREIARFGRDISPFVPPEIALDIQARLCGKEK 162


>gi|121611669|ref|YP_999476.1| pantetheine-phosphate adenylyltransferase [Verminephrobacter
           eiseniae EF01-2]
 gi|121556309|gb|ABM60458.1| pantetheine-phosphate adenylyltransferase [Verminephrobacter
           eiseniae EF01-2]
          Length = 167

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 53/162 (32%), Positives = 91/162 (56%), Gaps = 6/162 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDPIT GH D++ +A    E +++A+     K   F  + ER E+++ ++ ++ 
Sbjct: 7   AVYPGTFDPITLGHEDVVRRATQLFERVIVAVAAGHHKKTLFA-LDERIEMVRDAVKNYP 65

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                RV V SF GL  +       + +VRGLR +TDFDYE ++  +NR L P++ T+ L
Sbjct: 66  -----RVQVESFAGLLRDFVVARGGKAMVRGLRAVTDFDYEFQLAGMNRSLMPQVETVFL 120

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
              +  ++++ST +R + ++  ++  FV   V   L+  V S
Sbjct: 121 TPGDKYQFISSTFVREIAALGGEVHKFVSPAVQERLQAKVRS 162


>gi|83858657|ref|ZP_00952179.1| lipopolysaccharide core biosynthesis protein KdtB [Oceanicaulis
           alexandrii HTCC2633]
 gi|83853480|gb|EAP91332.1| lipopolysaccharide core biosynthesis protein KdtB [Oceanicaulis
           alexandrii HTCC2633]
          Length = 163

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 54/163 (33%), Positives = 85/163 (52%), Gaps = 3/163 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
            R A+Y G+FDPITNGH+DII +A+   + LVI +  N  K   F   +      + +  
Sbjct: 3   KRVALYPGTFDPITNGHLDIIGRAVKLYDKLVIGVARNDAKGPLFSFDERVDMARELAES 62

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    + V+ FEGL ++ A+ + A  I+RGLR ++DF+YE +M  +N+ L  +I T
Sbjct: 63  V---AGDTEIEVLPFEGLLMHFAEKVGASSIIRGLRAVSDFEYEFQMVGMNQRLNADIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L A    + + S L++ +  +  DI  FVP  V   L    
Sbjct: 120 VFLMADPRHQAIASRLVKEIAKLGGDIDPFVPQLVKERLLEKF 162


>gi|288923499|ref|ZP_06417618.1| pantetheine-phosphate adenylyltransferase [Frankia sp. EUN1f]
 gi|288345157|gb|EFC79567.1| pantetheine-phosphate adenylyltransferase [Frankia sp. EUN1f]
          Length = 162

 Score =  158 bits (400), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 55/162 (33%), Positives = 94/162 (58%), Gaps = 3/162 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+A   GSFDPITNGH+DII++A    +++V+A+  N  K   F ++ ER +LI++++ 
Sbjct: 1   MRRAACPGSFDPITNGHLDIIVRASRLFDEVVVAVSINKSKVNLF-TVDERMDLIREAVG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   V V S  GL V+  +    Q IV+GLR ++DFDYE++M  +N  L   + T
Sbjct: 60  AHPA-APTNVIVESSHGLLVDFCRVHGIQSIVKGLRAVSDFDYELQMAQMNNSLA-GVET 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           + +       +++S+L++ +     D++  VPD V   L++ 
Sbjct: 118 LFMSTNPQYAFLSSSLVKEVARYGGDVSGLVPDVVLKGLRDR 159


>gi|71064902|ref|YP_263629.1| phosphopantetheine adenylyltransferase [Psychrobacter arcticus
           273-4]
 gi|71037887|gb|AAZ18195.1| Phosphopantetheine adenylyltransferase [Psychrobacter arcticus
           273-4]
          Length = 170

 Score =  158 bits (400), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 54/164 (32%), Positives = 91/164 (55%), Gaps = 6/164 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
            K +Y G+FDPITNGH+D++ +A    +++VIA+     K   F + +ER  L++     
Sbjct: 12  TKILYPGTFDPITNGHVDLVTRATKLFDEVVIAVASGHHKKPLF-NFEERVALVETVFID 70

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               S     VI FEGL V+  ++ +A  ++RGLR M+DF+YE ++ ++NR L      +
Sbjct: 71  LPQVS-----VIGFEGLLVDFMREKNATAVLRGLRVMSDFEYEFQLANMNRELDENFEAV 125

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            L   ++  +++ST+IR +  +  D+T FVP  V       + S
Sbjct: 126 FLTPSQNYSFISSTMIREIAKLGGDVTKFVPPCVSEAFIQKLGS 169


>gi|85859443|ref|YP_461645.1| phosphopantetheine adenylyltransferase [Syntrophus aciditrophicus
           SB]
 gi|123516625|sp|Q2LTS1|COAD_SYNAS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|85722534|gb|ABC77477.1| phosphopantetheine adenylyltransferase [Syntrophus aciditrophicus
           SB]
          Length = 165

 Score =  158 bits (400), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 59/169 (34%), Positives = 95/169 (56%), Gaps = 6/169 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + AVY GSFDPITNGH+DII + LS  ++L++ I  N+ K+  F ++QER E+I++++
Sbjct: 1   MKKIAVYPGSFDPITNGHLDIIKRGLSMFDELIVLIAYNAAKSSLF-TVQERIEMIQEAL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     V V S++GL V+  +     VI+RGLR M++F+YE ++  +NR L   I 
Sbjct: 60  -----HDRKGVRVDSYDGLLVDYVRKEGGNVILRGLRAMSEFEYEFQLALMNRRLNRNIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           T+ L       Y +ST+I+    +       VP+ V   ++     + K
Sbjct: 115 TVFLMTGYKWFYTSSTIIKEASRLGGSPKGLVPEVVFRKMQEKYPLMNK 163


>gi|312622535|ref|YP_004024148.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312203002|gb|ADQ46329.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 168

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 57/156 (36%), Positives = 92/156 (58%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  VY GSFDP+TNGH+DII +A    + L++A+  N  KT  F  I+ER EL+K++  
Sbjct: 1   MKIGVYPGSFDPVTNGHLDIIERASKIFDKLIVAVLVNPNKTPVF-DIEERVELLKETTE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V +F+GL ++  K  +A+VIV+GLR ++DF+YE +M  +N+ L P I T
Sbjct: 60  HLPNVE-----VKAFKGLLIDFMKQENAKVIVKGLRAVSDFEYEFQMALLNKKLEPSIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I +       Y++S++++ +      I   VP+ + 
Sbjct: 115 IFMMTNSKYSYLSSSMVKEVARFGGCIEDLVPEKIA 150


>gi|237749583|ref|ZP_04580063.1| phosphopantetheine adenylyltransferase [Oxalobacter formigenes
           OXCC13]
 gi|229380945|gb|EEO31036.1| phosphopantetheine adenylyltransferase [Oxalobacter formigenes
           OXCC13]
          Length = 162

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 56/167 (33%), Positives = 98/167 (58%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A    ++L++ +  + VK   F S++ER ++ K+ + 
Sbjct: 1   MVIAVYPGTFDPLTRGHEDLVRRASGLFDELIVGVADSRVKKPFF-SMEERMQIAKEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+       V V SF GL  +  +  +A VI+RGLR ++DF+YE +M  +NR L PE  T
Sbjct: 60  HYPN-----VRVESFTGLLKDFVRVHNASVIIRGLRAVSDFEYEFQMAGMNRYLMPEAET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + +   +  ++++ T++R +  +  D++ FV   V  +LK  VI + 
Sbjct: 115 LFMTPSDQYQFISGTIVREIAFLGGDVSKFVFPSVEKWLKKKVIEMK 161


>gi|163814171|ref|ZP_02205563.1| hypothetical protein COPEUT_00325 [Coprococcus eutactus ATCC 27759]
 gi|158450620|gb|EDP27615.1| hypothetical protein COPEUT_00325 [Coprococcus eutactus ATCC 27759]
          Length = 162

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 57/167 (34%), Positives = 94/167 (56%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A+Y GSFDP+T GH+DII ++    ++L + +  N+ KT  F S+ ER  ++K  + 
Sbjct: 1   MSRAIYPGSFDPVTLGHLDIIKRSAEMFDELTVGVLNNTAKTPLF-SLDERVNMLKNVVS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V+ F GL V+ A+    +VIVRGLR +TDF+YE+++   NR + P+I T
Sbjct: 60  DIPNVK-----VVGFGGLLVDYARQNDIKVIVRGLRAVTDFEYELQIAQSNRKVAPDIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L       Y++S++++   S   D+  FVP+P+   LK     + 
Sbjct: 115 VFLTTNIQYSYLSSSIVKEYASFGVDVKDFVPEPIQDILKERFADIR 161


>gi|209964381|ref|YP_002297296.1| phosphopantetheine adenylyltransferase [Rhodospirillum centenum SW]
 gi|226709012|sp|B6ISP7|COAD_RHOCS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|209957847|gb|ACI98483.1| pantetheine-phosphate adenylyltransferase [Rhodospirillum centenum
           SW]
          Length = 183

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 93/165 (56%), Gaps = 2/165 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
            R  VY G+FDPITNGH DII +A   V+ L++ +  N+ K   F + + R E+++  + 
Sbjct: 5   KRIGVYPGTFDPITNGHFDIIQRATLVVDHLIVGVARNAGKGPLFSTDE-RVEMVRDELP 63

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H     +    V +F+ L ++ A ++ AQVI+RGLR ++DF+YE +M  +N  L P++ T
Sbjct: 64  HISTHGATVE-VRAFDSLLMHFAVEMGAQVIIRGLRAVSDFEYEFQMAGMNHRLNPQVET 122

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A +  ++++S  ++ +  +  DI  FV   V   L +    
Sbjct: 123 LFLMASDRHQFISSRFVKEIGRLGGDIRPFVSPRVAKRLLSRFAQ 167


>gi|163760252|ref|ZP_02167335.1| phosphopantetheine adenylyltransferase [Hoeflea phototrophica
           DFL-43]
 gi|162282651|gb|EDQ32939.1| phosphopantetheine adenylyltransferase [Hoeflea phototrophica
           DFL-43]
          Length = 182

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 69/165 (41%), Positives = 101/165 (61%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A Y GSFDP+TNGH+D++ QAL+  ++LVI IG +  K   F S  ER+ +I   + 
Sbjct: 18  MRTAFYPGSFDPMTNGHIDVLEQALALCDELVIGIGVHPGKAPLF-SFDERASMISHVVQ 76

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
              P     V+VISF+GL ++ A    A V+VRGLRD TD DYEM+M  +NR + P+I T
Sbjct: 77  SEFPLRFETVTVISFDGLVIDAASQAGATVLVRGLRDGTDLDYEMQMAGMNRAMAPDITT 136

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           +   A   +R++T+TL+R +  +  D++ FVP+ V   L   +  
Sbjct: 137 VFAPAFPQTRHITATLVRQIAKMGGDVSPFVPELVQKALAARIAE 181


>gi|51246626|ref|YP_066510.1| phosphopantetheine adenylyltransferase [Desulfotalea psychrophila
           LSv54]
 gi|61212564|sp|Q6AJH7|COAD_DESPS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|50877663|emb|CAG37503.1| probable phosphopantetheine adenylyltransferase [Desulfotalea
           psychrophila LSv54]
          Length = 170

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 60/162 (37%), Positives = 90/162 (55%), Gaps = 4/162 (2%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
             VY G+FDPITNGH+DII +AL+  + +++AI  N  K   F S +ER E+I+     F
Sbjct: 12  IGVYPGTFDPITNGHIDIIERALALFDTVIVAIAVNGQKQPLF-SGEERKEMIE---KCF 67

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
             +    +  I   GL VN A +  A+ I+RGLR ++DFDYE ++  +NR L  E+ +I 
Sbjct: 68  EKEKGRIIVKIVPSGLLVNFAVEQGARAIIRGLRAVSDFDYEFQLALMNRKLVREVESIF 127

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           L       Y++S+LI+ +     DI+  VP  V   L+    
Sbjct: 128 LMTAFRWIYISSSLIKDVSKNGGDISDLVPKHVERLLEEKYR 169


>gi|156741788|ref|YP_001431917.1| phosphopantetheine adenylyltransferase [Roseiflexus castenholzii
           DSM 13941]
 gi|189082584|sp|A7NK79|COAD_ROSCS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|156233116|gb|ABU57899.1| pantetheine-phosphate adenylyltransferase [Roseiflexus castenholzii
           DSM 13941]
          Length = 160

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 51/166 (30%), Positives = 87/166 (52%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDP+TNGH+DI  +A    + +++A+     K   F + + R  L+++S  
Sbjct: 1   MTIAVYPGSFDPVTNGHLDIAARASRIFDTVIMAVFDRPNKQLLFSTDE-RVALLRESTR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V ++  L V+  + + A VIVRG+R + DF+ E ++  +N+ L P+I  
Sbjct: 60  HLPRVK-----VDTYSTLTVDYVRSVGASVIVRGMRAVGDFEAEFQLAQINQTLAPDIDI 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           +   A     + +S+ +R + S+  D++  VP PV   LK +    
Sbjct: 115 VLFMASHRYTFFSSSTVREIASLGGDVSWLVPGPVVDALKRVYGRR 160


>gi|110802807|ref|YP_699015.1| phosphopantetheine adenylyltransferase [Clostridium perfringens
           SM101]
 gi|123047307|sp|Q0SS92|COAD_CLOPS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|110683308|gb|ABG86678.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           SM101]
          Length = 164

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 61/167 (36%), Positives = 97/167 (58%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY GSFDPIT GH+D+I +A S  + +++A+  N  K   F SI+ER  LI++ + 
Sbjct: 1   MRVGVYPGSFDPITKGHLDLIERAASKFDKVIVAVLININKKGMF-SIEERVNLIEKCVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +         V SF GL ++  +   A VI++GLR +TDF+YE +M  +NR L  E+ T
Sbjct: 60  KYNNVE-----VKSFNGLLIDFVRKEKADVIIKGLRSVTDFEYEFQMALMNRELANEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + +    +  Y++S+ I+ + S   +I +FVP  +   L+  +ISL 
Sbjct: 115 VFMVTSPNYSYISSSAIKQVASFSGEIKNFVPKEIVEDLEERIISLR 161


>gi|226951206|ref|ZP_03821670.1| phosphopantetheine adenylyltransferase [Acinetobacter sp. ATCC
           27244]
 gi|294649584|ref|ZP_06727003.1| antetheine-phosphate adenylyltransferase [Acinetobacter
           haemolyticus ATCC 19194]
 gi|226838036|gb|EEH70419.1| phosphopantetheine adenylyltransferase [Acinetobacter sp. ATCC
           27244]
 gi|292824523|gb|EFF83307.1| antetheine-phosphate adenylyltransferase [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 163

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 55/158 (34%), Positives = 92/158 (58%), Gaps = 6/158 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
             + +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER EL K S+ 
Sbjct: 3   KTRVIYPGTFDPITNGHVDLVARASKMFDEVVVAIAIGHHKNPVF-SLEERVELAKISLS 61

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H           + F+GL VN  ++  A  ++RGLR ++DF+YE ++ ++NR L P+  +
Sbjct: 62  HLDNVE-----FVGFDGLLVNFFREQRATAVLRGLRAISDFEYEFQLANMNRQLDPQFES 116

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVF 159
           + L   E   +++STL+R +  +  D+T FVP  V   
Sbjct: 117 VFLTPSEQYSFISSTLVREIARLKGDVTKFVPAVVVEA 154


>gi|332159690|ref|YP_004296267.1| phosphopantetheine adenylyltransferase [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|318603789|emb|CBY25287.1| phosphopantetheine adenylyltransferase [Yersinia enterocolitica
           subsp. palearctica Y11]
 gi|325663920|gb|ADZ40564.1| phosphopantetheine adenylyltransferase [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330859993|emb|CBX70321.1| phosphopantetheine adenylyltransferase [Yersinia enterocolitica
           W22703]
          Length = 159

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 90/165 (54%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+ KA+Y G+FDPITNGH+D++ +A      +++AI  +S K   F   +      +  +
Sbjct: 1   MITKAIYPGTFDPITNGHLDLVTRASEMFSHVILAIADSSSKKPMFTLAE------RVVL 54

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +      V V+ F  L    AK   A ++VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 55  AKQVTAQLKNVEVLGFSELMAEFAKKHDANILVRGLRSVSDFEYEWQLANMNRHLMPKLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E   +++S+L++ +     DIT F+P PV   L   + 
Sbjct: 115 SVFLMPSEKWSFISSSLVKEVARHGGDITPFLPAPVTKALMTKLA 159


>gi|297539219|ref|YP_003674988.1| pantetheine-phosphate adenylyltransferase [Methylotenera sp. 301]
 gi|297258566|gb|ADI30411.1| pantetheine-phosphate adenylyltransferase [Methylotenera sp. 301]
          Length = 163

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 46/164 (28%), Positives = 90/164 (54%), Gaps = 6/164 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPIT GH DI+ +A    + +++A+  ++ K   F   +      + ++  
Sbjct: 5   RIAVYPGTFDPITLGHEDIVRRAADLFDQVIVAVAGSTNKKTLFNLDE------RVALAK 58

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
            +   ++ + V+ F GL +   +D  A++++RGLR  +DF+YE ++  +NR L P+  T+
Sbjct: 59  SVFKHADNIRVVGFSGLLMQFVQDQGAKMVIRGLRAASDFEYEFQLAGMNRKLYPQFETL 118

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            L   E   +++S+L+R +  +  ++ +FV   V   +   + S
Sbjct: 119 FLTPSEQFMFISSSLVREVAVLGGNVHAFVSPTVDDAINEKLGS 162


>gi|290957123|ref|YP_003488305.1| phosphopantetheine adenylyltransferase [Streptomyces scabiei 87.22]
 gi|260646649|emb|CBG69746.1| putative phosphopantetheine adenylyltransferase [Streptomyces
           scabiei 87.22]
          Length = 159

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 90/165 (54%), Gaps = 7/165 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GSFDPITNGH+DII +A    +++ +A+  N  K   F  ++ER ELI++   
Sbjct: 1   MRRAVCPGSFDPITNGHLDIIGRASKLYDEVYVAVMINKSKKGLFE-VEERMELIREVTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +       V V +F GL V+  K      IV+GLR ++DFDYE++M  +N      + T
Sbjct: 60  EYAN-----VRVEAFHGLLVDFCKQRDIPAIVKGLRAVSDFDYELQMAQMN-IGLSGVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + +    +  +++S+L++ + +   D++  VP  V   L   +  
Sbjct: 114 LFVPTNPTYSFLSSSLVKEVATWGGDVSHLVPPLVLEALGERLKR 158


>gi|222529218|ref|YP_002573100.1| phosphopantetheine adenylyltransferase [Caldicellulosiruptor bescii
           DSM 6725]
 gi|254763923|sp|B9MRM3|COAD_ANATD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|222456065|gb|ACM60327.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           bescii DSM 6725]
          Length = 167

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 57/156 (36%), Positives = 92/156 (58%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  VY GSFDP+TNGH+DII +A    + L++A+  N  KT  F  I+ER EL+K++  
Sbjct: 1   MKIGVYPGSFDPVTNGHLDIIERASKIFDKLIVAVLVNPNKTPVF-DIEERVELLKETTE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V +F+GL ++  K  +A+VIV+GLR ++DF+YE +M  +N+ L P I T
Sbjct: 60  HLPNVE-----VKAFKGLLIDFMKQENAKVIVKGLRAVSDFEYEFQMALLNKKLEPSIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I +       Y++S++++ +      I   VP+ + 
Sbjct: 115 IFMMTNSKYSYLSSSMVKEVARFGGCIEDLVPEKIA 150


>gi|189500058|ref|YP_001959528.1| phosphopantetheine adenylyltransferase [Chlorobium phaeobacteroides
           BS1]
 gi|229488130|sp|B3EQL4|COAD_CHLPB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|189495499|gb|ACE04047.1| pantetheine-phosphate adenylyltransferase [Chlorobium
           phaeobacteroides BS1]
          Length = 165

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 56/168 (33%), Positives = 88/168 (52%), Gaps = 5/168 (2%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y G+FDP TNGH+D++ +AL+  + + I +  NS K+  F ++ ER  +I++  
Sbjct: 1   MERLAIYPGTFDPFTNGHLDVLERALTIFDKVYIVLAENSKKSSLF-TVDERCSMIREIT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 S   +      GL    A  + A  IVRGLR + DF+YE +++ +NR L PE+ 
Sbjct: 60  ASTSGVSVEVLH----GGLLAEYAHSVGATAIVRGLRQVKDFEYEFQLSLLNRHLNPEVT 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           T+ L       YV S++IR +  +  D++ FV   V   LK       
Sbjct: 116 TVFLMPNVKYTYVASSIIREVALLGGDVSKFVHPCVLAMLKKKYEEQN 163


>gi|119713190|gb|ABL97258.1| putative phosphopantetheine adenylyltransferase [uncultured marine
           bacterium EB0_50A10]
          Length = 160

 Score =  158 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 63/164 (38%), Positives = 93/164 (56%), Gaps = 5/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDPIT GHMDII +     + +V+AI  +  K   F S+++R  L      
Sbjct: 1   MRVAIYPGSFDPITYGHMDIIDRGCGLFDKVVVAIAKSESKNPMF-SLEDRINLA----T 55

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               ++     V     L V+LAKD  A  I+RGLR ++DF+YE ++ ++NR L P+I +
Sbjct: 56  SIYENNDMVEVVGFPRKLTVDLAKDYGACAIIRGLRAVSDFEYEFQLATMNRSLAPDIES 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           I L  KES  YV+S+LI+ +  +  DI+ FV   V   L+  + 
Sbjct: 116 IFLTPKESLIYVSSSLIKEISDLKGDISKFVHPTVEQALRAKLD 159


>gi|319764116|ref|YP_004128053.1| pantetheine-phosphate adenylyltransferase [Alicycliphilus
           denitrificans BC]
 gi|330823609|ref|YP_004386912.1| pantetheine-phosphate adenylyltransferase [Alicycliphilus
           denitrificans K601]
 gi|317118677|gb|ADV01166.1| pantetheine-phosphate adenylyltransferase [Alicycliphilus
           denitrificans BC]
 gi|329308981|gb|AEB83396.1| pantetheine-phosphate adenylyltransferase [Alicycliphilus
           denitrificans K601]
          Length = 162

 Score =  158 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 53/163 (32%), Positives = 84/163 (51%), Gaps = 6/163 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            AVY G+FDPIT GH D++ +A    + +++A+     K   F S+ ER ++ ++++   
Sbjct: 5   VAVYPGTFDPITLGHEDLVRRAAQLFDRVIVAVAIAHHKKTLF-SLDERMDMAREALSDC 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                 +V V  FEGL            +VRGLR  TDFDYE ++  +NR L P+I T+ 
Sbjct: 64  P-----QVRVEPFEGLVTEFTAARGGTAMVRGLRSGTDFDYEFQLAGMNRALVPQIETVF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           L      ++++STL+R +  +  D+  FV   V   L   V  
Sbjct: 119 LTPSSQYQFISSTLVREIAMLGGDVAQFVSPTVLQRLLAKVGK 161


>gi|254414187|ref|ZP_05027954.1| pantetheine-phosphate adenylyltransferase [Microcoleus
           chthonoplastes PCC 7420]
 gi|196178862|gb|EDX73859.1| pantetheine-phosphate adenylyltransferase [Microcoleus
           chthonoplastes PCC 7420]
          Length = 184

 Score =  158 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 53/157 (33%), Positives = 88/157 (56%), Gaps = 6/157 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y GSFDPIT GH+DII ++    E +++A+  N  K+  F +IQER + I+    H 
Sbjct: 2   IAIYPGSFDPITLGHLDIIERSCKLFETVIVAVLRNPSKSPLF-TIQERVQQIRGCTQHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    + SF GL V+ AK  +AQV++RGLR ++DF+ E++M   N+ L  EI T+ 
Sbjct: 61  SNVE-----IDSFTGLTVDYAKLKNAQVLLRGLRVLSDFEKELQMAHTNQTLWDEIETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           L       +++S++++ +      +   VP  V + +
Sbjct: 116 LATSNEYSFLSSSVVKEIAKFGGSVNHLVPPQVALDI 152


>gi|311898532|dbj|BAJ30940.1| putative phosphopantetheine adenylyltransferase [Kitasatospora
           setae KM-6054]
          Length = 161

 Score =  158 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 54/167 (32%), Positives = 87/167 (52%), Gaps = 7/167 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GSFDPITNGH+DII +A    + + +A+  N  K   F SI ER  LI ++  
Sbjct: 1   MRRAVCPGSFDPITNGHLDIIERASKLYDVVHVAVLINRNKQGMF-SIDERIALIAETTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V S  GL V+  ++     I++GLR   DFDYE++M  +N      + T
Sbjct: 60  HLGNIE-----VESHSGLLVDFCRERGIPAIIKGLRAAGDFDYELQMAQMN-HGLTGVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + +    +  +++S+L++ + S+  D++  +PD V   L   +    
Sbjct: 114 LFVPTSPTYSFLSSSLVKEVASLGGDVSHLLPDTVHRRLIERIAERR 160


>gi|302342193|ref|YP_003806722.1| pantetheine-phosphate adenylyltransferase [Desulfarculus baarsii
           DSM 2075]
 gi|301638806|gb|ADK84128.1| pantetheine-phosphate adenylyltransferase [Desulfarculus baarsii
           DSM 2075]
          Length = 164

 Score =  158 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 61/167 (36%), Positives = 93/167 (55%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDPITNGH+ I+ +AL     +V+AIG NS K   F ++ ER E+I     
Sbjct: 1   MTLAVYPGSFDPITNGHLSILRRALEIFPRIVVAIGRNSEKKSLF-TVDERLEII----- 54

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +  + N V   SF+GL ++    + + V++RG+R M+DF+YE +M  +NR +  ++ T
Sbjct: 55  GEVTRNMNGVRAESFDGLLMDYVTGLGSNVVLRGMRAMSDFEYEFQMALMNRKINKDVQT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L       YV+ST+I+   S+  +I+  VP  V   L      L 
Sbjct: 115 VFLMTDYKWFYVSSTIIKEAASLGGNISGLVPQLVERRLAEKFAQLR 161


>gi|254434817|ref|ZP_05048325.1| pantetheine-phosphate adenylyltransferase [Nitrosococcus oceani
           AFC27]
 gi|207091150|gb|EDZ68421.1| pantetheine-phosphate adenylyltransferase [Nitrosococcus oceani
           AFC27]
          Length = 175

 Score =  158 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 51/161 (31%), Positives = 91/161 (56%), Gaps = 6/161 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            AVY G+FDPIT GH D++ +A    E +++A+  + VK   F S++ER  + ++ +  +
Sbjct: 20  TAVYPGTFDPITRGHSDLVERAAPLFERIIVAVAASPVKAPCF-SLEERVSMAEEVLAGY 78

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V  F  L  + A+   A+V++RGLR ++DF+YE ++ ++NR L  E+ T+ 
Sbjct: 79  PSVE-----VRGFGVLLADFARSCGARVLLRGLRAVSDFEYEFQLANMNRHLVSEVETLF 133

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           L   E   Y++++L+R + ++  DI+ FV   V   L   +
Sbjct: 134 LTPAEQYAYISASLVREVAALGGDISPFVHPRVATALAEKL 174


>gi|77165397|ref|YP_343922.1| coenzyme A biosynthesis protein [Nitrosococcus oceani ATCC 19707]
 gi|76883711|gb|ABA58392.1| Phosphopantetheine adenylyltransferase [Nitrosococcus oceani ATCC
           19707]
          Length = 160

 Score =  158 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 51/161 (31%), Positives = 91/161 (56%), Gaps = 6/161 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            AVY G+FDPIT GH D++ +A    E +++A+  + VK   F S++ER  + ++ +  +
Sbjct: 5   TAVYPGTFDPITRGHSDLVERAAPLFERIIVAVAASPVKAPCF-SLEERVSMAEEVLAGY 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V  F  L  + A+   A+V++RGLR ++DF+YE ++ ++NR L  E+ T+ 
Sbjct: 64  PSVE-----VRGFGVLLADFARSCGARVLLRGLRAVSDFEYEFQLANMNRHLVSEVETLF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           L   E   Y++++L+R + ++  DI+ FV   V   L   +
Sbjct: 119 LTPAEQYAYISASLVREVAALGGDISPFVHPRVATALAEKL 159


>gi|299136481|ref|ZP_07029664.1| pantetheine-phosphate adenylyltransferase [Acidobacterium sp.
           MP5ACTX8]
 gi|298600996|gb|EFI57151.1| pantetheine-phosphate adenylyltransferase [Acidobacterium sp.
           MP5ACTX8]
          Length = 163

 Score =  158 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 61/164 (37%), Positives = 98/164 (59%), Gaps = 5/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+D+I +    V+ LV+AI  NS K     +  ER E+I+++ 
Sbjct: 1   MQTKAIYPGTFDPLTNGHLDLIARGAKIVDQLVVAILRNSEKGAPLFTASEREEMIREAT 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 S     V +F+GL V+ A+   A+ ++RG+R ++D++YE +M  +NR L PE+ 
Sbjct: 61  LGLGNVS-----VATFDGLLVDFARSQGAKAVLRGIRAVSDYEYEFQMAMMNRKLDPELE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           T+ +   E   YV+S LI+ +  +  D++S VP  V   LK+ V
Sbjct: 116 TLFMMPAEKYTYVSSRLIKGVFHLGGDVSSLVPPLVMDRLKSKV 159


>gi|302871971|ref|YP_003840607.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302574830|gb|ADL42621.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 168

 Score =  158 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 56/156 (35%), Positives = 92/156 (58%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  VY GSFDP+TNGH+DII +A    + L++A+  N  KT  F  I+ER EL+K++  
Sbjct: 1   MKIGVYPGSFDPVTNGHLDIIERASKIFDKLIVAVLVNPNKTPVF-DIEERVELLKETTE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          + +F+GL ++  K  +A+VIV+GLR ++DF+YE +M  +N+ L P I T
Sbjct: 60  HLPNVE-----IKAFKGLLIDFMKQENAKVIVKGLRAVSDFEYEFQMALLNKKLEPSIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I +       Y++S++++ +      I   VP+ + 
Sbjct: 115 IFMMTNSKYSYLSSSMVKEVARFGGCIEDLVPEKIA 150


>gi|309389037|gb|ADO76917.1| Phosphopantetheine adenylyltransferase [Halanaerobium praevalens
           DSM 2228]
          Length = 162

 Score =  158 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 59/168 (35%), Positives = 92/168 (54%), Gaps = 6/168 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +K VY GSFDP+TNGH+DI+ +A +  +++++++  N  KT  F +++ER E++K S 
Sbjct: 1   MSKKIVYPGSFDPVTNGHLDIVKRAANIFDEVIVSVFNNPNKTPVF-TMEERVEMLKNST 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V SF GL     K I    I+RGLR ++DF+ E +M S+N+ L   I 
Sbjct: 60  RELENVK-----VDSFSGLTTKYIKSIGGDAILRGLRAVSDFEGEFQMASMNKHLDENIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           TI L       +++S++I+     D DI   VP+ V   L+N  I   
Sbjct: 115 TIFLMTDTKYAFLSSSVIKEAAYFDGDIKELVPNFVYHKLRNKFIEKN 162


>gi|148653803|ref|YP_001280896.1| pantetheine-phosphate adenylyltransferase [Psychrobacter sp.
           PRwf-1]
 gi|148572887|gb|ABQ94946.1| pantetheine-phosphate adenylyltransferase [Psychrobacter sp.
           PRwf-1]
          Length = 169

 Score =  158 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 55/161 (34%), Positives = 87/161 (54%), Gaps = 6/161 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
            K VY G+FDPITNGH D++ +A+   +++VIA+     K   F S +ER EL++     
Sbjct: 9   TKVVYPGTFDPITNGHRDLVKRAVKLFDEVVIAVALGHHKKPMF-SFEERVELVESVFED 67

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               S     V+ FEGL V   ++  A  ++RGLR M+DF+YE ++ ++NR L      +
Sbjct: 68  LPQVS-----VVGFEGLLVEFMREQQATAVLRGLRAMSDFEYEFQLANMNRELDENFEAV 122

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            L       +++ST+IR +  ++ D+  FVP  V     N 
Sbjct: 123 FLTPAPEYSFISSTMIREIAKLNGDVDKFVPVCVQKAFDNK 163


>gi|87200266|ref|YP_497523.1| coenzyme A biosynthesis protein [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87135947|gb|ABD26689.1| Coenzyme A biosynthesis protein [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 170

 Score =  158 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 54/167 (32%), Positives = 84/167 (50%), Gaps = 4/167 (2%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R  VY G+FDPIT GH+DII +    V+ L+I +  N  K   F   +    + ++    
Sbjct: 4   RIGVYPGTFDPITLGHLDIIRRGAKLVDKLIIGVTTNPSKNPMFTPDERMDSVRREVAAQ 63

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                 + V V+ F  L +  A+   A VIVRGLR + DF+YE +M  +N+ L  EI T+
Sbjct: 64  ----GIDNVEVVGFNALLMKFARAQGASVIVRGLRAVADFEYEYQMAGMNQQLDAEIETV 119

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
            L A  S + + S L++ +     DI+ FV   +   +   V S+ +
Sbjct: 120 FLMADVSLQPIASKLVKEIALFGGDISDFVTPTIRDEVVARVDSIGR 166


>gi|313201665|ref|YP_004040323.1| pantetheine-phosphate adenylyltransferase [Methylovorus sp. MP688]
 gi|312440981|gb|ADQ85087.1| pantetheine-phosphate adenylyltransferase [Methylovorus sp. MP688]
          Length = 171

 Score =  158 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 44/162 (27%), Positives = 89/162 (54%), Gaps = 6/162 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
             VY G+FDPIT GH DI+ +A    + +++A+  +  K+  F   +      + S+   
Sbjct: 11  TVVYPGTFDPITRGHEDIVRRAAGLFDRVIVAVAQSPGKSPFFGLDE------RVSMASE 64

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           +      V V+ F GL +   +   A+V++RGLR ++DF+YE ++  +NR + P++ T+ 
Sbjct: 65  VLQDCPNVHVMGFSGLLMEFVQAQGARVVIRGLRAVSDFEYEFQLAGMNRNMFPQVETLF 124

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           L   E   +++++L+R +  ++ D+++FV   V   ++  + 
Sbjct: 125 LTPAEQYMFISASLVREIARLNGDVSNFVSPLVQAHIQCKLD 166


>gi|94967598|ref|YP_589646.1| phosphopantetheine adenylyltransferase [Candidatus Koribacter
           versatilis Ellin345]
 gi|94549648|gb|ABF39572.1| Phosphopantetheine adenylyltransferase [Candidatus Koribacter
           versatilis Ellin345]
          Length = 167

 Score =  158 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 50/157 (31%), Positives = 83/157 (52%), Gaps = 6/157 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
             +Y GSFDP+TNGH+D+I +     ++LV+AI  N  K   F   + R  L + +    
Sbjct: 9   IGIYPGSFDPVTNGHLDLIHRGAKIFDELVVAILRNPEKDPLFTVPERREMLQEMTK--- 65

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
              +   V V  F+GL V+ A+   A  ++RG+R ++D++YE +M  +NR L   + TI 
Sbjct: 66  ---NLPNVRVDEFQGLMVDYARSQGAAAVLRGIRAISDYEYEFQMALMNRKLDSTLETIF 122

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           +   E   Y++S L+R +  +   +   VP+ V   L
Sbjct: 123 MMPAEKYSYLSSRLVREVARLGGSVDGLVPEMVVQKL 159


>gi|123440467|ref|YP_001004461.1| phosphopantetheine adenylyltransferase [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|166216618|sp|A1JHR9|COAD_YERE8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|122087428|emb|CAL10209.1| phosphopantetheine adenylyltransferase [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 159

 Score =  158 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 93/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+ KA+Y G+FDPITNGH+D++ +A      +++AI  +S K   F ++ ER  L KQ  
Sbjct: 1   MITKAIYPGTFDPITNGHLDLVTRASEMFSHVILAIADSSSKKPMF-TLAERVILAKQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V+ F  L    AK  +A ++VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  APLKNVE-----VLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E   +++S+L++ +     DIT F+P PV   L   + 
Sbjct: 115 SVFLMPSEKWSFISSSLVKEVARHGGDITPFLPAPVTKALMTKLA 159


>gi|254780181|ref|YP_003064594.1| phosphopantetheine adenylyltransferase [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039858|gb|ACT56654.1| phosphopantetheine adenylyltransferase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 182

 Score =  158 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 182/182 (100%), Positives = 182/182 (100%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI
Sbjct: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
           FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA
Sbjct: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTI 180
           TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTI
Sbjct: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTI 180

Query: 181 FS 182
           FS
Sbjct: 181 FS 182


>gi|47779379|gb|AAT38608.1| predicted phosphopantetheine adenylyltransferase [uncultured gamma
           proteobacterium eBACHOT4E07]
          Length = 160

 Score =  158 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 63/165 (38%), Positives = 97/165 (58%), Gaps = 5/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDPIT GHMDII +A    + ++IAI  +  K   F S+++R +L      
Sbjct: 1   MKVAIYPGSFDPITFGHMDIIDRASGLFDKIIIAIAKSETKNPLF-SLEDRIKLA----N 55

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               D+     +     L V++AK+ +A  I+RGLR ++DF+YE ++ ++NR L P+I +
Sbjct: 56  TIYKDNDKVDVIGFPRQLTVDVAKEHNACAIIRGLRAVSDFEYEFQLATMNRSLAPDIES 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           I L  KES  YV+S+LI+ +  +  DI+ FV   V   LK  + S
Sbjct: 116 IFLTPKESLIYVSSSLIKEICDLKGDISKFVHPSVEQALKAKLDS 160


>gi|148656731|ref|YP_001276936.1| phosphopantetheine adenylyltransferase [Roseiflexus sp. RS-1]
 gi|166216597|sp|A5UWI3|COAD_ROSS1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|148568841|gb|ABQ90986.1| Phosphopantetheine adenylyltransferase [Roseiflexus sp. RS-1]
          Length = 160

 Score =  158 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 87/166 (52%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDP+TNGH+DI  +A    + +++A+     K   F S +ER  L+++S  
Sbjct: 1   MTIAVYPGSFDPVTNGHLDIAARASRIFDTVIMAVFDRPNKQLLF-STEERVALLRESTR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V ++  L V+  + + A VIVRG+R + DF+ E ++  +N+ L P+I  
Sbjct: 60  HLPRVK-----VDTYSTLTVDYVRSVGASVIVRGMRAVGDFEAEFQLAQINQTLAPDIDI 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           +   A     + +S+ +R + S+  D++  VP PV   LK      
Sbjct: 115 VLFMASHRYTFFSSSTVREIASLGGDVSWLVPGPVVEALKRAYGRR 160


>gi|167402125|ref|ZP_02307602.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167048500|gb|EDR59908.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Antiqua str. UG05-0454]
          Length = 172

 Score =  158 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+ KA+Y G+FDPITNGH+D++ +A +    +++AI  +S K   F ++ ER  L K+  
Sbjct: 14  MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPMF-TLDERVALAKKVT 72

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V+ F  L    AK  +A ++VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 73  APLKNVE-----VLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLE 127

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E   +++S+L++ +     DIT F+P PV   L   + 
Sbjct: 128 SVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA 172


>gi|168698838|ref|ZP_02731115.1| phosphopantetheine adenylyltransferase [Gemmata obscuriglobus UQM
           2246]
          Length = 167

 Score =  157 bits (398), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 61/161 (37%), Positives = 95/161 (59%), Gaps = 6/161 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVYTG+FDP+  GH+D+I +     + L++ +G N  K   F +I+ER  LI+     
Sbjct: 9   RIAVYTGTFDPVHYGHLDVIERGSKLFDKLIVGVGINPDKKTLF-TIEERVRLIETVAAG 67

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
           +         V SFEGLAV   +D  A++++RGLR ++D +YE  M+ +N    P I T+
Sbjct: 68  WPNVE-----VQSFEGLAVRFVRDSGARIMLRGLRTLSDMEYEFTMSLMNLAQDPAIETL 122

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            L AKE   +V+S+L+R + ++D ++T F+P PV   LK  
Sbjct: 123 FLMAKEEFSHVSSSLLRQIAALDGNLTKFLPQPVLDALKER 163


>gi|308173467|ref|YP_003920172.1| phosphopantetheine adenylyltransferase [Bacillus amyloliquefaciens
           DSM 7]
 gi|307606331|emb|CBI42702.1| phosphopantetheine adenylyltransferase [Bacillus amyloliquefaciens
           DSM 7]
 gi|328553603|gb|AEB24095.1| phosphopantetheine adenylyltransferase [Bacillus amyloliquefaciens
           TA208]
 gi|328911603|gb|AEB63199.1| phosphopantetheine adenylyltransferase [Bacillus amyloliquefaciens
           LL3]
          Length = 160

 Score =  157 bits (398), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 90/165 (54%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDP+T GH+DII +  +  E + + +  NS K   F +++ER EL+++  
Sbjct: 1   MASIAVCPGSFDPVTYGHLDIIRRGANVFEQVYVCVLNNSSKQPLF-TVEERCELLREVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +     V + +GL ++ AK   A+ I+RGLR ++DF+YEM+ TSVNR L   I 
Sbjct: 60  KDIPNIT-----VETSQGLLIDYAKKKQAKAIIRGLRAVSDFEYEMQGTSVNRVLDESIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T  +       +++S++++ +   +  ++ FVP  V   L+    
Sbjct: 115 TFFMMTNNQYSFLSSSIVKEVAKYNGPVSEFVPPEVEQALQQKFK 159


>gi|257439025|ref|ZP_05614780.1| pantetheine-phosphate adenylyltransferase [Faecalibacterium
           prausnitzii A2-165]
 gi|257198515|gb|EEU96799.1| pantetheine-phosphate adenylyltransferase [Faecalibacterium
           prausnitzii A2-165]
          Length = 167

 Score =  157 bits (398), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 58/167 (34%), Positives = 90/167 (53%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDP+T GH+DII +A    + L++A+  NS K   F +++ER  L+++   
Sbjct: 1   MATAVYPGSFDPVTRGHLDIIKRAAKINDHLIVAVLINSAKHPLF-TVEERVALLQECCK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +     V SF+GL V  AK   A V+VRGLR +TDF+ E+++   N  L P I T
Sbjct: 60  GIPNVT-----VESFDGLTVEFAKKRHASVMVRGLRAVTDFENEIQLAQTNHALMPGIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L       Y++ST+++      + I+ FV   V   ++  +  L 
Sbjct: 115 MFLATSIKWSYLSSTIVKEAARYGSSISKFVTPNVEAAVEQKMAELR 161


>gi|226325133|ref|ZP_03800651.1| hypothetical protein COPCOM_02925 [Coprococcus comes ATCC 27758]
 gi|225206481|gb|EEG88835.1| hypothetical protein COPCOM_02925 [Coprococcus comes ATCC 27758]
          Length = 159

 Score =  157 bits (398), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 59/165 (35%), Positives = 99/165 (60%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A+Y GSFDP+T GH+DII ++   V++L+I +  N  KT  F S++ER +++K+   
Sbjct: 1   MIRAIYPGSFDPVTFGHLDIITRSSKIVDELIIGVLMNKAKTPLF-SVEERVKMLKEVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V+ F+GL V  A+   A++++RGLR +TDF+YE++M+  N  L PE+ T
Sbjct: 60  DLGNVK-----VVPFDGLLVEFARQQKARLVIRGLRAITDFEYEIQMSQTNHKLEPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L       Y++ST++R + +   DI+ FVP+ V   +K  +  
Sbjct: 115 MFLTTNLKYSYLSSTIVREVAAFGGDISQFVPETVAKSIKEKMSQ 159


>gi|118580606|ref|YP_901856.1| pantetheine-phosphate adenylyltransferase [Pelobacter propionicus
           DSM 2379]
 gi|118503316|gb|ABK99798.1| Phosphopantetheine adenylyltransferase [Pelobacter propionicus DSM
           2379]
          Length = 160

 Score =  157 bits (398), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 58/164 (35%), Positives = 95/164 (57%), Gaps = 7/164 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + AVY GSFDPIT GH+DII + L   +++++A+ CNS K   F SI+ER  LI++ +
Sbjct: 1   MKKIAVYPGSFDPITYGHLDIINRGLKVFDEIIVAVACNSQKKSLF-SIEERMALIRRVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                    RV V +F GL ++     +A VI+RGLR ++DF+YE ++  +N  L  +I 
Sbjct: 60  DQD------RVRVDTFTGLLIDYVTRQNADVIIRGLRAISDFEYEFQIAQMNSSLGHDIE 113

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           T+ +       Y++S++++ +  +  +I  FVP  V   L+   
Sbjct: 114 TLFMMTSLQYGYLSSSIVKEVCGLRGNIDGFVPPEVKSALRLKY 157


>gi|226227293|ref|YP_002761399.1| phosphopantetheine adenylyltransferase [Gemmatimonas aurantiaca
           T-27]
 gi|226090484|dbj|BAH38929.1| phosphopantetheine adenylyltransferase [Gemmatimonas aurantiaca
           T-27]
          Length = 188

 Score =  157 bits (398), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 56/167 (33%), Positives = 96/167 (57%), Gaps = 6/167 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y GSFDPIT+GH D+I + L+F + L++A+  N  K   F S+ ER   I++ +    
Sbjct: 27  ALYAGSFDPITHGHDDLIKRTLTFADRLIVAVANNVNKQPLF-SVDERMHFIREVMADDP 85

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                   + SF GL V+ A+++ A+V VRGLR ++DF+YE ++  +NR L P++ TI +
Sbjct: 86  RIE-----IRSFSGLLVDFAREVGARVNVRGLRAVSDFEYEFQIALMNRHLYPDLETIFM 140

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYD 171
                + Y++S+++R +     D+T  V   V   ++    +L + D
Sbjct: 141 TPSLDTTYISSSMVREVARFGGDVTGLVHPLVADAMRERFAALQRGD 187


>gi|315178470|gb|ADT85384.1| phosphopantetheine adenylyltransferase [Vibrio furnissii NCTC
           11218]
          Length = 165

 Score =  157 bits (398), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 90/160 (56%), Gaps = 6/160 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D+I +A S  ++++IA+  +  K   F +++ER    K    H 
Sbjct: 8   RVIYPGTFDPITNGHLDLIERAASMFDEVIIAVAASPSKNTLF-TLEERVAFAKAVTSHL 66

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
              ++       F GL V+ AK   A V+VRGLR   DF+YE  +T++ R L P + ++ 
Sbjct: 67  DNVTAK-----GFSGLMVDFAKAEGATVLVRGLRTTVDFEYEFGLTNMYRRLMPGLESVF 121

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L   E   +++S+L+R +     ++ +FVP+ V   L + 
Sbjct: 122 LTPAEEYAFISSSLVREVAIHGGNVDAFVPELVANALHSK 161


>gi|262369413|ref|ZP_06062741.1| phosphopantetheine adenylyltransferase [Acinetobacter johnsonii
           SH046]
 gi|262315481|gb|EEY96520.1| phosphopantetheine adenylyltransferase [Acinetobacter johnsonii
           SH046]
          Length = 163

 Score =  157 bits (398), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 89/162 (54%), Gaps = 6/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
             + +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER  L K S+ 
Sbjct: 3   KTRVIYPGTFDPITNGHIDLVTRASRMFDEVVVAIAIGHHKNPLF-SLEERVSLAKASLS 61

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H           + F+GL VN  ++  A  ++RGLR ++DF+YE ++ ++NR L      
Sbjct: 62  HLDNVE-----FVGFDGLLVNFFREQKATAVLRGLRAVSDFEYEFQLANMNRQLDSHFEA 116

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           + L   E   +++STLIR +  +  D+T FVP  V    +  
Sbjct: 117 VFLTPSEQYSFISSTLIREIARLKGDVTKFVPQAVVAAFERK 158


>gi|260770734|ref|ZP_05879664.1| phosphopantetheine adenylyltransferase [Vibrio furnissii CIP
           102972]
 gi|260614315|gb|EEX39504.1| phosphopantetheine adenylyltransferase [Vibrio furnissii CIP
           102972]
          Length = 165

 Score =  157 bits (398), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 90/160 (56%), Gaps = 6/160 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D+I +A S  ++++IA+  +  K   F +++ER    K    H 
Sbjct: 8   RVIYPGTFDPITNGHLDLIERAASMFDEVIIAVAASPSKNTLF-TLEERVAFAKAVTSHL 66

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
              ++       F GL V+ AK   A V+VRGLR   DF+YE  +T++ R L P + ++ 
Sbjct: 67  DKVTAK-----GFSGLMVDFAKAEGATVLVRGLRTTVDFEYEFGLTNMYRRLMPGLESVF 121

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L   E   +++S+L+R +     ++ +FVP+ V   L + 
Sbjct: 122 LTPAEEYAFISSSLVREVAIHGGNVDAFVPELVANALHSK 161


>gi|254482653|ref|ZP_05095891.1| pantetheine-phosphate adenylyltransferase [marine gamma
           proteobacterium HTCC2148]
 gi|214037012|gb|EEB77681.1| pantetheine-phosphate adenylyltransferase [marine gamma
           proteobacterium HTCC2148]
          Length = 161

 Score =  157 bits (398), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 57/166 (34%), Positives = 95/166 (57%), Gaps = 8/166 (4%)

Query: 2   MRK--AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           MR    +Y G+FDPITNGH+D+  +A      +V+AI  +  KT  F  +++R  L + S
Sbjct: 1   MRTNTVIYPGTFDPITNGHVDLTERASRLFGRVVVAIAYSEKKTPLF-DLEQRIALCEAS 59

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           + H          V  F  L  + AK   A+ ++RGLR + DF+YE ++T++NR + PE 
Sbjct: 60  LSHLDNVE-----VTGFSNLLTDFAKSQDARCVLRGLRTVADFEYEFQLTNMNRAMFPEF 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
            ++ L   E   +++S+L+R + ++  DIT FVP+PV + L++   
Sbjct: 115 ESVFLTPSEHLSFISSSLVREIAALKGDITPFVPEPVALALQSRFA 160


>gi|149908606|ref|ZP_01897268.1| phosphopantetheine adenylyltransferase [Moritella sp. PE36]
 gi|149808440|gb|EDM68377.1| phosphopantetheine adenylyltransferase [Moritella sp. PE36]
          Length = 164

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 96/166 (57%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  K +Y G+FDP+TNGH D+I +A    + +++ +  N+ K   F  ++ER +L K   
Sbjct: 1   MTVKVIYPGTFDPVTNGHTDLIERAAKLFDHVIVGVAFNATKKPFF-DLKERVQLAKDVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F GL V+ AK+ +A V++RGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHLDNVE-----VVGFSGLLVDFAKEYNASVLIRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           ++ L   E + +++STL++ +   + D+  FV   VC  + + +  
Sbjct: 115 SVFLTPSEENSFISSTLVKEVAIHNGDVAQFVDPIVCQAILDKIAE 160


>gi|313901491|ref|ZP_07834942.1| Phosphopantetheine adenylyltransferase [Thermaerobacter
           subterraneus DSM 13965]
 gi|313468243|gb|EFR63706.1| Phosphopantetheine adenylyltransferase [Thermaerobacter
           subterraneus DSM 13965]
          Length = 163

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 56/155 (36%), Positives = 91/155 (58%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+  GSFDPITNGH+DII +A    + +++ +  NS K   F + +ER EL +Q+  
Sbjct: 1   MTIALCPGSFDPITNGHLDIIERASRLFDQVLVTVFINSSKQPWF-TPEERVELARQATA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H    S     V +++GL V  A+   A+VIV+GLR ++DF+YE +M  +N+ L  E+ T
Sbjct: 60  HLPNVS-----VDAYDGLLVEYARRKGARVIVKGLRAVSDFEYEFQMAQINKQLAGELET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + +  +  + Y++S++++ L     D    VPD V
Sbjct: 115 LFMMTRPENAYLSSSIVKELARYGVDPAGLVPDVV 149


>gi|121595809|ref|YP_987705.1| phosphopantetheine adenylyltransferase [Acidovorax sp. JS42]
 gi|222112009|ref|YP_002554273.1| phosphopantetheine adenylyltransferase [Acidovorax ebreus TPSY]
 gi|229488112|sp|A1WBK4|COAD_ACISJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254764151|sp|B9MF03|COAD_ACIET RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|120607889|gb|ABM43629.1| pantetheine-phosphate adenylyltransferase [Acidovorax sp. JS42]
 gi|221731453|gb|ACM34273.1| pantetheine-phosphate adenylyltransferase [Acidovorax ebreus TPSY]
          Length = 165

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 86/162 (53%), Gaps = 6/162 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDPIT GH D++ +A    + +++A+     K   F S+ ER E+ +Q++    
Sbjct: 6   AVYPGTFDPITLGHEDLVRRAARLFDRVIVAVAIAHHKKTLF-SLDERMEMARQALADCP 64

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                +V V SFEGL            +VRGLR  TDFDYE ++  +NR L P + T+ L
Sbjct: 65  -----QVQVESFEGLVTEFTAARGGTAMVRGLRSGTDFDYEFQLAGMNRALVPGVETVFL 119

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
                 ++++STL+R + ++  D+  FV   V   L + +  
Sbjct: 120 TPASQYQFISSTLVREIGTLGGDVAQFVSPGVHERLLHKLGR 161


>gi|290477291|ref|YP_003470212.1| CMP-deoxy-D-manno-octulosonate-lipid A transferase
           (phosphopantetheine adenylyltransferase) [Xenorhabdus
           bovienii SS-2004]
 gi|289176645|emb|CBJ83454.1| CMP-deoxy-D-manno-octulosonate-lipid A transferase
           (phosphopantetheine adenylyltransferase) [Xenorhabdus
           bovienii SS-2004]
          Length = 160

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 99/166 (59%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KA+Y G+FDPIT+GH+DI+ +A +  + +++AI  +  K   F +++ER+ L K+  
Sbjct: 1   MKKKAIYPGTFDPITHGHLDIVTRAANMFDHVLLAIANSDRKNPMF-NLEERTALAKEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N AK   A +++RG+R ++DF+YE ++ ++NR   PE+ 
Sbjct: 60  AHLKNVE-----VVGFSELMANFAKKQQATILIRGVRSVSDFEYEWQLANMNRHFMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           ++ L   ++  +V+S+LI+ +   D D+++F+P+PV   +      
Sbjct: 115 SVFLLPSQNLSFVSSSLIKDVARHDGDVSTFLPEPVAQAMLKKFGK 160


>gi|301059167|ref|ZP_07200107.1| pantetheine-phosphate adenylyltransferase [delta proteobacterium
           NaphS2]
 gi|300446715|gb|EFK10540.1| pantetheine-phosphate adenylyltransferase [delta proteobacterium
           NaphS2]
          Length = 165

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 62/169 (36%), Positives = 95/169 (56%), Gaps = 7/169 (4%)

Query: 1   MMR-KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           M +  AVY G FDP+TNGH+ I+ +AL+  + L+IAI  N  K   F SI+ER E+I+++
Sbjct: 1   MKKTIAVYPGFFDPVTNGHLSIVSRALNIFDKLIIAILNNPKKVPLF-SIEERIEMIQKA 59

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           +            V +F+GL V+ A    A V++RGLR ++DF+YE +M  +NR L  ++
Sbjct: 60  VDQNSRIE-----VDTFDGLLVDYAVHKKANVVLRGLRALSDFEYEFQMALMNRKLNRDV 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
            +I L       Y++ST+I+   S   D++  VPD V   LK       
Sbjct: 115 QSIFLMTDYKWFYISSTIIKEAASFGGDVSGLVPDIVNQNLKEKFKKRN 163


>gi|296135228|ref|YP_003642470.1| pantetheine-phosphate adenylyltransferase [Thiomonas intermedia
           K12]
 gi|294339323|emb|CAZ87679.1| Phosphopantetheine adenylyltransferase (Pantetheine-phosphate
           adenylyltransferase) (PPAT) (Dephospho-CoA
           pyrophosphorylase) [Thiomonas sp. 3As]
 gi|295795350|gb|ADG30140.1| pantetheine-phosphate adenylyltransferase [Thiomonas intermedia
           K12]
          Length = 165

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 50/167 (29%), Positives = 89/167 (53%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y G+FDP+T GH D++ +A    + L++AI     K   F +++ER ++ ++ + 
Sbjct: 1   MLLAIYPGTFDPLTRGHEDLVRRASKLCDRLLVAIAAGHHKNAMF-TLEERLDIAREVLS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +         V  F GL  +      AQV+VRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  PYPNVE-----VSGFTGLLRDFVVARGAQVVVRGLRAVSDFEYEFQMAGMNRQLMPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L   +  ++++ T +R +  +  D++ FV   V   L+  V    
Sbjct: 115 LFLTPADQYQFISGTFVREIAMLGGDVSKFVVPLVMERLQAKVAQRR 161


>gi|310816556|ref|YP_003964520.1| phosphopantetheine adenylyltransferase [Ketogulonicigenium vulgare
           Y25]
 gi|308755291|gb|ADO43220.1| phosphopantetheine adenylyltransferase [Ketogulonicigenium vulgare
           Y25]
          Length = 159

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 59/164 (35%), Positives = 93/164 (56%), Gaps = 5/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+TNGH+DII +  + V+ LVI +  N+ K   F   + R  L++  + 
Sbjct: 1   MRIGLYPGTFDPVTNGHLDIIRRGAALVDRLVIGVAINAGKGPLFGVDE-RVALLEVEVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    ++V+ FE L V+ A  + AQVI+RGLR   DF+YE  MT +NR L P+I T
Sbjct: 60  AIPA----DIAVVPFETLLVDFAGKVGAQVIIRGLRGAADFEYEFPMTGMNRTLAPDIET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L A+   + + S L++ +  +  D+++FVP  V   L +   
Sbjct: 116 VFLMAEARHQAIASRLVKEVSRLGGDVSAFVPPGVQQALADRWK 159


>gi|217979655|ref|YP_002363802.1| phosphopantetheine adenylyltransferase [Methylocella silvestris
           BL2]
 gi|254764159|sp|B8EIU8|COAD_METSB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|217505031|gb|ACK52440.1| pantetheine-phosphate adenylyltransferase [Methylocella silvestris
           BL2]
          Length = 167

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 69/163 (42%), Positives = 104/163 (63%), Gaps = 1/163 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+YTGSFDP+TNGH+D+I  A S  ++LV+ IG +  K   F S+ ER+ LI +S 
Sbjct: 1   MNRIALYTGSFDPLTNGHLDVITSAASICDELVVGIGAHPSKAPLF-SVDERAALIDRSC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F+ + S R+SV  F GLAV  A+   A++++RGLR+ +DFDYE +M  +N  + PEI 
Sbjct: 60  RDFLKERSCRLSVQPFFGLAVEAARAAGARILIRGLRNGSDFDYEAQMAGMNAAMAPEIR 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           T+   A     ++T+TL+R + ++  D++ FVP PV   L+  
Sbjct: 120 TVFFVASPGVGHITATLVRQIAAMGGDVSHFVPQPVLRALEAK 162


>gi|163790319|ref|ZP_02184751.1| hypothetical protein CAT7_07663 [Carnobacterium sp. AT7]
 gi|159874390|gb|EDP68462.1| hypothetical protein CAT7_07663 [Carnobacterium sp. AT7]
          Length = 161

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 59/166 (35%), Positives = 94/166 (56%), Gaps = 5/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A++ GSFDP TNGH+D + +A    + +VIA+  NS K   F S++E+   IK+++
Sbjct: 1   MDKIALFPGSFDPFTNGHLDTVERASKLFDQVVIAVATNSTKNALF-SLEEKITFIKKAV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H    S    S     GL VNLAK I A  ++RGLR+  DF+YE  + ++N+    +I 
Sbjct: 60  EHIENVSVTEHS----GGLTVNLAKKIGAVTLLRGLRNNADFEYESTIATMNKIQHKDIE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+ L + E  R+++S+LI+ +     D++S VP  V   +K     
Sbjct: 116 TMFLMSNEKYRFLSSSLIKEVAMFGGDVSSLVPAGVNEAIKIKYQK 161


>gi|320160932|ref|YP_004174156.1| phosphopantetheine adenylyltransferase [Anaerolinea thermophila
           UNI-1]
 gi|319994785|dbj|BAJ63556.1| phosphopantetheine adenylyltransferase [Anaerolinea thermophila
           UNI-1]
          Length = 171

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 60/165 (36%), Positives = 97/165 (58%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A + G+FDPI  GHM+I ++A +  ++L++A+    +K     S +ER EL+KQ+  
Sbjct: 1   MVRAFFPGTFDPIHYGHMNIALRASNLFDELIVAVYDRPLK-NLLFSPEERMELVKQAF- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                   ++ VI + GL V+  ++  AQVIVRGLR  +DF+YE RM   N  L P+I  
Sbjct: 59  ----FGQEKIRVIGYRGLTVDACRENGAQVIVRGLRVFSDFEYEFRMALANHRLAPDIEV 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           IAL   E   +++S+ +R + ++  DI+S VP  V + LK+ +  
Sbjct: 115 IALITNEEHTFLSSSTVREIAALGGDISSMVPPHVEIALKDKLKQ 159


>gi|146296797|ref|YP_001180568.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|166216531|sp|A4XKE2|COAD_CALS8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|145410373|gb|ABP67377.1| Phosphopantetheine adenylyltransferase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 168

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 57/156 (36%), Positives = 91/156 (58%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  VY GSFDP+TNGH+DII +A    + L++A+  N  KT  F  I ER EL+K++  
Sbjct: 1   MKIGVYPGSFDPVTNGHLDIIERASKIFDKLIVAVLVNPNKTPVF-DIDERVELLKETTE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V +F+GL ++  K  +A+VIV+GLR ++DF+YE +M  +N+ L P I T
Sbjct: 60  HLPNVE-----VKAFKGLLIDFMKQENAKVIVKGLRAVSDFEYEFQMALLNKKLEPSIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I +       Y++S++++ +      I   VP+ + 
Sbjct: 115 IFMMTNSKYSYLSSSMVKEVARFGGCIEDLVPEKIA 150


>gi|207727831|ref|YP_002256225.1| phosphopantetheine adenylyltransferase (pantetheine-phosphate
           adenylyltransferase) (ppat) (dephospho-coa
           pyrophosphorylase) protein [Ralstonia solanacearum
           MolK2]
 gi|206591072|emb|CAQ56684.1| phosphopantetheine adenylyltransferase (pantetheine-phosphate
           adenylyltransferase) (ppat) (dephospho-coa
           pyrophosphorylase) protein [Ralstonia solanacearum
           MolK2]
          Length = 169

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 47/167 (28%), Positives = 88/167 (52%), Gaps = 5/167 (2%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP T GH D++ +A +  ++LV+ +  +  K   F  ++ER  + ++ + 
Sbjct: 1   MVIAVYPGTFDPFTRGHEDLVRRASNIFDELVVGVAQSPNKRPFFA-LEERIHIAREVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+        S +  + +A +  +      IVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HYPNVRVEGFSGLLKDFVAQDTTRRE----IVRGLRAVSDFEYEFQMAGMNRYLLPDVET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L   +  ++++ T +R +  +  D++ FV   V  +L   V    
Sbjct: 116 MFLTPSDQYQFISGTFVREIAQLGGDVSKFVFPSVERWLVEKVGRRH 162


>gi|300721239|ref|YP_003710509.1| CMP-deoxy-D-manno-octulosonate-lipid A transferase [Xenorhabdus
           nematophila ATCC 19061]
 gi|297627726|emb|CBJ88252.1| CMP-deoxy-D-manno-octulosonate-lipid A transferase
           (phosphopantetheine adenylyltransferase) [Xenorhabdus
           nematophila ATCC 19061]
          Length = 160

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 56/166 (33%), Positives = 97/166 (58%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M RKA+Y G+FDP+T GH+DI+ +A +  + +++AI  +  K   F S++ER  L K+  
Sbjct: 1   MKRKAIYPGTFDPVTYGHLDIVTRAANMFDHILLAIANSDRKNPMF-SLEERVTLAKEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L VN AK   A +++RG+R + DF+YE ++ ++NR    E+ 
Sbjct: 60  AHLENVE-----VVGFSELMVNFAKKQQATILIRGVRSVADFEYECQLANMNRHFMQELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           ++ L   ++  +V+S+LI+ +   D DI+SF+P+PV   +   +  
Sbjct: 115 SVFLLPSQNLSFVSSSLIKDVARHDGDISSFLPEPVARAMLQKLGK 160


>gi|257054997|ref|YP_003132829.1| Phosphopantetheine adenylyltransferase [Saccharomonospora viridis
           DSM 43017]
 gi|256584869|gb|ACU96002.1| Phosphopantetheine adenylyltransferase [Saccharomonospora viridis
           DSM 43017]
          Length = 160

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 50/165 (30%), Positives = 92/165 (55%), Gaps = 7/165 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GS+DP TNGH+DII +A    +++V+A+   + K +G  +I+ER +++++   
Sbjct: 1   MRRAVCPGSYDPATNGHLDIIERAAKLFDEVVVAV-LINKKKQGLFTIEERLDMLREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    V V S+ GL V+  ++     I +GLR ++DFDYE++M  +NR L   + T
Sbjct: 60  DLPN-----VRVDSWHGLLVDYCREHDIPAIAKGLRSVSDFDYELQMAQMNRELT-GVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + +       +++S+L++ + +   D++  VP  V   L   +  
Sbjct: 114 LLMSNNPEYSFLSSSLVKEVATYGGDVSDMVPPVVHERLLAKLAE 158


>gi|297156903|gb|ADI06615.1| phosphopantetheine adenylyltransferase [Streptomyces
           bingchenggensis BCW-1]
          Length = 159

 Score =  157 bits (397), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 90/165 (54%), Gaps = 7/165 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GSFDP+TNGH+DII +A    + + +A+  N  K   F ++ ER +L++Q   
Sbjct: 1   MRRAVCPGSFDPVTNGHLDIIARASKLYDVVYVAVMINKSKQGMF-TVDERMDLLRQVTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +   S     V  F GL V+  K+     IV+GLR ++DFDYE++M  +N  L   + T
Sbjct: 60  EYGNVS-----VECFHGLLVDFCKEREIPAIVKGLRAVSDFDYELQMAQMNNGLS-GVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + +    +  +++S+L++ + +   D++  VP  V   L   +  
Sbjct: 114 LFVPTNPTYSFLSSSLVKEVATWGGDVSHLVPPVVLDALTERLGR 158


>gi|119713350|gb|ABL97414.1| phosphopantetheine adenylyltransferase [uncultured marine bacterium
           EB80_02D08]
          Length = 160

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 64/164 (39%), Positives = 94/164 (57%), Gaps = 5/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDPIT GHMDII +     + +V+AI  +  K   F S+++R  L +    
Sbjct: 1   MRVAIYPGSFDPITYGHMDIIDRGCGLFDKIVVAIAKSESKKPLF-SLEDRINLAQS--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               D+     V     L V+LAKD  A  I+RGLR ++DF+YE ++ ++NR L P+I +
Sbjct: 57  -IYKDNDKVEVVGFPRKLTVDLAKDYGACAIIRGLRAVSDFEYEFQLATMNRSLAPDIES 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           I L  KES  YV+S+LI+ +  +  DI+ FV   V   L+  + 
Sbjct: 116 IFLTPKESLIYVSSSLIKEISDLKGDISKFVHPTVAQALRAKLD 159


>gi|29376945|ref|NP_816099.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           V583]
 gi|227519831|ref|ZP_03949880.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0104]
 gi|227553984|ref|ZP_03984031.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           HH22]
 gi|229545128|ref|ZP_04433853.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX1322]
 gi|229549376|ref|ZP_04438101.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           ATCC 29200]
 gi|255972082|ref|ZP_05422668.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis T1]
 gi|255975149|ref|ZP_05425735.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis T2]
 gi|256616992|ref|ZP_05473838.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis ATCC
           4200]
 gi|256853811|ref|ZP_05559176.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis T8]
 gi|256956728|ref|ZP_05560899.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis DS5]
 gi|256961255|ref|ZP_05565426.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis
           Merz96]
 gi|257079682|ref|ZP_05574043.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis JH1]
 gi|257081971|ref|ZP_05576332.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis
           E1Sol]
 gi|257084523|ref|ZP_05578884.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis Fly1]
 gi|257090640|ref|ZP_05585001.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis
           CH188]
 gi|257416688|ref|ZP_05593682.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis
           AR01/DG]
 gi|257421908|ref|ZP_05598898.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis X98]
 gi|293383539|ref|ZP_06629449.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           R712]
 gi|293387348|ref|ZP_06631904.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           S613]
 gi|294780840|ref|ZP_06746195.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           PC1.1]
 gi|300860835|ref|ZP_07106922.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TUSoD Ef11]
 gi|307270789|ref|ZP_07552079.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX4248]
 gi|307277115|ref|ZP_07558219.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX2134]
 gi|307285766|ref|ZP_07565900.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0860]
 gi|307287669|ref|ZP_07567712.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0109]
 gi|307290495|ref|ZP_07570408.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0411]
 gi|312905175|ref|ZP_07764296.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0635]
 gi|312906089|ref|ZP_07765101.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           DAPTO 512]
 gi|312909435|ref|ZP_07768290.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           DAPTO 516]
 gi|312953532|ref|ZP_07772370.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0102]
 gi|61212751|sp|Q831P9|COAD_ENTFA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|29344410|gb|AAO82169.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           V583]
 gi|227072721|gb|EEI10684.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0104]
 gi|227176887|gb|EEI57859.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           HH22]
 gi|229305613|gb|EEN71609.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           ATCC 29200]
 gi|229309673|gb|EEN75660.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX1322]
 gi|255963100|gb|EET95576.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis T1]
 gi|255968021|gb|EET98643.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis T2]
 gi|256596519|gb|EEU15695.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis ATCC
           4200]
 gi|256710754|gb|EEU25797.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis T8]
 gi|256947224|gb|EEU63856.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis DS5]
 gi|256951751|gb|EEU68383.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis
           Merz96]
 gi|256987712|gb|EEU75014.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis JH1]
 gi|256990001|gb|EEU77303.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis
           E1Sol]
 gi|256992553|gb|EEU79855.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis Fly1]
 gi|256999452|gb|EEU85972.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis
           CH188]
 gi|257158516|gb|EEU88476.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis
           ARO1/DG]
 gi|257163732|gb|EEU93692.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis X98]
 gi|291079051|gb|EFE16415.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           R712]
 gi|291083246|gb|EFE20209.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           S613]
 gi|294452085|gb|EFG20532.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           PC1.1]
 gi|295113497|emb|CBL32134.1| pantetheine-phosphate adenylyltransferase, bacterial [Enterococcus
           sp. 7L76]
 gi|300849874|gb|EFK77624.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TUSoD Ef11]
 gi|306498442|gb|EFM67946.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0411]
 gi|306501407|gb|EFM70710.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0109]
 gi|306502527|gb|EFM71794.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0860]
 gi|306506045|gb|EFM75211.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX2134]
 gi|306512903|gb|EFM81545.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX4248]
 gi|310627735|gb|EFQ11018.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           DAPTO 512]
 gi|310628544|gb|EFQ11827.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0102]
 gi|310631565|gb|EFQ14848.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0635]
 gi|311290108|gb|EFQ68664.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           DAPTO 516]
 gi|315030170|gb|EFT42102.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX4000]
 gi|315032945|gb|EFT44877.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0017]
 gi|315035751|gb|EFT47683.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0027]
 gi|315144855|gb|EFT88871.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX2141]
 gi|315146728|gb|EFT90744.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX4244]
 gi|315152022|gb|EFT96038.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0031]
 gi|315155385|gb|EFT99401.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0043]
 gi|315159039|gb|EFU03056.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0312]
 gi|315161632|gb|EFU05649.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0645]
 gi|315164892|gb|EFU08909.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX1302]
 gi|315170250|gb|EFU14267.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX1342]
 gi|315574316|gb|EFU86507.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0309B]
 gi|315579109|gb|EFU91300.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0630]
 gi|315580209|gb|EFU92400.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0309A]
 gi|323481440|gb|ADX80879.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           62]
 gi|327535736|gb|AEA94570.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           OG1RF]
 gi|329572370|gb|EGG54024.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX1467]
          Length = 163

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 44/163 (26%), Positives = 92/163 (56%), Gaps = 5/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A++ GSFDP+TNGH+++I ++    ++++I +  N+ K   F   +++  + + + 
Sbjct: 1   MRKIALFPGSFDPMTNGHLNLIERSAKLFDEVIIGVFINTSKQTLFTPEEKKYLIEEATK 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   N   ++    L V  AK + A  ++RG+R++ D++YE  +  +N+ L PEI 
Sbjct: 61  EM-----PNVRVIMQETQLTVESAKSLGANFLIRGIRNVKDYEYEKDIAKMNQHLAPEIE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           T+ L A+E   +V+S+L++ ++    D++ ++P  +   LK  
Sbjct: 116 TVFLLAEEPYAHVSSSLLKEVLRFGGDVSDYLPPNIYHALKQK 158


>gi|326443700|ref|ZP_08218434.1| phosphopantetheine adenylyltransferase [Streptomyces clavuligerus
           ATCC 27064]
          Length = 160

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 54/164 (32%), Positives = 92/164 (56%), Gaps = 7/164 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GSFDPITNGH+DII +A    +++ +A+  N  K KG  ++ ER +LI++   
Sbjct: 1   MRRAVCPGSFDPITNGHLDIIARASRLYDEVYVAVMINQSK-KGLFTVDERMDLIRRVTT 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +   +     V S  GL V+  K      IV+GLR ++DFDYE++M  +N  L   + T
Sbjct: 60  EYGNVT-----VESHHGLLVDFCKARGIPAIVKGLRAVSDFDYELQMAQMNNGLS-GVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + +    +  +++S+L++ + +   D++  +PD V   L   + 
Sbjct: 114 LFVPTNPTYSFLSSSLVKEVAAWGGDVSHLLPDAVHRALVERLR 157


>gi|197286979|ref|YP_002152851.1| phosphopantetheine adenylyltransferase [Proteus mirabilis HI4320]
 gi|227354781|ref|ZP_03839198.1| phosphopantetheine adenylyltransferase [Proteus mirabilis ATCC
           29906]
 gi|29427852|sp|Q8RSX4|COAD_PROMI RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229500856|sp|B4F0X7|COAD_PROMH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|18762493|gb|AAL78072.1| phosphopantetheine adenyltransferase [Proteus mirabilis]
 gi|194684466|emb|CAR46217.1| phosphopantetheine adenylyltransferase [Proteus mirabilis HI4320]
 gi|227165099|gb|EEI49930.1| phosphopantetheine adenylyltransferase [Proteus mirabilis ATCC
           29906]
 gi|301072214|gb|ADK56068.1| CoaD [Proteus mirabilis]
 gi|301072236|gb|ADK56089.1| CoaD [Proteus mirabilis]
 gi|312598038|gb|ADQ89972.1| phosphopantetheine adenyltransferase [Proteus mirabilis]
 gi|312598059|gb|ADQ89992.1| phosphopantetheine adenyltransferase [Proteus mirabilis]
          Length = 161

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 96/167 (57%), Gaps = 6/167 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPIT GH+DI+ +A    + +++AI  ++ K   F S++ER  L K+  
Sbjct: 1   MKNKAIYPGTFDPITYGHIDILTRAAGMFDTVLLAIAASARKNPMF-SLEERVALAKEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N AK   A +++RG+R ++DF+YE ++ ++NR   P++ 
Sbjct: 60  QHLPNVE-----VVGFCELMANFAKKQQATILIRGVRSVSDFEYEWQLANMNRHFAPDLD 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           ++ L   ++  +V+S+LI+ +   D D+++F+P+ V   +   +   
Sbjct: 115 SVFLLPSQNLSFVSSSLIKDVARHDGDVSTFLPEVVATAMLQKLGKR 161


>gi|302386345|ref|YP_003822167.1| pantetheine-phosphate adenylyltransferase [Clostridium
           saccharolyticum WM1]
 gi|302196973|gb|ADL04544.1| pantetheine-phosphate adenylyltransferase [Clostridium
           saccharolyticum WM1]
          Length = 162

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 59/168 (35%), Positives = 94/168 (55%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRKAVY GSFDP+T GH+DII ++    + L+I +  N  KT  F S++ER  ++K    
Sbjct: 1   MRKAVYPGSFDPVTFGHLDIIERSARMSDHLIIGVLNNYSKTPLF-SVEERVNMLKSLTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      VI+F GL V+  +   A  ++RGLR +TDF+YE+++   NR + PEI T
Sbjct: 60  DLPNVE-----VIAFGGLLVDFVRANQADAVIRGLRAVTDFEYELQIAQTNRVMAPEIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + L       Y++S++++ + S   +I +FVP  V   +   +   +K
Sbjct: 115 VFLTTNLKYSYLSSSIVKEIASYGGEINTFVPPCVAERVMKKMEDRMK 162


>gi|319405588|emb|CBI79208.1| Phosphopantetheine adenylyltransferase [Bartonella sp. AR 15-3]
          Length = 164

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 72/164 (43%), Positives = 104/164 (63%), Gaps = 1/164 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDPITNGH+DI+  +L F + +V+AIG  + K   F S +ER+ LI Q   
Sbjct: 1   MKIALYAGSFDPITNGHLDILQSSLIFTDKVVVAIGIQATKKPFF-SFEERAALITQVRK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   S+R+ VISF+ L +  A++I A  ++RGLRD TDFDYEM+M  +N  + PE+ T
Sbjct: 60  DLLNIGSDRLQVISFDNLLIEKAREIGASFLIRGLRDGTDFDYEMQMAGMNEVMAPELRT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           I L    SSR ++STL+R + ++  D+T FVP  V   L +   
Sbjct: 120 IFLPTSISSRMISSTLVRQIATMGGDVTPFVPQNVAQALYSKFK 163


>gi|307265581|ref|ZP_07547135.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|306919379|gb|EFN49599.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           wiegelii Rt8.B1]
          Length = 159

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 60/164 (36%), Positives = 93/164 (56%), Gaps = 6/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+T GH+DII +     + L++A+  N +K   F SI+ER EL+K    
Sbjct: 1   MKTAIYPGSFDPVTYGHIDIIKRGALLFDKLIVAVLLNPIKKPLF-SIEERMELLKAVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           +        V +  F+GL V+ AK + A VI+RGLR ++DF+YE +M  +N+ L P I T
Sbjct: 60  NIPN-----VQIDYFDGLLVDYAKKVRAGVIIRGLRMVSDFEYEFQMALINKKLDPSIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L   E   Y +S+ ++ +       + FVP+ V   LK  + 
Sbjct: 115 VFLMTNEQYSYFSSSAVKEIAQFRGGFSKFVPEIVAQKLKEKLK 158


>gi|239623796|ref|ZP_04666827.1| pantetheine-phosphate adenylyltransferase [Clostridiales bacterium
           1_7_47_FAA]
 gi|239521827|gb|EEQ61693.1| pantetheine-phosphate adenylyltransferase [Clostridiales bacterium
           1_7_47FAA]
          Length = 161

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 89/166 (53%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDP+T GH DII +     + +++ +  N  K+  F S  ER  ++K+   
Sbjct: 1   MKIAVYPGSFDPVTLGHYDIIERTSKIFDKVILGVLNNRAKSPLF-SAGERVNMLKEVTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V SFEGL ++  +   A +IVRGLR +TDF+YE+++   NR + PE+ T
Sbjct: 60  SLPNVE-----VQSFEGLLIDFVRQNGAAIIVRGLRAITDFEYELQLAQTNRVIAPEVDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           I L       Y++S++++ +   D DI+ F+   +   ++  +   
Sbjct: 115 IFLTTNLKYSYLSSSIVKEIAEYDGDISEFLHPAIAARVREKLKER 160


>gi|212703403|ref|ZP_03311531.1| hypothetical protein DESPIG_01446 [Desulfovibrio piger ATCC 29098]
 gi|212673148|gb|EEB33631.1| hypothetical protein DESPIG_01446 [Desulfovibrio piger ATCC 29098]
          Length = 184

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 55/179 (30%), Positives = 94/179 (52%), Gaps = 12/179 (6%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y G+FDP+TNGH+ +I + L+  + +V+A+  N+ K   F S +ER  + ++++ 
Sbjct: 5   MKLALYPGTFDPLTNGHLALIRRGLAVFDQIVVAVADNTPKFPLF-SQEERVAMAREAVG 63

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V  F GL V  A    A  I+RGLR ++DF+YE ++  +NR L  +I T
Sbjct: 64  DDDRIL-----VEPFTGLTVEYAAKRGACAILRGLRAVSDFEYEFQLALMNRRLQRDIQT 118

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTI 180
           + L       +++ST+++   S  ADI   VP+ V       +  + KY   ++   T 
Sbjct: 119 VFLMTDYQWLFISSTIVKAAASHGADIVGLVPENV------RLRLMEKYQRGEVRQATP 171


>gi|108804211|ref|YP_644148.1| phosphopantetheine adenylyltransferase [Rubrobacter xylanophilus
           DSM 9941]
 gi|123069120|sp|Q1AW92|COAD_RUBXD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|108765454|gb|ABG04336.1| Phosphopantetheine adenylyltransferase [Rubrobacter xylanophilus
           DSM 9941]
          Length = 164

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 90/165 (54%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+  GSFDPIT GH+DII +A    + +V+A+G N  K     + + R+ LI++   
Sbjct: 1   MNIAICPGSFDPITTGHLDIIRRASKLFDHVVVAVGSNLRKQPRLSAAE-RARLIEKVTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                S     V   EGL V+ A++  A+V+V+GLR ++DF+ E     +NR L PE+ T
Sbjct: 60  DLENVS-----VEVMEGLLVDFAREQGARVVVKGLRAVSDFESEFEQAQLNRTLYPELET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + + +     +++S+ +R + ++  D+   VPD +   ++ I   
Sbjct: 115 VFIMSASQHSFLSSSAVREIAALGGDVRGLVPDGILETVRQIYSR 159


>gi|256763143|ref|ZP_05503723.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis T3]
 gi|256684394|gb|EEU24089.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis T3]
          Length = 163

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 45/163 (27%), Positives = 93/163 (57%), Gaps = 5/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A++ GSFDP+TNGH+++I ++    ++++I +  N+ K   F   +++  + + + 
Sbjct: 1   MRKIALFPGSFDPMTNGHLNLIERSAKLFDEVIIGVFINTSKQTLFTPEEKKYLIEEATK 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   N   ++    LAV  AK + A  ++RG+R++ D++YE  +  +N+ L PEI 
Sbjct: 61  EM-----PNVRVIMQETQLAVESAKSLGANFLIRGIRNVKDYEYEKDIAKMNQHLAPEIE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           T+ L A+E   +V+S+L++ ++    D++ ++P  +   LK  
Sbjct: 116 TVFLLAEEPYAHVSSSLLKEVLRFGGDVSDYLPPNIYHALKQK 158


>gi|320354628|ref|YP_004195967.1| phosphopantetheine adenylyltransferase [Desulfobulbus propionicus
           DSM 2032]
 gi|320123130|gb|ADW18676.1| Phosphopantetheine adenylyltransferase [Desulfobulbus propionicus
           DSM 2032]
          Length = 176

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 53/164 (32%), Positives = 91/164 (55%), Gaps = 5/164 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+DII + L   + +++ +  N  KT  F +++ER  +I++    
Sbjct: 18  RTAVYPGTFDPITNGHIDIIERGLHLFDRIIVTVAVNVQKTPLF-TLEERCAMIRECF-- 74

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               +  +V V   +GL V+ A   +A+ I+RGLR ++DFDYE ++  +NR L   + T+
Sbjct: 75  --KHAGTQVEVGFTDGLIVDYALRHNARTIIRGLRAISDFDYEFQLALMNRRLERSVETV 132

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            L       Y++S+ I++      +++  VP+ V   L+     
Sbjct: 133 FLMTGFRWIYISSSGIKNAARCHGNVSGLVPEHVERALQEKFAR 176


>gi|326389656|ref|ZP_08211222.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           ethanolicus JW 200]
 gi|325994371|gb|EGD52797.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 159

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 59/164 (35%), Positives = 92/164 (56%), Gaps = 6/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+T GH+DII +     + L++A+  N +K   F SI+ER EL+K    
Sbjct: 1   MKTAIYPGSFDPVTYGHIDIIKRGALLFDKLIVAVLLNPIKKPLF-SIEERIELLKAVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           +        V +  F+ L V+ AK + A VI+RGLR ++DF+YE +M  +N+ L P I T
Sbjct: 60  NIPN-----VQIDYFDDLLVDYAKKVRAGVIIRGLRMVSDFEYEFQMALINKKLDPSIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L   E   Y +S+ ++ +       + FVP+ V   LK  + 
Sbjct: 115 VFLMTNEQYSYFSSSAVKEIAQFRGGFSKFVPEIVAQKLKEKLK 158


>gi|242309051|ref|ZP_04808206.1| phosphopantetheine adenylyltransferase [Helicobacter pullorum MIT
           98-5489]
 gi|239524475|gb|EEQ64341.1| phosphopantetheine adenylyltransferase [Helicobacter pullorum MIT
           98-5489]
          Length = 166

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 95/162 (58%), Gaps = 2/162 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y G+FDPITNGH+DI+ +A    + L+IA+  +  K   F S ++R E+ K +I
Sbjct: 1   MSKIAIYPGTFDPITNGHLDIVQRACKLFDGLIIAVAKSENKKPLF-SQEQRIEMAKLAI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 S   + V  F+ L  + AK+ ++ +++RGLR ++DF+YE++M   N  L P++ 
Sbjct: 60  KEL-QLSFPSLYVYGFDNLVADFAKEQNSNILIRGLRAVSDFEYELQMGYANASLNPKLE 118

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           TI L     + +++S+++R ++S   +I    P  V  F+K 
Sbjct: 119 TIYLMPSLQNAFISSSVVRSILSHGGEIKHLTPKSVSNFIKE 160


>gi|90415301|ref|ZP_01223235.1| phosphopantetheine adenylyltransferase [marine gamma
           proteobacterium HTCC2207]
 gi|90332624|gb|EAS47794.1| phosphopantetheine adenylyltransferase [marine gamma
           proteobacterium HTCC2207]
          Length = 160

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 91/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M   VY G+FDPITNGH+D++ +A    + ++I I  +  K   F S+ ER +L   ++ 
Sbjct: 1   MTTIVYPGTFDPITNGHIDLVERASRMFDKIIIGIATSQRKGPLF-SVDERIQLATDALA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          ++ F+ L VN  +D  A  I+RGLR ++DF+YE ++ ++NR L P I +
Sbjct: 60  HVPNIE-----ILGFDYLLVNFVQDCKADAIMRGLRAVSDFEYEFQLANMNRALSPNIES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   Y++S+L+R + S+D D++ F P  V   L      
Sbjct: 115 VFLTPAEHLSYISSSLVREISSLDGDVSKFAPANVVDALSQKFNK 159


>gi|311029900|ref|ZP_07707990.1| phosphopantetheine adenylyltransferase [Bacillus sp. m3-13]
          Length = 162

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 55/164 (33%), Positives = 88/164 (53%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDP+T GH+DII +A    + + + +  NS K   F ++ ER ++IKQ  
Sbjct: 1   MASVAVCPGSFDPVTFGHLDIIKRASKVFDKVYVCVLNNSSKKPLF-TVDERVDMIKQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F         V  F GL ++ A   +A  IVRGLR ++DF+YEM++TS+NR L   I 
Sbjct: 60  KEFGNVE-----VEEFHGLLIDYAHSKNASSIVRGLRAVSDFEYEMQITSMNRVLDESIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           T+ +       +++S++++ +   +  ++  VP  V   LK   
Sbjct: 115 TLFMMTNNQYSFLSSSIVKEVAKYNGSVSELVPPTVEAELKKKF 158


>gi|315174008|gb|EFU18025.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX1346]
          Length = 163

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 45/163 (27%), Positives = 92/163 (56%), Gaps = 5/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A++ GSFDP+TNGH+++I ++    +++VI +  N+ K   F   +++  + + + 
Sbjct: 1   MRKIALFPGSFDPMTNGHLNLIERSAKLFDEVVIGVFINTSKQTLFTPEEKKYLIEEATK 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   N   ++    L V  AK + A  ++RG+R++ D++YE  +  +N+ L PEI 
Sbjct: 61  EM-----PNVRVIMQETQLTVESAKSLGANFLIRGIRNVKDYEYEKDIAKMNQHLAPEIE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           T+ L A+E   +V+S+L++ ++    D++ ++P  +   LK  
Sbjct: 116 TVFLLAEEPYAHVSSSLLKEVLRFGGDVSDYLPPNIYHALKQK 158


>gi|15640252|ref|NP_229879.1| phosphopantetheine adenylyltransferase [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|121586333|ref|ZP_01676122.1| phosphopantetheine adenylyltransferase [Vibrio cholerae 2740-80]
 gi|121729456|ref|ZP_01682085.1| phosphopantetheine adenylyltransferase [Vibrio cholerae V52]
 gi|147673495|ref|YP_001218482.1| phosphopantetheine adenylyltransferase [Vibrio cholerae O395]
 gi|153820031|ref|ZP_01972698.1| phosphopantetheine adenylyltransferase [Vibrio cholerae NCTC 8457]
 gi|153821813|ref|ZP_01974480.1| phosphopantetheine adenylyltransferase [Vibrio cholerae B33]
 gi|227080442|ref|YP_002808993.1| lipopolysaccharide core biosynthesis protein KdtB [Vibrio cholerae
           M66-2]
 gi|229506977|ref|ZP_04396485.1| phosphopantetheine adenylyltransferase [Vibrio cholerae BX 330286]
 gi|229509347|ref|ZP_04398830.1| phosphopantetheine adenylyltransferase [Vibrio cholerae B33]
 gi|229516294|ref|ZP_04405742.1| phosphopantetheine adenylyltransferase [Vibrio cholerae RC9]
 gi|229606485|ref|YP_002877133.1| phosphopantetheine adenylyltransferase [Vibrio cholerae MJ-1236]
 gi|254286322|ref|ZP_04961281.1| phosphopantetheine adenylyltransferase [Vibrio cholerae AM-19226]
 gi|254851353|ref|ZP_05240703.1| phosphopantetheine adenylyltransferase [Vibrio cholerae MO10]
 gi|255744034|ref|ZP_05417988.1| phosphopantetheine adenylyltransferase [Vibrio cholera CIRS 101]
 gi|262161925|ref|ZP_06030942.1| phosphopantetheine adenylyltransferase [Vibrio cholerae INDRE 91/1]
 gi|262168065|ref|ZP_06035764.1| phosphopantetheine adenylyltransferase [Vibrio cholerae RC27]
 gi|298500864|ref|ZP_07010666.1| pantetheine-phosphate adenylyltransferase [Vibrio cholerae MAK 757]
 gi|14194524|sp|Q9KVC4|COAD_VIBCH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|172047484|sp|A5F408|COAD_VIBC3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254764185|sp|C3LQI4|COAD_VIBCM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|9654630|gb|AAF93398.1| lipopolysaccharide core biosynthesis protein KdtB [Vibrio cholerae
           O1 biovar El Tor str. N16961]
 gi|121549453|gb|EAX59481.1| phosphopantetheine adenylyltransferase [Vibrio cholerae 2740-80]
 gi|121628631|gb|EAX61106.1| phosphopantetheine adenylyltransferase [Vibrio cholerae V52]
 gi|126509435|gb|EAZ72029.1| phosphopantetheine adenylyltransferase [Vibrio cholerae NCTC 8457]
 gi|126520709|gb|EAZ77932.1| phosphopantetheine adenylyltransferase [Vibrio cholerae B33]
 gi|146315378|gb|ABQ19917.1| phosphopantetheine adenylyltransferase [Vibrio cholerae O395]
 gi|150423737|gb|EDN15679.1| phosphopantetheine adenylyltransferase [Vibrio cholerae AM-19226]
 gi|227008330|gb|ACP04542.1| lipopolysaccharide core biosynthesis protein KdtB [Vibrio cholerae
           M66-2]
 gi|227012069|gb|ACP08279.1| lipopolysaccharide core biosynthesis protein KdtB [Vibrio cholerae
           O395]
 gi|229346720|gb|EEO11690.1| phosphopantetheine adenylyltransferase [Vibrio cholerae RC9]
 gi|229353662|gb|EEO18599.1| phosphopantetheine adenylyltransferase [Vibrio cholerae B33]
 gi|229356082|gb|EEO21001.1| phosphopantetheine adenylyltransferase [Vibrio cholerae BX 330286]
 gi|229369140|gb|ACQ59563.1| phosphopantetheine adenylyltransferase [Vibrio cholerae MJ-1236]
 gi|254847058|gb|EET25472.1| phosphopantetheine adenylyltransferase [Vibrio cholerae MO10]
 gi|255738299|gb|EET93690.1| phosphopantetheine adenylyltransferase [Vibrio cholera CIRS 101]
 gi|262023598|gb|EEY42300.1| phosphopantetheine adenylyltransferase [Vibrio cholerae RC27]
 gi|262028303|gb|EEY46959.1| phosphopantetheine adenylyltransferase [Vibrio cholerae INDRE 91/1]
 gi|297540368|gb|EFH76427.1| pantetheine-phosphate adenylyltransferase [Vibrio cholerae MAK 757]
          Length = 164

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 54/160 (33%), Positives = 88/160 (55%), Gaps = 6/160 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D+I +A    ++++IA+  +  K   F +++ER E  +Q   H 
Sbjct: 8   RVIYPGTFDPITNGHLDLIERAAQMFDEVIIAVAASPSKNTLF-TLEERVEFARQVTSHL 66

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
              S+       F GL V+ AK   A V++RGLR   DF+YE  +T++ R L P + ++ 
Sbjct: 67  DNVSAK-----GFSGLLVDFAKAEKANVLIRGLRTTVDFEYEFGLTNMYRRLMPGLESVF 121

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L   E   +++STL+R +     ++  FVP  V   L   
Sbjct: 122 LTPAEEHAFISSTLVREVAIHGGNVDEFVPAIVANALHQK 161


>gi|29829211|ref|NP_823845.1| phosphopantetheine adenylyltransferase [Streptomyces avermitilis
           MA-4680]
 gi|61212750|sp|Q82JT5|COAD_STRAW RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|29606317|dbj|BAC70380.1| putative pantetheine-phosphate adenylyltransferase [Streptomyces
           avermitilis MA-4680]
          Length = 159

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 86/165 (52%), Gaps = 7/165 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GSFDPITNGH+DII +A    + + +A+  N  K   F   + R ELI+Q   
Sbjct: 1   MRRAVCPGSFDPITNGHLDIIARASKLYDVVHVAVMINQSKKGLFEVDE-RIELIRQVTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F         V SF GL V+  K      IV+GLR ++DFDYE++M  +N      + T
Sbjct: 60  EFGNVE-----VESFHGLLVDFCKQRDIPAIVKGLRAVSDFDYELQMAQMN-IGLSGVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + +    +  +++S+L++ + +   D++  VP  V   L   +  
Sbjct: 114 LFVPTNPTYSFLSSSLVKEVAAWGGDVSHLVPPAVLEALNGRLKQ 158


>gi|332179469|gb|AEE15158.1| Phosphopantetheine adenylyltransferase [Thermodesulfobium narugense
           DSM 14796]
          Length = 168

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 58/168 (34%), Positives = 99/168 (58%), Gaps = 3/168 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+++A+Y GSFDPIT GH+DI  +A    ++++IA+   + K K   +I+ER  LIK+S+
Sbjct: 1   MIKRALYPGSFDPITLGHLDIARRASHLFDEVIIAVA-YNEKKKALFNIEERVNLIKESL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                  +  V V S+  L +  AK ++   I+RGLR ++DF++E +M   NR + P I 
Sbjct: 60  KERNMPKN--VHVTSYTCLTIEFAKSLNVSSIIRGLRVISDFEFEFQMALTNRRMDPRIE 117

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           T+ L   E   Y++ST+I+ + S++ ++T +V D V   L   ++   
Sbjct: 118 TVFLMTHEDYSYISSTIIKEIASLNGNVTPWVTDVVKNALNEKLLGRE 165


>gi|303256297|ref|ZP_07342313.1| pantetheine-phosphate adenylyltransferase [Burkholderiales
           bacterium 1_1_47]
 gi|302861026|gb|EFL84101.1| pantetheine-phosphate adenylyltransferase [Burkholderiales
           bacterium 1_1_47]
          Length = 165

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 54/169 (31%), Positives = 94/169 (55%), Gaps = 6/169 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y G+FDP+T GH+D+I +A      L++A+  +  K   F +++ER ++ K+++ 
Sbjct: 1   MITATYPGTFDPLTKGHLDLIRRACWIFPKLIVAVAESKRKHTLF-TLEERVQMAKEAVK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F         V+ FEGL V+  +   +  IVRG R ++DF+YE +M  +N+ L PE+ T
Sbjct: 60  GFPNVE-----VVGFEGLLVDFVRRHGSTCIVRGARAVSDFEYEFQMAGMNQKLMPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKY 170
           I L   E  ++++ T +R +  +  D++ FVP  +   L+   I L + 
Sbjct: 115 IFLTPAEQFQFISGTFVREIAMMGGDVSGFVPQNIRAALERKRIELKQT 163


>gi|229829108|ref|ZP_04455177.1| hypothetical protein GCWU000342_01193 [Shuttleworthia satelles DSM
           14600]
 gi|229792271|gb|EEP28385.1| hypothetical protein GCWU000342_01193 [Shuttleworthia satelles DSM
           14600]
          Length = 162

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 59/163 (36%), Positives = 90/163 (55%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDP T GH+DII ++    + L++A+  NS K   F S++ER +++K    
Sbjct: 1   MRTAIYPGSFDPATFGHLDIIERSSKLFDQLIVAVLNNSAKESLF-SVEERVDMLKMLTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V SFEGL ++ A+ + A  +VRGLR ++DF+YE+++   N    PEI T
Sbjct: 60  GCPNVK-----VDSFEGLLIDYARRMDAGFLVRGLRAVSDFEYELQIAQTNHVEYPEIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           I L    +  Y++ST++R   S   DI  FVP  +   +    
Sbjct: 115 IFLTTSLNYSYLSSTIVREFASYGGDIRQFVPAEIIPLIYGKY 157


>gi|291288907|ref|YP_003505723.1| pantetheine-phosphate adenylyltransferase [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290886067|gb|ADD69767.1| pantetheine-phosphate adenylyltransferase [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 163

 Score =  157 bits (396), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 45/167 (26%), Positives = 89/167 (53%), Gaps = 6/167 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
             +Y G+FDP+TNGH+DI  +     + L++AI  N  K   F ++++R  + ++     
Sbjct: 2   IGLYPGTFDPLTNGHVDIAHRGAKLFDKLIVAISENPQKNTAF-TLEDRVSMAQEVFCEI 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V+ F  L +   K ++A V+VRG+R ++DF+YE ++  +NR +  +  T+ 
Sbjct: 61  PNIE-----VVPFTCLLIKFMKKVNADVVVRGMRAVSDFEYEFQLALMNRKMSKDFETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKY 170
           L   +   +++S+++R + +   D+  FVP+ V   +  +  +  KY
Sbjct: 116 LMPNQDYIFLSSSMVREVAAHKGDVAGFVPECVNRQIVELYGAPTKY 162


>gi|325293067|ref|YP_004278931.1| Phosphopantetheine adenylyltransferase [Agrobacterium sp. H13-3]
 gi|325060920|gb|ADY64611.1| Phosphopantetheine adenylyltransferase [Agrobacterium sp. H13-3]
          Length = 164

 Score =  157 bits (396), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 67/165 (40%), Positives = 107/165 (64%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDP+TNGH+D++IQAL+    +++A+G +  K   F S +ER+ LI +++ 
Sbjct: 1   MTIAFYPGSFDPMTNGHLDVLIQALNVASKVIVAVGIHPGKAPLF-SFEERATLISRALS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  + RV V+SF+ L V+ A+   A++++RGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  ESLPGEAARVEVVSFDNLVVDAARQHGARLLLRGLRDGTDLDYEMQMAGMNRQMAPDIQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A  SSR +T+TL+R + ++  ++ +FVP  V   L   +  
Sbjct: 120 VFLPAGTSSRPITATLVRQIAAMGGNVDAFVPKAVLEALNAKLKR 164


>gi|269792717|ref|YP_003317621.1| pantetheine-phosphate adenylyltransferase [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100352|gb|ACZ19339.1| pantetheine-phosphate adenylyltransferase [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 166

 Score =  157 bits (396), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 54/163 (33%), Positives = 94/163 (57%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +AVY GSFDPITNGH+ I  +A +  ++L++A+  N  K   F S++ER  + ++++ 
Sbjct: 1   MIRAVYPGSFDPITNGHVYIAERAAALFDELIVAVLHNPEKRATF-SVEERQMMAREALS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V +F+GL V+  + + +++I+RGLR ++DF+YE ++  +NR L PEI T
Sbjct: 60  HLPTVK-----VDAFQGLLVDFMRHVRSRIIIRGLRALSDFEYEFQLAQMNRQLAPEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + +       Y++S  ++ + S    I   VP  V   L+  +
Sbjct: 115 MFIVTDAKYSYLSSRGVKEVYSFGGPIQDMVPPGVFRRLRERI 157


>gi|148260182|ref|YP_001234309.1| pantetheine-phosphate adenylyltransferase [Acidiphilium cryptum
           JF-5]
 gi|326402876|ref|YP_004282957.1| phosphopantetheine adenylyltransferase [Acidiphilium multivorum
           AIU301]
 gi|166216050|sp|A5FXQ8|COAD_ACICJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|146401863|gb|ABQ30390.1| pantetheine-phosphate adenylyltransferase [Acidiphilium cryptum
           JF-5]
 gi|325049737|dbj|BAJ80075.1| phosphopantetheine adenylyltransferase [Acidiphilium multivorum
           AIU301]
          Length = 169

 Score =  157 bits (396), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 58/156 (37%), Positives = 89/156 (57%), Gaps = 1/156 (0%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
             +Y G+FDPITNGH+DII +A      LVI +  N+ K   F + + R E+++  I   
Sbjct: 7   IGLYPGTFDPITNGHLDIIGRAAQLCSKLVIGVARNAGKGPLFPTAE-RVEMVRAEIAPI 65

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
              +   + V +F+ L +  A+ +SAQVIVRGLR ++DFDYE +M  +N  L   I TI 
Sbjct: 66  AERTGTEIDVQAFDSLLIAFAQQVSAQVIVRGLRAVSDFDYEFQMAGMNARLDQRIETIF 125

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVF 159
           L A E  ++++S  ++ +  +  DI+SFVP      
Sbjct: 126 LMASERHQFISSRFVKEIAQLGGDISSFVPKLTLER 161


>gi|225874848|ref|YP_002756307.1| pantetheine-phosphate adenylyltransferase [Acidobacterium
           capsulatum ATCC 51196]
 gi|225792806|gb|ACO32896.1| pantetheine-phosphate adenylyltransferase [Acidobacterium
           capsulatum ATCC 51196]
          Length = 162

 Score =  157 bits (396), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 59/168 (35%), Positives = 88/168 (52%), Gaps = 7/168 (4%)

Query: 1   MMRK-AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           M    A+Y GSFDP+TNGH+D+I +     + LV+AI  NS K   F   +    L +  
Sbjct: 1   MHTVKAIYPGSFDPVTNGHLDLIARGAKMFDHLVVAILRNSTKAPLFTEAERVEMLTEGV 60

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
                      VSV +F GL V+ A++  A  ++RG+R ++D++YE +M  +NR L PE+
Sbjct: 61  R------GFGNVSVATFHGLLVDFAREQKANAVLRGIRAISDYEYEFQMALMNRRLAPEV 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
            TI L       +V+S LI+ +  +   +   VPD V   LK  V  L
Sbjct: 115 ETIFLMPDAKYSFVSSRLIKQVFELGGSVDGLVPDFVVERLKQRVPHL 162


>gi|16078566|ref|NP_389385.1| phosphopantetheine adenylyltransferase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221309372|ref|ZP_03591219.1| phosphopantetheine adenylyltransferase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313699|ref|ZP_03595504.1| phosphopantetheine adenylyltransferase [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318621|ref|ZP_03599915.1| phosphopantetheine adenylyltransferase [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221322895|ref|ZP_03604189.1| phosphopantetheine adenylyltransferase [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321315264|ref|YP_004207551.1| phosphopantetheine adenylyltransferase [Bacillus subtilis BSn5]
 gi|8469189|sp|O34797|COAD_BACSU RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|2340005|emb|CAB11355.1| YlbI protein [Bacillus subtilis subsp. subtilis str. 168]
 gi|2633873|emb|CAB13375.1| phosphopantetheine adenylyltransferase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|291484052|dbj|BAI85127.1| phosphopantetheine adenylyltransferase [Bacillus subtilis subsp.
           natto BEST195]
 gi|320021538|gb|ADV96524.1| phosphopantetheine adenylyltransferase [Bacillus subtilis BSn5]
          Length = 161

 Score =  157 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 54/166 (32%), Positives = 91/166 (54%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDP+T GH+DII +     E + + +  NS K   F S++ER EL+++  
Sbjct: 1   MASIAVCPGSFDPVTYGHLDIIKRGAHIFEQVYVCVLNNSSKKPLF-SVEERCELLREVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +     V + +GL ++ AK  +A+ I+RGLR ++DF+YEM+ TSVNR L   I 
Sbjct: 60  KDIPNIT-----VETSQGLLIDYAKRKNAKAILRGLRAVSDFEYEMQGTSVNRVLDESIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T  +       +++S++++ +   +  ++ FVP  V + L+     
Sbjct: 115 TFFMMTNNQYSFLSSSIVKEVARYNGSVSEFVPPEVELALQQKFRQ 160


>gi|291542206|emb|CBL15316.1| Phosphopantetheine adenylyltransferase [Ruminococcus bromii L2-63]
          Length = 161

 Score =  157 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 55/166 (33%), Positives = 92/166 (55%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +  +  GSFDP+T GH+D+I +A    + +++ +  NS K   F SI ER EL+K+  
Sbjct: 1   MNKTVICPGSFDPVTLGHLDVITRASKLFDRVIVGVLVNSSKKPIF-SIDERIELLKEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          ++ F GL     +D     IV+GLR +TDF+YE +M   N+ L P + 
Sbjct: 60  EHLDNVE-----IVGFNGLLAQYCEDHGVDAIVKGLRAVTDFEYEFQMALTNKKLNPNLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+ L A+  S Y++S+++R + S+  DI++FVP  +   +   + +
Sbjct: 115 TLFLTAEADSMYLSSSMVREIASMGGDISNFVPACIHDRIVERLKN 160


>gi|205373064|ref|ZP_03225869.1| phosphopantetheine adenylyltransferase [Bacillus coahuilensis m4-4]
          Length = 164

 Score =  157 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 57/166 (34%), Positives = 91/166 (54%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + AV  GSFDP+T GH+DII +      ++ + +  NS K   F + + R ELIK++ 
Sbjct: 1   MGKIAVCPGSFDPLTYGHLDIITRGAKVFNEIRVVVLNNSSKNPLFTAAE-RVELIKEAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V +F GL ++ AK + A  I+RGLR ++DF+YEM++TS+NR L   I 
Sbjct: 60  KHLPN-----VQVDTFSGLLIDYAKRVGASAIIRGLRAVSDFEYEMQITSMNRVLDENIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T  +       +++S++++ +     DI+  VP  V   LK   + 
Sbjct: 115 TFFIMTNNQYSFLSSSIVKEVAKYKGDISELVPQIVEEKLKEKFME 160


>gi|281357724|ref|ZP_06244210.1| pantetheine-phosphate adenylyltransferase [Victivallis vadensis
           ATCC BAA-548]
 gi|281315671|gb|EFA99698.1| pantetheine-phosphate adenylyltransferase [Victivallis vadensis
           ATCC BAA-548]
          Length = 165

 Score =  157 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 53/167 (31%), Positives = 94/167 (56%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y GSFDP TNGH D++ +A    + +++A+  NS K+  F +++ER ELI++S  
Sbjct: 1   MKTVLYPGSFDPFTNGHRDLVARAGLLFDQVIVAVAVNSEKSPMF-TLEERKELIEKSCA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V++F GL V+  +  +AQ ++RGLR  +DF+YE++M  +NR L  E  T
Sbjct: 60  DLPHVK-----VVAFRGLVVDAIEKYNAQAVLRGLRAFSDFEYELQMALMNRSLRRECET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           I +     + YV S L++ + ++  +   +VP+ V   ++  +    
Sbjct: 115 IFMMPTLENSYVASRLVKEVAALKGNYRQYVPEVVAEAIEAKLAERR 161


>gi|149189223|ref|ZP_01867510.1| phosphopantetheine adenylyltransferase [Vibrio shilonii AK1]
 gi|148836977|gb|EDL53927.1| phosphopantetheine adenylyltransferase [Vibrio shilonii AK1]
          Length = 164

 Score =  157 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 55/160 (34%), Positives = 91/160 (56%), Gaps = 6/160 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D+I +A +  ++++IAI  +  K   F ++ ER E  ++   H 
Sbjct: 8   RVIYPGTFDPITNGHLDLIERAATMFDEVIIAIAASPSKNTMF-TLDERVEFAREVTKHL 66

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
              S+       F GL VN A+D  A V++RGLR   DF+YE  +T++ R L P + ++ 
Sbjct: 67  ENVSAK-----GFSGLLVNFAEDEKANVLIRGLRTTVDFEYEFGLTNMYRRLLPGLESVF 121

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L   E   +++STL+R +     D++ FVP  +   L+  
Sbjct: 122 LTPAEEHAFISSTLVREVAIHGGDVSQFVPPLIEKALQTK 161


>gi|256963618|ref|ZP_05567789.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis
           HIP11704]
 gi|307271559|ref|ZP_07552831.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0855]
 gi|256954114|gb|EEU70746.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis
           HIP11704]
 gi|306511831|gb|EFM80829.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0855]
          Length = 163

 Score =  157 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 44/163 (26%), Positives = 92/163 (56%), Gaps = 5/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A++ GSFDP+TNGH+++I ++    ++++I +  N+ K   F   +++  + + + 
Sbjct: 1   MRKIALFPGSFDPMTNGHLNLIERSAKLFDEVIIGVFINTSKQTLFTPEEKKYLIEEATK 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   N   ++    L V  AK + A  ++RG+R++ D++YE  +  +N+ L PEI 
Sbjct: 61  EM-----PNVRVIMQETQLTVESAKSLGANFLIRGIRNVKDYEYEKDIAKMNQHLAPEIE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           T+ L A+E   +V+S+L++ ++    D++ ++P  +   LK  
Sbjct: 116 TVFLLAEEPYAHVSSSLLKEVLRFGGDVSDYLPPNIYYALKQK 158


>gi|301167847|emb|CBW27432.1| phosphopantetheine adenylyltransferase [Bacteriovorax marinus SJ]
          Length = 157

 Score =  157 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 57/160 (35%), Positives = 95/160 (59%), Gaps = 6/160 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KAVY G+FDP TNGH DI+ +AL+  +++ + +  +  KT  F S ++R +++++  
Sbjct: 1   MKKKAVYAGTFDPFTNGHDDILKRALNLFDEVTVLVAVSPSKTPLF-SAEQRVKMLEEHF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                    +V V S+ GL V+ AK  +   I+RGLR   DF+ E +M S+N  L PEI 
Sbjct: 60  KDDT-----QVRVDSWSGLLVDYAKKNNINTIIRGLRPTGDFEVEFQMASMNNKLYPEIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           T+ L  +  + Y++S+LI+ +   D D++ FVP  +  +L
Sbjct: 115 TVFLMTEGQNYYISSSLIKEIYKHDGDVSEFVPAVINKWL 154


>gi|257087481|ref|ZP_05581842.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis D6]
 gi|257419904|ref|ZP_05596898.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis T11]
 gi|312899881|ref|ZP_07759199.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0470]
 gi|256995511|gb|EEU82813.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis D6]
 gi|257161732|gb|EEU91692.1| phosphopantetheine adenylyltransferase [Enterococcus faecalis T11]
 gi|311292877|gb|EFQ71433.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0470]
 gi|315025362|gb|EFT37294.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX2137]
 gi|315166353|gb|EFU10370.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX1341]
          Length = 163

 Score =  157 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 44/163 (26%), Positives = 92/163 (56%), Gaps = 5/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A++ GSFDP+TNGH+++I ++    ++++I +  N+ K   F   +++  + + + 
Sbjct: 1   MRKIALFPGSFDPMTNGHLNLIERSAKLFDEVIIGVFINTSKQTLFTPEEKKYLIKEATK 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   N   ++    L V  AK + A  ++RG+R++ D++YE  +  +N+ L PEI 
Sbjct: 61  EM-----PNVRVIMQETQLTVESAKSLGANFLIRGIRNVKDYEYEKDIAKMNQHLAPEIE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           T+ L A+E   +V+S+L++ ++    D++ ++P  +   LK  
Sbjct: 116 TVFLLAEEPYAHVSSSLLKEVLRFGGDVSDYLPPNIYHALKQK 158


>gi|254293785|ref|YP_003059808.1| pantetheine-phosphate adenylyltransferase [Hirschia baltica ATCC
           49814]
 gi|254042316|gb|ACT59111.1| pantetheine-phosphate adenylyltransferase [Hirschia baltica ATCC
           49814]
          Length = 164

 Score =  157 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 61/167 (36%), Positives = 91/167 (54%), Gaps = 3/167 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y G+FDPIT GHMDII +A+  V+ LVI +  N  K   F S++ER E++ Q   
Sbjct: 1   MKIGLYPGTFDPITYGHMDIISRAVKLVDKLVIGVAVNESKGPLF-SVEERVEMVLQETA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F  D+        F  L ++ A   +A  IVRGLR ++DF+YE +M ++N+ +   I T
Sbjct: 60  EFAKDAVIEAK--PFNNLLIHFADQCNAHAIVRGLRAVSDFEYEFQMVAMNQKMDSSIET 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L A    + V+S L++ +  +D DI  FVPD V   L        
Sbjct: 118 VFLMADPEHQAVSSRLVKEIARLDGDIDLFVPDGVSQRLYAKYGKTK 164


>gi|51892577|ref|YP_075268.1| phosphopantetheine adenylyltransferase [Symbiobacterium
           thermophilum IAM 14863]
 gi|61212550|sp|Q67PG9|COAD_SYMTH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|51856266|dbj|BAD40424.1| phosphopantetheine adenylyltransferase [Symbiobacterium
           thermophilum IAM 14863]
          Length = 162

 Score =  157 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 55/167 (32%), Positives = 90/167 (53%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KAV  GSFDP+T GH+DII +A    +++V+A+  N  K   F +++ER E+++++  
Sbjct: 1   MIKAVCPGSFDPVTLGHLDIIERAARTFDEVVVAVLTNPRKEPLF-TVEERLEMLREATK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H    S     V + +GL V+ A+    +VIV+GLR + DF+YE +M +VNR L   I T
Sbjct: 60  HIPNVS-----VAAADGLLVDFARQQGCRVIVKGLRPIQDFEYEWQMGAVNRQLDGNIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
             L ++    +++S+++R L          VP      L+       
Sbjct: 115 CFLMSRIEYAHLSSSIVRELAYFGRPTEGLVPPFTARRLREKFAKTQ 161


>gi|260774461|ref|ZP_05883375.1| phosphopantetheine adenylyltransferase [Vibrio metschnikovii CIP
           69.14]
 gi|260610588|gb|EEX35793.1| phosphopantetheine adenylyltransferase [Vibrio metschnikovii CIP
           69.14]
          Length = 164

 Score =  157 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 51/160 (31%), Positives = 86/160 (53%), Gaps = 6/160 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+DI+ +A S  ++++IA+  +  K   F ++ ER    +    H 
Sbjct: 8   RVIYPGTFDPITNGHLDIVERAASMFDEVIIAVAASPSKNTMF-TLDERVTFTQAVTQHL 66

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
              +S       F GL V+ A+   A V++RGLR   DF+YE  +T++ R L P + ++ 
Sbjct: 67  PNVTSK-----GFSGLMVDFARAEQANVLIRGLRTTVDFEYEFGLTNMYRRLMPGLESVF 121

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L   E   +++ST++R +     ++  FVP  V   L   
Sbjct: 122 LTPSEQYAFISSTIVREVAIHGGNVDGFVPTVVAQALSAK 161


>gi|260435860|ref|ZP_05789830.1| pantetheine-phosphate adenylyltransferase [Synechococcus sp. WH
           8109]
 gi|260413734|gb|EEX07030.1| pantetheine-phosphate adenylyltransferase [Synechococcus sp. WH
           8109]
          Length = 163

 Score =  157 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 60/165 (36%), Positives = 94/165 (56%), Gaps = 7/165 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDP+TNGHMD+I +A+S   ++V+A+  N  K   F S++ER E I+ +  
Sbjct: 1   MR-ALYPGSFDPLTNGHMDLIERAVSLFGEVVVAVLSNPSKRPAF-SVEERIEQIRTATC 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          VISF+GL VN A    A +I+RGLR M+DF+YE+++   NR L  ++ T
Sbjct: 59  HLSGVE-----VISFDGLTVNCAVTHRADLILRGLRAMSDFEYELQIAHTNRSLADDLET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + +       +++S++++ +      I   VP  V   L  +  S
Sbjct: 114 VFMATTARHSFLSSSVVKEVARFGGSIDHMVPPEVAKDLNRLFNS 158


>gi|119717507|ref|YP_924472.1| pantetheine-phosphate adenylyltransferase [Nocardioides sp. JS614]
 gi|166216568|sp|A1SLV0|COAD_NOCSJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|119538168|gb|ABL82785.1| Phosphopantetheine adenylyltransferase [Nocardioides sp. JS614]
          Length = 159

 Score =  157 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 57/165 (34%), Positives = 96/165 (58%), Gaps = 7/165 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +AV  GSFDP+TNGH+DI+ +A +  ++LV+A G N  K++ F   + R E++++   
Sbjct: 1   MTRAVCPGSFDPVTNGHLDIVRRAAAIFDELVVATGTNVSKSRLFDPEE-RLEMLREVCA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +     V+ F GL V+  +DI AQ IV+GLR   D++YE+ M  +N  L   + T
Sbjct: 60  DLPNVT-----VMGFTGLIVDFCRDIDAQAIVKGLRGGNDYEYELPMAQMNAHLT-GVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L    S  YV+S+L++ + S+  D+++ VP  V   L+  + +
Sbjct: 114 VFLTTHASWGYVSSSLVKEVASLGGDVSALVPPAVHGRLQARLAA 158


>gi|146340926|ref|YP_001205974.1| phosphopantetheine adenylyltransferase [Bradyrhizobium sp. ORS278]
 gi|166216061|sp|A4YV23|COAD_BRASO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|146193732|emb|CAL77749.1| phosphopantetheine adenylyltransferase [Bradyrhizobium sp. ORS278]
          Length = 164

 Score =  157 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 93/165 (56%), Gaps = 1/165 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++ QA+   + L++A+G +  K   F S +ER  +  +  
Sbjct: 1   MQRIALYPGSFDPVTNGHLDVVRQAVHLCDKLIVAVGVHHGKKPLF-STEERLAMAHEVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +       +++ L V  A+   A +++RGLRD TD DYEM++  +N+ + P I 
Sbjct: 60  GPVASAAGCAFDASTYDNLTVTAAQQAGAILMIRGLRDGTDLDYEMQLAGMNQTMAPSIQ 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T+ + A    R +T++L+R + ++  +I+ FVP  V   LK    
Sbjct: 120 TVFVPASVPVRPITASLVRQIAAMGGEISHFVPPSVVAPLKAKFA 164


>gi|329936746|ref|ZP_08286453.1| phosphopantetheine adenylyltransferase [Streptomyces
           griseoaurantiacus M045]
 gi|329303976|gb|EGG47859.1| phosphopantetheine adenylyltransferase [Streptomyces
           griseoaurantiacus M045]
          Length = 159

 Score =  156 bits (395), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 90/165 (54%), Gaps = 7/165 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GSFDPITNGH+DII +A    +++ +A+  N  K   F  ++ER +LI+    
Sbjct: 1   MRRAVCPGSFDPITNGHLDIIARASRLYDEVYVAVMINKSKKGLFE-VEERIDLIRGETA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F       V V +F GL V+  K      IV+GLR ++DFDYE++M  +N  L   + T
Sbjct: 60  DFGN-----VRVEAFHGLLVDFCKQREIPAIVKGLRAVSDFDYELQMAQMNNGLS-GVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + +    +  +++S+L++ + +   D++  VP  V   L   +  
Sbjct: 114 LFVPTNPTYSFLSSSLVKEVAAWGGDVSHLVPPAVLAALGERLRK 158


>gi|322835038|ref|YP_004215065.1| pantetheine-phosphate adenylyltransferase [Rahnella sp. Y9602]
 gi|321170239|gb|ADW75938.1| pantetheine-phosphate adenylyltransferase [Rahnella sp. Y9602]
          Length = 160

 Score =  156 bits (395), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 56/166 (33%), Positives = 93/166 (56%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+DI+ +A    + +++AI  +  K   F S+ ER  L  Q  
Sbjct: 1   MSTKAIYPGTFDPMTNGHLDIVTRAALMFDQVILAIAASPSKKPMF-SLDERVALATQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          VI F  L  N AK+  A V+VRGLR ++DF+YEM++ ++NR L P + 
Sbjct: 60  SHLDNVE-----VIGFSDLMANFAKNQGANVLVRGLRAVSDFEYEMQLANMNRHLLPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           ++ +   +   +++S+L++ +     DIT F+P  +   L   + +
Sbjct: 115 SVFMMPSKEWSFISSSLVKEVARHGGDITPFLPQIITQALMEKISA 160


>gi|152994584|ref|YP_001339419.1| pantetheine-phosphate adenylyltransferase [Marinomonas sp. MWYL1]
 gi|150835508|gb|ABR69484.1| pantetheine-phosphate adenylyltransferase [Marinomonas sp. MWYL1]
          Length = 164

 Score =  156 bits (395), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 53/167 (31%), Positives = 92/167 (55%), Gaps = 6/167 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AVY G+FDPITNGH D++ +A    E +++A+  +  K     S + R  L K+ +
Sbjct: 4   MSTIAVYPGTFDPITNGHTDLVERASKLFEKVIVAVAASPKKRPAL-SHELRISLAKEVL 62

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F+ L     + +S +V++RGLR ++DF+YE ++ ++NR + P++ 
Sbjct: 63  GHLTNVE-----VVGFDNLLTEFTRSVSGKVVIRGLRAVSDFEYEFQLANMNRAIAPDVE 117

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           +I L   E   Y++STL+R + S++ D   FV   V   L+    ++
Sbjct: 118 SIFLTPSEKHSYISSTLVREIASLNGDFGQFVNPEVKRVLQEHYQTI 164


>gi|319795652|ref|YP_004157292.1| pantetheine-phosphate adenylyltransferase [Variovorax paradoxus
           EPS]
 gi|315598115|gb|ADU39181.1| pantetheine-phosphate adenylyltransferase [Variovorax paradoxus
           EPS]
          Length = 167

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 94/166 (56%), Gaps = 5/166 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            AVY G+FDPIT GH D++ +A      +++A+     K K   ++QER ++ ++++  +
Sbjct: 6   IAVYPGTFDPITLGHEDVVRRATQLFSKVIVAVAAGHHK-KALFNLQERMDMAREAVKPY 64

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               S++V+V SF GL  +       + +VRGLR +TDFDYE ++  +NR L P++ T+ 
Sbjct: 65  ----SDQVTVESFSGLLRDFVVARGGKAMVRGLRAVTDFDYEFQLAGMNRSLMPDVETVF 120

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           L   +  ++++ST +R +  +  ++  FV   V   L   V SL +
Sbjct: 121 LTPSDKYQFISSTFVREIAMLGGEVNKFVSPNVEHMLAAKVRSLGR 166


>gi|114321802|ref|YP_743485.1| phosphopantetheine adenylyltransferase [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|122310763|sp|Q0A592|COAD_ALHEH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|114228196|gb|ABI57995.1| Phosphopantetheine adenylyltransferase [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 174

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 53/171 (30%), Positives = 92/171 (53%), Gaps = 8/171 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAI--GCNSVKTKGFLSIQERSELIKQ 58
           M   AVY G+FDP+TNGH D++ ++    + L++A+    +  K   F ++ ER  L ++
Sbjct: 1   MAIVAVYPGTFDPLTNGHADLVQRSCRLFDRLIVAVAAYPSPSKRPAF-TLDERLALARE 59

Query: 59  SIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPE 118
            +            V +F+ L V+  +   A VI+RGLR ++DF++E ++ S+NR L  E
Sbjct: 60  VLKDMPGVE-----VEAFDTLLVDFVRARGATVILRGLRAVSDFEHEFQLASMNRQLIEE 114

Query: 119 IATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + T+ L   E   Y++S+L+R + ++  D+T FVP  V   L        +
Sbjct: 115 VETVFLTPAEQHAYISSSLVREVAALGGDVTRFVPPVVARALARRYSGPNR 165


>gi|315150110|gb|EFT94126.1| pantetheine-phosphate adenylyltransferase [Enterococcus faecalis
           TX0012]
          Length = 163

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 44/163 (26%), Positives = 92/163 (56%), Gaps = 5/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A++ GSFDP+TNGH+++I ++    ++++I +  N+ K   F   +++  + + + 
Sbjct: 1   MRKIALFPGSFDPMTNGHLNLIERSAKLFDEVIIGVFINTSKQTLFTPEEKKYLIEEATK 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   N   ++    L V  AK + A  ++RG+R++ D++YE  +  +N+ L PEI 
Sbjct: 61  EM-----PNVRVIMKETQLTVESAKSLGANFLIRGIRNVKDYEYEKDIAKMNQHLAPEIE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           T+ L A+E   +V+S+L++ ++    D++ ++P  +   LK  
Sbjct: 116 TVFLLAEEPYAHVSSSLLKEVLRFGGDVSDYLPPNIYHALKQK 158


>gi|85373943|ref|YP_458005.1| phosphopantetheine adenylyltransferase [Erythrobacter litoralis
           HTCC2594]
 gi|84787026|gb|ABC63208.1| lipopolysaccharide core biosynthesis protein KdtB [Erythrobacter
           litoralis HTCC2594]
          Length = 170

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 52/168 (30%), Positives = 83/168 (49%), Gaps = 4/168 (2%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R  VY G+FDPIT GH DII +    V+ L+I +  N  K   F   +     ++     
Sbjct: 4   RIGVYPGTFDPITRGHRDIIRRGAKLVDTLIIGVTTNPSKNPMFTPEE----RMEMVKKE 59

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                 +   V+ F+ L +  AK  +A VIVRGLR + DF+YE +M  +N+ +  +I T+
Sbjct: 60  LADMGLDNTEVVGFDALLMKFAKKQNANVIVRGLRAVADFEYEYQMAGMNQQIDADIETV 119

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKY 170
            L A  S + + S L++ +     DI+ FV   V   ++  V  + + 
Sbjct: 120 FLMADVSLQPIASKLVKEIALYGGDISPFVSPAVKAQVEARVEKIGRR 167


>gi|302392172|ref|YP_003827992.1| phosphopantetheine adenylyltransferase [Acetohalobium arabaticum
           DSM 5501]
 gi|302204249|gb|ADL12927.1| Phosphopantetheine adenylyltransferase [Acetohalobium arabaticum
           DSM 5501]
          Length = 161

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 57/164 (34%), Positives = 98/164 (59%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R AVY GSFDPITNGH+DII +  +  +++++A+  N  K     S +ER ++I+++I
Sbjct: 1   MGRAAVYPGSFDPITNGHLDIIERTANIFDNVIVAVSNNPNK-DHLFSREERVQMIEEAI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             +         V +F+GL ++  ++  A++IVRGLR ++DF+ E +M S+N+ L  +I 
Sbjct: 60  VDYEEIE-----VDAFDGLLIDYIREQKAEIIVRGLRAVSDFEAEFQMASMNKKLDSDIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           TI +  K    Y++S++IR +  +   I   VP+ V   L+  +
Sbjct: 115 TIFMMTKNQYVYLSSSIIREVSELGGCIEGLVPENVIPKLREKI 158


>gi|153810848|ref|ZP_01963516.1| hypothetical protein RUMOBE_01232 [Ruminococcus obeum ATCC 29174]
 gi|149833244|gb|EDM88326.1| hypothetical protein RUMOBE_01232 [Ruminococcus obeum ATCC 29174]
          Length = 169

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 56/174 (32%), Positives = 93/174 (53%), Gaps = 6/174 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDP T GH+D+I +A    + +V+ +  NS K+  F S++ER  +++++  
Sbjct: 1   MVTAVYPGSFDPATYGHLDVIRRASVSFDRVVVGVLQNSAKSPLF-SVEERVNILEKATK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                       +S      N A++  AQVIVRGLR +TDF+YE++M   NR L P++ T
Sbjct: 60  DIPNVVIRPFDGLSV-----NFARENHAQVIVRGLRAVTDFEYELQMAQTNRVLAPDVDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKL 175
           + L       YV+ST+++ +     D++SF P  +   L   +    + +   +
Sbjct: 115 VFLTTTLEYAYVSSTIMKEVARFGGDLSSFAPPEIIQALCKKMQEEKEKNKENI 168


>gi|254500933|ref|ZP_05113084.1| pantetheine-phosphate adenylyltransferase [Labrenzia alexandrii
           DFL-11]
 gi|222437004|gb|EEE43683.1| pantetheine-phosphate adenylyltransferase [Labrenzia alexandrii
           DFL-11]
          Length = 167

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 66/163 (40%), Positives = 101/163 (61%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGHMDI+ Q+L+  + +V+AIG +  K   F   +    +   ++
Sbjct: 1   MTRIALYPGSFDPVTNGHMDILRQSLALADKVVVAIGIHPGKKPLFSFEERVELIHTSAV 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F    ++R+ VI+F  L +N A+   A  +VRGLRD TD DYEM+M  +N  L P+I 
Sbjct: 61  AEFSEAEASRIEVIAFSDLVINTARTQKADYLVRGLRDGTDLDYEMQMAGMNGTLEPDIK 120

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           T+ L A  + R++T+TL+R +  +  +I++FVPDPV   L+  
Sbjct: 121 TVFLPASPAVRHITATLVRQIAQMGGEISAFVPDPVADPLRQR 163


>gi|319948350|ref|ZP_08022494.1| phosphopantetheine adenylyltransferase [Dietzia cinnamea P4]
 gi|319437981|gb|EFV92957.1| phosphopantetheine adenylyltransferase [Dietzia cinnamea P4]
          Length = 157

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 57/163 (34%), Positives = 89/163 (54%), Gaps = 7/163 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M   V  GSFDP+T GH+DII +A    +D+V+ +  N  K   F +I ER  LI +   
Sbjct: 1   MTTVVCPGSFDPVTLGHLDIIRRAAELFDDVVVCVVANPNKQGTF-TIDERKALIDEVCA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    V V SF GL V+  +D  A  +++GLRD TD+DYE+ M  +NR +   + T
Sbjct: 60  DMP-----GVRVDSFYGLLVDYCRDQGATAVIKGLRDSTDYDYELPMAHMNRSIA-GVDT 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L  +    +V+S+L R +  +  D++  +P+PV V L+  +
Sbjct: 114 VFLPTRADLAFVSSSLCREVTRLGGDVSHLLPEPVAVALRQRL 156


>gi|149920738|ref|ZP_01909202.1| phosphopantetheine adenylyltransferase [Plesiocystis pacifica
           SIR-1]
 gi|149818391|gb|EDM77842.1| phosphopantetheine adenylyltransferase [Plesiocystis pacifica
           SIR-1]
          Length = 176

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 57/161 (35%), Positives = 91/161 (56%), Gaps = 6/161 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            AVY GSFDPIT GH +I+ +A    +++V+A+G + VK  GF S ++R ELI++   H 
Sbjct: 9   IAVYPGSFDPITLGHTEILERAAQLFDEVVVAVGHHPVKR-GFFSYEQRVELIREVTAHI 67

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               +       F GL ++  +++ A+VIVRGLR   DF+ E +M   NR L P++ T+ 
Sbjct: 68  PNVRAAH-----FSGLMIDFCREVGARVIVRGLRAAGDFEPEFQMALANRELEPKVETVF 122

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           L  +   ++++S+LIR + S       FVP  V   ++   
Sbjct: 123 LIPEPQKQFISSSLIREIASHGGPFQRFVPGAVSRAMEARY 163


>gi|255324612|ref|ZP_05365729.1| pantetheine-phosphate adenylyltransferase [Corynebacterium
           tuberculostearicum SK141]
 gi|311740521|ref|ZP_07714348.1| pantetheine-phosphate adenylyltransferase [Corynebacterium
           pseudogenitalium ATCC 33035]
 gi|255298518|gb|EET77818.1| pantetheine-phosphate adenylyltransferase [Corynebacterium
           tuberculostearicum SK141]
 gi|311304041|gb|EFQ80117.1| pantetheine-phosphate adenylyltransferase [Corynebacterium
           pseudogenitalium ATCC 33035]
          Length = 157

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 57/165 (34%), Positives = 86/165 (52%), Gaps = 8/165 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KAV  GSFDP+T GH+DII +A    +++ + +  N  K  G  S++ER ELI+QS+ 
Sbjct: 1   MTKAVCPGSFDPVTLGHVDIINRANQMFDEVTVLVTGNPDKPSGLFSVEERMELIRQSVD 60

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             I        V    GL V+   +  A V+V+GLR   D++YE+ M  +NR L   I T
Sbjct: 61  SSIK-------VDYCSGLLVDYTTEHGADVLVKGLRSSLDYEYELPMAQMNRRLS-GIDT 112

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   Y++S+L + +     D+T   P+ V   +K     
Sbjct: 113 VFLLTDEKYGYISSSLCKQVAKFGGDVTGMFPESVGRAVKEKYRQ 157


>gi|38233729|ref|NP_939496.1| phosphopantetheine adenylyltransferase [Corynebacterium diphtheriae
           NCTC 13129]
 gi|61212618|sp|Q6NHJ8|COAD_CORDI RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|38199990|emb|CAE49659.1| phosphopantetheine adenylyltransferase [Corynebacterium
           diphtheriae]
          Length = 159

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 85/165 (51%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRKAV  GSFDP+T GH+DII +A    +++ + +  N  K  G  ++ ER  LIK+S  
Sbjct: 1   MRKAVCPGSFDPVTMGHLDIIGRAAQQYDEVTVLVTANPNKPSGMFTVDERLALIKESTA 60

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           HF+        V ++ GL V+         IV+GLR   D++YE+ M  +NR L   + T
Sbjct: 61  HFVNVK-----VDNWAGLLVDYTTANGIDAIVKGLRTALDYEYELPMAQMNRKLA-GVDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L       Y++STL + +     D++  +P  V   +   V S
Sbjct: 115 LFLMTDPQYGYISSTLCKEVTKYGGDVSDMLPPAVAAAIVEKVKS 159


>gi|238754766|ref|ZP_04616118.1| Phosphopantetheine adenylyltransferase [Yersinia ruckeri ATCC
           29473]
 gi|238707074|gb|EEP99439.1| Phosphopantetheine adenylyltransferase [Yersinia ruckeri ATCC
           29473]
          Length = 158

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 53/164 (32%), Positives = 94/164 (57%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           MM KA+Y G+FDP+TNGH+D++ +A +    +++AI  ++ K   F ++ ER  L  +  
Sbjct: 1   MMTKAIYPGTFDPMTNGHLDLVTRASAMFGHVILAIADSAHKKPMF-TLDERVTLASEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          VI F  L  + A+   A ++VRGLR ++DF+YE ++ ++NR L P + 
Sbjct: 60  AHLDNVE-----VIGFSELMASFAQQHQANILVRGLRSVSDFEYEWQLANMNRHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           ++ L   E   +++S+L++ +     DIT F+P P+   L + +
Sbjct: 115 SVFLLPSEKWSFISSSLVKEVARHGGDITPFLPAPITKALLDKL 158


>gi|304316955|ref|YP_003852100.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778457|gb|ADL69016.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 159

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 57/168 (33%), Positives = 98/168 (58%), Gaps = 9/168 (5%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDP+TNGH+D+I +A    + L++A+  N  KT  F S++ER E++++  F
Sbjct: 1   MNIAVYPGSFDPVTNGHLDVIKRAAKVFDKLIVAVLINPSKTPMF-SVEERVEMLREVTF 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      +  F GL +   + +++++IV+GLR ++DF+YE +M  +N+ L PE+ T
Sbjct: 60  DIENVE-----IDCFSGLLIEYLEKVNSKIIVKGLRMVSDFEYEFQMALINKKLNPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           I         Y++S++++ + S    ++  VPD V   +K+I   L K
Sbjct: 115 IFFMTSNKYGYLSSSIVKEVASFGGCLSDLVPDSV---IKHIFKKLKK 159


>gi|229521060|ref|ZP_04410481.1| phosphopantetheine adenylyltransferase [Vibrio cholerae TM
           11079-80]
 gi|261210486|ref|ZP_05924780.1| phosphopantetheine adenylyltransferase [Vibrio sp. RC341]
 gi|262404959|ref|ZP_06081511.1| phosphopantetheine adenylyltransferase [Vibrio sp. RC586]
 gi|297581675|ref|ZP_06943597.1| phosphopantetheine adenylyltransferase [Vibrio cholerae RC385]
 gi|229341945|gb|EEO06946.1| phosphopantetheine adenylyltransferase [Vibrio cholerae TM
           11079-80]
 gi|260840544|gb|EEX67110.1| phosphopantetheine adenylyltransferase [Vibrio sp. RC341]
 gi|262348798|gb|EEY97939.1| phosphopantetheine adenylyltransferase [Vibrio sp. RC586]
 gi|297534082|gb|EFH72921.1| phosphopantetheine adenylyltransferase [Vibrio cholerae RC385]
          Length = 164

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 87/160 (54%), Gaps = 6/160 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D+I +A    ++++IA+  +  K   F +++ER E  +    H 
Sbjct: 8   RVIYPGTFDPITNGHLDLIERAAQMFDEVIIAVAASPSKNTLF-TLEERVEFARHVTSHL 66

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
              S+       F GL V+ AK   A V++RGLR   DF+YE  +T++ R L P + ++ 
Sbjct: 67  DNVSAK-----GFSGLLVDFAKAEKANVLIRGLRTTVDFEYEFGLTNMYRRLMPGLESVF 121

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L   E   +++STL+R +     ++  FVP  V   L   
Sbjct: 122 LTPAEEHAFISSTLVREVAIHGGNVDEFVPAIVANALHQK 161


>gi|120612510|ref|YP_972188.1| pantetheine-phosphate adenylyltransferase [Acidovorax citrulli
           AAC00-1]
 gi|120590974|gb|ABM34414.1| pantetheine-phosphate adenylyltransferase [Acidovorax citrulli
           AAC00-1]
          Length = 167

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 90/165 (54%), Gaps = 6/165 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            AVY G+FDPIT GH D++ +A      +++A+     K   F S++ER  ++++++  +
Sbjct: 6   IAVYPGTFDPITLGHEDVVRRATQLFGSVIVAVAAGHHKKTLF-SLEERIAMVREAVQPY 64

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                 +V V SF GL  +       + +VRGLR +TDFDYE ++  +NR L PE+ T+ 
Sbjct: 65  P-----QVRVESFSGLLRDFVVAREGKAMVRGLRAVTDFDYEFQLAGMNRSLMPEVETVF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           L   +  ++++ST +R +  +  ++  FV   VC  L   V  + 
Sbjct: 120 LTPSDKYQFISSTFVREIAVLGGEVDKFVSPGVCQRLAAKVRGMA 164


>gi|153800838|ref|ZP_01955424.1| phosphopantetheine adenylyltransferase [Vibrio cholerae MZO-3]
 gi|153826357|ref|ZP_01979024.1| phosphopantetheine adenylyltransferase [Vibrio cholerae MZO-2]
 gi|124123669|gb|EAY42412.1| phosphopantetheine adenylyltransferase [Vibrio cholerae MZO-3]
 gi|149739926|gb|EDM54113.1| phosphopantetheine adenylyltransferase [Vibrio cholerae MZO-2]
          Length = 164

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 54/160 (33%), Positives = 88/160 (55%), Gaps = 6/160 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D+I +A    ++++IA+  +  K   F +++ER E  +Q   H 
Sbjct: 8   RVIYPGTFDPITNGHLDLIERAAQMFDEVIIAVAASPSKNTLF-TLEERVEFARQVTSHL 66

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
              S+       F GL V+ AK   A V++RGLR   DF+YE  +T++ R L P + ++ 
Sbjct: 67  DNVSAK-----GFSGLLVDFAKAEKANVLIRGLRTTVDFEYEFGLTNMYRRLMPGLESVF 121

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L   E   +++STL+R +     ++  FVP  V   L   
Sbjct: 122 LTPAEEHAFISSTLVREVAIHGGNVDEFVPTIVANALHQK 161


>gi|218245484|ref|YP_002370855.1| pantetheine-phosphate adenylyltransferase [Cyanothece sp. PCC 8801]
 gi|257058520|ref|YP_003136408.1| pantetheine-phosphate adenylyltransferase [Cyanothece sp. PCC 8802]
 gi|218165962|gb|ACK64699.1| pantetheine-phosphate adenylyltransferase [Cyanothece sp. PCC 8801]
 gi|256588686|gb|ACU99572.1| pantetheine-phosphate adenylyltransferase [Cyanothece sp. PCC 8802]
          Length = 162

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 56/171 (32%), Positives = 91/171 (53%), Gaps = 9/171 (5%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDPIT GH+DII +     E +++A+ CN+ K   F S+++R E I++   
Sbjct: 1   MVIAIYPGSFDPITLGHLDIIERGGMLFERVIVAVLCNTSKKPVF-SVEKRVEQIRECTQ 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +        V SF GL V  AK   A V++RGLR ++DF+ E++M   N+ L   I T
Sbjct: 60  HLLNVE-----VDSFTGLTVEYAKLHKAGVLLRGLRVLSDFEKELQMAHTNKTLSEAIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDS 172
           + L       +++S+ ++ +     +I+  VP+ V   L    +   K + 
Sbjct: 115 VFLATTTEYSFLSSSTVKEIAQFGGEISHLVPENVARDL---YVYYSKPNQ 162


>gi|148264545|ref|YP_001231251.1| phosphopantetheine adenylyltransferase [Geobacter uraniireducens
           Rf4]
 gi|189082572|sp|A5G4G0|COAD_GEOUR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|146398045|gb|ABQ26678.1| pantetheine-phosphate adenylyltransferase [Geobacter uraniireducens
           Rf4]
          Length = 162

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 55/164 (33%), Positives = 95/164 (57%), Gaps = 6/164 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           +KAVY GSFDPIT GH+DII + L   + +++A+  NS K   F +++ER  LI++ +  
Sbjct: 4   KKAVYPGSFDPITYGHIDIIERGLKVFDTVIVAVARNSEKNSLF-NVEERIALIREVL-- 60

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                ++R  V +F+GL V+  +   A VI+RGLR ++DF+YE ++  +NR +  E+ T+
Sbjct: 61  ---GDNSRAKVDTFDGLLVDYVRKQGATVIIRGLRAVSDFEYEFQLAQMNRSITQEVETL 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            +       Y++S++++ + S++  I   VP  V   L      
Sbjct: 118 FMMTSVPYSYLSSSIVKEVSSLNGPIDGLVPPLVKKALDAKFNR 161


>gi|87124467|ref|ZP_01080316.1| putative pantetheine-phosphate adenylyltransferase [Synechococcus
           sp. RS9917]
 gi|86168039|gb|EAQ69297.1| putative pantetheine-phosphate adenylyltransferase [Synechococcus
           sp. RS9917]
          Length = 204

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 58/159 (36%), Positives = 93/159 (58%), Gaps = 7/159 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDP+T GH+D+I +      ++V+A+  N  KT  F S+++R   I+ S  
Sbjct: 40  MR-ALYPGSFDPLTLGHLDLIERGCRLFGEVVVAVLQNPGKTPAF-SLEQRLAQIEASTA 97

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H        V V SF+GL V  A++I A +I+RGLR M+DF+YE+++   NR L PEI T
Sbjct: 98  HLS-----GVRVTSFDGLTVRCAEEIGADLILRGLRAMSDFEYELQIAHTNRSLQPEIET 152

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           + L       +++S++++ +      ++  VP+ V   L
Sbjct: 153 VFLATSAHHSFLSSSVVKEVARFGGRVSHMVPEVVAQDL 191


>gi|262392588|ref|YP_003284442.1| phosphopantetheine adenylyltransferase [Vibrio sp. Ex25]
 gi|262336182|gb|ACY49977.1| phosphopantetheine adenylyltransferase [Vibrio sp. Ex25]
          Length = 161

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 58/166 (34%), Positives = 91/166 (54%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +K +Y G+FDPITNGH+D+I +     + + I +  +  K   F S+ ER EL+ Q  
Sbjct: 1   MNKKVIYPGTFDPITNGHLDLIERTAKMFDSVTIGVAASPSKNTMF-SLDERVELVHQCC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H    S     V+ F GL V+ AK+  A +++RGLR   DF+YE  +TS+ R L P + 
Sbjct: 60  QHLSNVS-----VVGFSGLLVDFAKEQQASILIRGLRTTMDFEYEFGLTSMYRKLLPGLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           +I L   E   +++ST++R +     ++  FVP PV   +   + S
Sbjct: 115 SIFLTPSEEFAFLSSTIVREVAIHGGNVAQFVPSPVNTAILEKLRS 160


>gi|313113536|ref|ZP_07799125.1| pantetheine-phosphate adenylyltransferase [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310624263|gb|EFQ07629.1| pantetheine-phosphate adenylyltransferase [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 185

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 64/171 (37%), Positives = 92/171 (53%), Gaps = 7/171 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDP+T GH+DII +A    + L++A+  NS K   F +++ER EL+K+   
Sbjct: 18  MATAVYPGSFDPVTKGHLDIIKRAAKINDHLIVAVLNNSAKNPLF-TVEERVELLKECCK 76

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    VSV SF+GL V  AK   A V+VRGLR +TDF+ E+++   N  L P I T
Sbjct: 77  -----GIQNVSVESFDGLTVEFAKKRHASVMVRGLRAVTDFENEIQLAQTNHALMPGIET 131

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL-VKYD 171
           + L       Y++ST+++      +DI  FV   V   +      +  K D
Sbjct: 132 MFLATSIKWSYLSSTIVKEAAYYGSDIGKFVTPNVEKAVNEKYALIRQKKD 182


>gi|300781316|ref|ZP_07091170.1| pantetheine-phosphate adenylyltransferase [Corynebacterium
           genitalium ATCC 33030]
 gi|300533023|gb|EFK54084.1| pantetheine-phosphate adenylyltransferase [Corynebacterium
           genitalium ATCC 33030]
          Length = 161

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 54/164 (32%), Positives = 83/164 (50%), Gaps = 6/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KAV  GSFDP+TNGH+DI  +A    +++ + +  N  K  G  SI ER +LI++   
Sbjct: 1   MTKAVCPGSFDPVTNGHLDIFTRAARSFDEVTVLVTGNPNKQSGLFSIDERMDLIREVTS 60

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H    +     V ++ GL V+     +   +V+GLR   D+DYE+ M  +NR L   + T
Sbjct: 61  HIPNIT-----VDTWGGLLVDYTTAHNIGALVKGLRSSLDYDYELPMAQMNRRLS-GVDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
             L   E   Y++S+L + +     D+   VPDPV   +     
Sbjct: 115 FFLMTDEKYGYISSSLCKEVAKYGGDLKGLVPDPVFEAMNQKFS 158


>gi|225627570|ref|ZP_03785607.1| pantetheine-phosphate adenylyltransferase [Brucella ceti str. Cudo]
 gi|256159821|ref|ZP_05457558.1| phosphopantetheine adenylyltransferase [Brucella ceti M490/95/1]
 gi|256255072|ref|ZP_05460608.1| phosphopantetheine adenylyltransferase [Brucella ceti B1/94]
 gi|260168804|ref|ZP_05755615.1| phosphopantetheine adenylyltransferase [Brucella sp. F5/99]
 gi|261222263|ref|ZP_05936544.1| phosphopantetheine adenylyltransferase [Brucella ceti B1/94]
 gi|261758287|ref|ZP_06001996.1| phosphopantetheine adenylyltransferase [Brucella sp. F5/99]
 gi|265998227|ref|ZP_06110784.1| phosphopantetheine adenylyltransferase [Brucella ceti M490/95/1]
 gi|225617575|gb|EEH14620.1| pantetheine-phosphate adenylyltransferase [Brucella ceti str. Cudo]
 gi|260920847|gb|EEX87500.1| phosphopantetheine adenylyltransferase [Brucella ceti B1/94]
 gi|261738271|gb|EEY26267.1| phosphopantetheine adenylyltransferase [Brucella sp. F5/99]
 gi|262552695|gb|EEZ08685.1| phosphopantetheine adenylyltransferase [Brucella ceti M490/95/1]
          Length = 164

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 70/165 (42%), Positives = 101/165 (61%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGH+D++  AL   + +++AIG +  K   F S  ER  LI+ S  
Sbjct: 1   MTIAIYAGSFDPVTNGHIDVLKGALRLADQVIVAIGIHPGKKPLF-SFDERVALIEASAK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   + RVSVI+F+GL ++ A+   AQ++VRGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  AVLHKDAARVSVIAFDGLVIDAARKHGAQLMVRGLRDGTDLDYEMQMAGMNGTMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A  + R +T+TL+R + S+  DI  FVP  V   L     S
Sbjct: 120 VFLPADPAVRTITATLVRQIASMGGDIKPFVPVAVAAALNTKFKS 164


>gi|186684078|ref|YP_001867274.1| phosphopantetheine adenylyltransferase [Nostoc punctiforme PCC
           73102]
 gi|229500850|sp|B2J6C6|COAD_NOSP7 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|186466530|gb|ACC82331.1| pantetheine-phosphate adenylyltransferase [Nostoc punctiforme PCC
           73102]
          Length = 183

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 55/161 (34%), Positives = 88/161 (54%), Gaps = 6/161 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y GSFDPIT GH+D+I +     E +++A+  N  KT  F S+Q+R E I+ S  H 
Sbjct: 2   IAIYPGSFDPITLGHLDLIQRGSRLFERVIVAVLRNPNKTPLF-SVQQRLEQIRLSTQHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V SF+GL VN A+   AQV++RGLR ++DF+ E++M   N+ L  +I T+ 
Sbjct: 61  PNVE-----VDSFDGLTVNYAQMRHAQVLLRGLRAVSDFEVELQMAHTNKTLSTQIETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           L       +++S+++R +      I   VP  + + +    
Sbjct: 116 LATSNEYSFLSSSVVREIARFGGSIDHLVPPHIALDIYQCY 156


>gi|331091195|ref|ZP_08340036.1| phosphopantetheine adenylyltransferase [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330404642|gb|EGG84181.1| phosphopantetheine adenylyltransferase [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 158

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 60/164 (36%), Positives = 102/164 (62%), Gaps = 6/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A+Y GSFDP+T GHMDII ++   V++L++ +  N+ KT  F S++ER ++++++  
Sbjct: 1   MLRAIYPGSFDPVTLGHMDIIKRSCKIVDELIVGVLNNNAKTPLF-SVEERVKMLREATK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V+ FEGL V+ AK I A+V++RGLR +TDF+YE++MT  N  L P++ T
Sbjct: 60  ELKNVK-----VVEFEGLLVDFAKAIDAKVVIRGLRAITDFEYELQMTQTNHKLEPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L       +++ST ++ + +   DIT FVP+ V   ++  + 
Sbjct: 115 LFLTTSIEYSFLSSTTVKEVAAFGGDITQFVPEVVVKEIEEKMK 158


>gi|218295485|ref|ZP_03496298.1| pantetheine-phosphate adenylyltransferase [Thermus aquaticus
           Y51MC23]
 gi|218244117|gb|EED10643.1| pantetheine-phosphate adenylyltransferase [Thermus aquaticus
           Y51MC23]
          Length = 161

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 50/161 (31%), Positives = 88/161 (54%), Gaps = 6/161 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKT-KGFLSIQERSELIKQSIFHF 63
            VY GSFDP+TNGH+D+I +A      + +AI  N  K  +   + +ER  +++++  H 
Sbjct: 3   VVYPGSFDPLTNGHLDVIQRASRLFAKVTVAILENPNKRGQYLFTAEERLTIVREATAHL 62

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               +      +F GL V+  K + AQ IV+GLR ++D++YE++M  +NR L P + T+ 
Sbjct: 63  PNVEAA-----TFSGLLVDFVKRVGAQAIVKGLRAVSDYEYELQMAHLNRQLLPGLETLF 117

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + +     +V+ST+++ +     D++  VP      LK   
Sbjct: 118 ILSATRYSFVSSTMVKEIARYGGDVSKLVPPATLRALKAKF 158


>gi|85708530|ref|ZP_01039596.1| phosphopantetheine adenylyltransferase [Erythrobacter sp. NAP1]
 gi|85690064|gb|EAQ30067.1| phosphopantetheine adenylyltransferase [Erythrobacter sp. NAP1]
          Length = 170

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 54/168 (32%), Positives = 86/168 (51%), Gaps = 4/168 (2%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R  +Y G+FDPIT GH DII +    V++L+I +  N  K   F + +  + + ++    
Sbjct: 4   RIGIYPGTFDPITLGHADIIRRGSKLVDELIIGVTTNPSKNPMFSTDERFAMVEREVAAL 63

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                 + V V+ F  L V  A+   A VI+RGLR + DF+YE +M  +N+ L  +I T+
Sbjct: 64  ----GLDNVQVVGFNALLVKFAQKQGANVIIRGLRAVADFEYEYQMAGMNQQLDEDIETV 119

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKY 170
            L A  S + + S L++ +     DIT FV  PV   +   V  + + 
Sbjct: 120 FLMADVSLQPIASKLVKEIALYGGDITPFVSAPVKDEVIARVDKIGRK 167


>gi|95929551|ref|ZP_01312293.1| Coenzyme A biosynthesis protein [Desulfuromonas acetoxidans DSM
           684]
 gi|95134248|gb|EAT15905.1| Coenzyme A biosynthesis protein [Desulfuromonas acetoxidans DSM
           684]
          Length = 163

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 56/164 (34%), Positives = 98/164 (59%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R AVY GSFDPITNGH+DII + L   + +++A+  NS K KG  S++ER ++I+   
Sbjct: 1   MNRTAVYPGSFDPITNGHLDIIQRGLHAFDTIIVAVAKNSSK-KGLFSVEERVDMIR--- 56

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +   + R+ V + +GL ++      A+VI+RGLR ++DF+YE ++  +N  +  E+ 
Sbjct: 57  --DVVGDNPRIIVDTIDGLLIDYVMRKGARVILRGLRAVSDFEYEFQLAQMNHTVQKEVE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           T+ +       Y++S++++ + S++  I+ FVP+ V   L    
Sbjct: 115 TMFMMTSVRYGYLSSSIVKEMASLNGPISEFVPEAVLKKLAEKF 158


>gi|166031897|ref|ZP_02234726.1| hypothetical protein DORFOR_01598 [Dorea formicigenerans ATCC
           27755]
 gi|166028350|gb|EDR47107.1| hypothetical protein DORFOR_01598 [Dorea formicigenerans ATCC
           27755]
          Length = 164

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 61/165 (36%), Positives = 98/165 (59%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++A+Y GSFDP+T GH+DII ++   V++LVI +  N+ KT  F S++ER +++ +   
Sbjct: 1   MKRAIYPGSFDPVTYGHLDIIRRSAPLVDELVIGVLNNNAKTPLF-SVEERVKMLNEVTR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    V V+ F+GL V  AK + A +IVRGLR +TDF+YE++M   N  L P + T
Sbjct: 60  DMTN-----VIVVPFDGLLVEFAKKMDACMIVRGLRAITDFEYELQMAQTNHKLEPSVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L       Y++ST+++ +     DI+ FVPD V   ++  +  
Sbjct: 115 VFLTTSLEYSYLSSTIVKEVAFYHGDISKFVPDVVRERIREKMNQ 159


>gi|15888987|ref|NP_354668.1| phosphopantetheine adenylyltransferase [Agrobacterium tumefaciens
           str. C58]
 gi|29427860|sp|Q8UES4|COAD_AGRT5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|15156771|gb|AAK87453.1| phosphopantetheine adenylyltransferase [Agrobacterium tumefaciens
           str. C58]
          Length = 164

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 67/165 (40%), Positives = 105/165 (63%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDP+TNGH+D++IQAL+    +++A+G +  K   F S  ER+ LI +++ 
Sbjct: 1   MTIAFYPGSFDPMTNGHLDVLIQALNVASKVIVAVGIHPGKAPLF-SFDERAALISRALS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  + RV V+SF+ L V+ A+   A +++RGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  ETLPGEAARVEVVSFDNLVVDAARQHGAHLLLRGLRDGTDLDYEMQMAGMNRQMAPDIQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A  SSR +T+TL+R + ++  ++ +FVP  V   L   +  
Sbjct: 120 VFLPAGTSSRPITATLVRQIAAMGGNVDAFVPKAVLEALNAKLKR 164


>gi|21223924|ref|NP_629703.1| phosphopantetheine adenylyltransferase [Streptomyces coelicolor
           A3(2)]
 gi|256784977|ref|ZP_05523408.1| phosphopantetheine adenylyltransferase [Streptomyces lividans TK24]
 gi|289768869|ref|ZP_06528247.1| pantetheine-phosphate adenylyltransferase [Streptomyces lividans
           TK24]
 gi|8469204|sp|Q9ZBR1|COAD_STRCO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|4007727|emb|CAA22411.1| phosphopantetheine adenylyltransferase [Streptomyces coelicolor
           A3(2)]
 gi|289699068|gb|EFD66497.1| pantetheine-phosphate adenylyltransferase [Streptomyces lividans
           TK24]
          Length = 159

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 57/166 (34%), Positives = 92/166 (55%), Gaps = 7/166 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GSFDPITNGH+DII +A S  +++ +A+  N  K   F  I+ER +LI++   
Sbjct: 1   MRRAVCPGSFDPITNGHLDIIARASSLYDEVYVAVMINQAKKGLFE-IEERIDLIRRVTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +       V V SF GL V+  K      IV+GLR ++DFDYE++M  +N  L   + T
Sbjct: 60  EYGN-----VRVESFHGLLVDFCKQREIPAIVKGLRAVSDFDYELQMAQMNNGLS-GVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + +    +  +++S+L++ + +   D+   VP  V   L   + + 
Sbjct: 114 LFIPTNPTYSFLSSSLVKEVATWGGDVAHLVPPLVLEALTERLRNR 159


>gi|117928785|ref|YP_873336.1| phosphopantetheine adenylyltransferase [Acidothermus cellulolyticus
           11B]
 gi|166216049|sp|A0LV90|COAD_ACIC1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|117649248|gb|ABK53350.1| Phosphopantetheine adenylyltransferase [Acidothermus cellulolyticus
           11B]
          Length = 165

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 54/163 (33%), Positives = 97/163 (59%), Gaps = 7/163 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRKAV  GSFDP+TNGH+DII +A +  +++ +A+  N  K   F S++ER ++++++  
Sbjct: 1   MRKAVCPGSFDPVTNGHLDIISRAAALYDEVTVAVLVNKAKRALF-SVEERMDMVREATA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +       V V SF GL V+  +     VI++GLR ++DFDYE++M  +N  L   + T
Sbjct: 60  QYPN-----VVVESFSGLLVDFCRARGIPVIIKGLRAVSDFDYELQMAQMNHSLA-GVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L       +++S+L++ + +   D+++ +PD V   L+  +
Sbjct: 114 LFLSTNPLYSFLSSSLVKEVAAYGGDVSTLIPDSVARRLRTRL 156


>gi|253573472|ref|ZP_04850815.1| pantetheine-phosphate adenylyltransferase [Paenibacillus sp. oral
           taxon 786 str. D14]
 gi|251847000|gb|EES75005.1| pantetheine-phosphate adenylyltransferase [Paenibacillus sp. oral
           taxon 786 str. D14]
          Length = 170

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 57/163 (34%), Positives = 88/163 (53%), Gaps = 6/163 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY GSFDP+T GHMDII +A    + L++A+  N  K   F ++ ER  L+++   H
Sbjct: 8   RVAVYPGSFDPVTKGHMDIIQRASRQFDKLIVAVLNNLSKKPLF-TVDERKALLREVTGH 66

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     + SF  L VN      A VIVRG+R +TDF+YE+++ S N  L  E+ TI
Sbjct: 67  LPNVE-----IDSFRDLLVNYMDYKQAHVIVRGIRSVTDFEYELQLASTNHKLNSEVETI 121

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
            +       Y++S++++ + S   D++  VP  V + L+    
Sbjct: 122 FMMTHPKYSYLSSSVVKEIASFHGDVSDLVPPEVEMALREKFK 164


>gi|329850839|ref|ZP_08265684.1| pantetheine-phosphate adenylyltransferase [Asticcacaulis
           biprosthecum C19]
 gi|328841154|gb|EGF90725.1| pantetheine-phosphate adenylyltransferase [Asticcacaulis
           biprosthecum C19]
          Length = 159

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 62/165 (37%), Positives = 93/165 (56%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPITNGH DII +A+  V+ LVI +  N+ K   F +++ER E+I +   
Sbjct: 1   MRIGLYPGTFDPITNGHTDIIGRAVKLVDKLVIGVARNTGKGPTF-TLEERVEMIVEQTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V  F  L ++ A++I A VI+RGLR + DF+YE +MT++N+ L  EI T
Sbjct: 60  HLGNIE-----VRPFSSLLMHFAEEIGASVIIRGLRAVADFEYEFQMTAMNQQLNREIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A    + + S L++ +  +   I  FV + V   L   V S
Sbjct: 115 VFLMADPRHQAIASRLVKEIAQLGGSIRPFVAESVEKRLLAKVRS 159


>gi|90414928|ref|ZP_01222892.1| phosphopantetheine adenylyltransferase [Photobacterium profundum
           3TCK]
 gi|61212602|sp|Q6LVM8|COAD_PHOPR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|90323984|gb|EAS40580.1| phosphopantetheine adenylyltransferase [Photobacterium profundum
           3TCK]
          Length = 161

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 50/164 (30%), Positives = 93/164 (56%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDPITNGH+D+I +A +  + +V+ I  +  K   F   +      + ++
Sbjct: 1   MTTRVIYPGTFDPITNGHLDLIERAAAMFDHVVVGIAASPSKKPLFDLPE------RVAL 54

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              I      V ++ F GL V+ AK+ +A ++VRGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 55  TQAITKHLPNVEIVGFSGLLVDFAKESNANILVRGLRAVSDFEYEFQLANMNRRLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           T+ L   E + +++ST+++ +     D++ FV   +   L   +
Sbjct: 115 TVFLTPSEENSFISSTIVKEVALHKGDVSQFVDLRITGALNAKL 158


>gi|297180062|gb|ADI16287.1| phosphopantetheine adenylyltransferase [uncultured bacterium
           HF0010_16H03]
          Length = 160

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 62/164 (37%), Positives = 92/164 (56%), Gaps = 5/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDPIT GHMDII +     + +V+AI  +  K   F +++ER  L      
Sbjct: 1   MKVAIYPGSFDPITFGHMDIIERGCGLFDKVVVAIAKSESKNPMF-TLEERINLA----T 55

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               D+     V     L V LAKD  A  I+RGLR ++DF+YE ++ ++NR L P+I +
Sbjct: 56  SIFEDNDKVEVVGFPRKLTVELAKDYEACAIIRGLRAVSDFEYEFQLATMNRSLAPDIES 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           I L  KES  YV+S+LI+ +  +  D++ FV   V   L+  + 
Sbjct: 116 IFLTPKESLIYVSSSLIKEISDLKGDVSKFVHPKVEQALRAKLD 159


>gi|17987169|ref|NP_539803.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 1
           str. 16M]
 gi|23501973|ref|NP_698100.1| phosphopantetheine adenylyltransferase [Brucella suis 1330]
 gi|62290010|ref|YP_221803.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 1 str.
           9-941]
 gi|82699938|ref|YP_414512.1| phosphopantetheine adenylyltransferase [Brucella melitensis biovar
           Abortus 2308]
 gi|148560691|ref|YP_001259019.1| phosphopantetheine adenylyltransferase [Brucella ovis ATCC 25840]
 gi|189024251|ref|YP_001935019.1| Coenzyme A biosynthesis protein [Brucella abortus S19]
 gi|225852597|ref|YP_002732830.1| phosphopantetheine adenylyltransferase [Brucella melitensis ATCC
           23457]
 gi|254689325|ref|ZP_05152579.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 6 str.
           870]
 gi|254693810|ref|ZP_05155638.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697458|ref|ZP_05159286.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701842|ref|ZP_05163670.1| phosphopantetheine adenylyltransferase [Brucella suis bv. 5 str.
           513]
 gi|254706717|ref|ZP_05168545.1| phosphopantetheine adenylyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|254710176|ref|ZP_05171987.1| phosphopantetheine adenylyltransferase [Brucella pinnipedialis
           B2/94]
 gi|254714174|ref|ZP_05175985.1| phosphopantetheine adenylyltransferase [Brucella ceti M644/93/1]
 gi|254717609|ref|ZP_05179420.1| phosphopantetheine adenylyltransferase [Brucella ceti M13/05/1]
 gi|254730355|ref|ZP_05188933.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 4 str.
           292]
 gi|256031670|ref|ZP_05445284.1| phosphopantetheine adenylyltransferase [Brucella pinnipedialis
           M292/94/1]
 gi|256044755|ref|ZP_05447659.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256113655|ref|ZP_05454466.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 3
           str. Ether]
 gi|256257572|ref|ZP_05463108.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 9 str.
           C68]
 gi|256263909|ref|ZP_05466441.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 2
           str. 63/9]
 gi|256369522|ref|YP_003107032.1| phosphopantetheine adenylyltransferase [Brucella microti CCM 4915]
 gi|260546565|ref|ZP_05822304.1| phosphopantetheine adenylyltransferase [Brucella abortus NCTC 8038]
 gi|260565642|ref|ZP_05836126.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 1
           str. 16M]
 gi|260754839|ref|ZP_05867187.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 6 str.
           870]
 gi|260758056|ref|ZP_05870404.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 4 str.
           292]
 gi|260761880|ref|ZP_05874223.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883851|ref|ZP_05895465.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 9 str.
           C68]
 gi|261214090|ref|ZP_05928371.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 3 str.
           Tulya]
 gi|261219443|ref|ZP_05933724.1| phosphopantetheine adenylyltransferase [Brucella ceti M13/05/1]
 gi|261314180|ref|ZP_05953377.1| phosphopantetheine adenylyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|261317731|ref|ZP_05956928.1| phosphopantetheine adenylyltransferase [Brucella pinnipedialis
           B2/94]
 gi|261321939|ref|ZP_05961136.1| phosphopantetheine adenylyltransferase [Brucella ceti M644/93/1]
 gi|261752402|ref|ZP_05996111.1| phosphopantetheine adenylyltransferase [Brucella suis bv. 5 str.
           513]
 gi|265988762|ref|ZP_06101319.1| phosphopantetheine adenylyltransferase [Brucella pinnipedialis
           M292/94/1]
 gi|265991177|ref|ZP_06103734.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|265995013|ref|ZP_06107570.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 3
           str. Ether]
 gi|297248412|ref|ZP_06932130.1| pantetheine-phosphate adenylyltransferase [Brucella abortus bv. 5
           str. B3196]
 gi|54036867|sp|P63815|COAD_BRUSU RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|54040900|sp|P63814|COAD_BRUME RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|75496775|sp|Q57D42|COAD_BRUAB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|123547038|sp|Q2YPY4|COAD_BRUA2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216062|sp|A5VQM2|COAD_BRUO2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229488121|sp|B2S5U8|COAD_BRUA1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254763933|sp|C0RJ68|COAD_BRUMB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|17982836|gb|AAL52067.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 1
           str. 16M]
 gi|23347921|gb|AAN30015.1| pantetheine-phosphate adenylyltransferase [Brucella suis 1330]
 gi|62196142|gb|AAX74442.1| CoaD, pantetheine-phosphate adenylyltransferase [Brucella abortus
           bv. 1 str. 9-941]
 gi|82616039|emb|CAJ11075.1| Coenzyme A biosynthesis
           protein:Cytidylyltransferase:Cytidyltransferase-related
           domain [Brucella melitensis biovar Abortus 2308]
 gi|148371948|gb|ABQ61927.1| pantetheine-phosphate adenylyltransferase [Brucella ovis ATCC
           25840]
 gi|189019823|gb|ACD72545.1| Coenzyme A biosynthesis protein [Brucella abortus S19]
 gi|225640962|gb|ACO00876.1| pantetheine-phosphate adenylyltransferase [Brucella melitensis ATCC
           23457]
 gi|255999684|gb|ACU48083.1| phosphopantetheine adenylyltransferase [Brucella microti CCM 4915]
 gi|260095615|gb|EEW79492.1| phosphopantetheine adenylyltransferase [Brucella abortus NCTC 8038]
 gi|260151710|gb|EEW86804.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 1
           str. 16M]
 gi|260668374|gb|EEX55314.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 4 str.
           292]
 gi|260672312|gb|EEX59133.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674947|gb|EEX61768.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 6 str.
           870]
 gi|260873379|gb|EEX80448.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 9 str.
           C68]
 gi|260915697|gb|EEX82558.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 3 str.
           Tulya]
 gi|260924532|gb|EEX91100.1| phosphopantetheine adenylyltransferase [Brucella ceti M13/05/1]
 gi|261294629|gb|EEX98125.1| phosphopantetheine adenylyltransferase [Brucella ceti M644/93/1]
 gi|261296954|gb|EEY00451.1| phosphopantetheine adenylyltransferase [Brucella pinnipedialis
           B2/94]
 gi|261303206|gb|EEY06703.1| phosphopantetheine adenylyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|261742155|gb|EEY30081.1| phosphopantetheine adenylyltransferase [Brucella suis bv. 5 str.
           513]
 gi|262766126|gb|EEZ11915.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 3
           str. Ether]
 gi|263001961|gb|EEZ14536.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|263094042|gb|EEZ17976.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 2
           str. 63/9]
 gi|264660959|gb|EEZ31220.1| phosphopantetheine adenylyltransferase [Brucella pinnipedialis
           M292/94/1]
 gi|297175581|gb|EFH34928.1| pantetheine-phosphate adenylyltransferase [Brucella abortus bv. 5
           str. B3196]
 gi|326409118|gb|ADZ66183.1| Coenzyme A biosynthesis protein [Brucella melitensis M28]
 gi|326538825|gb|ADZ87040.1| pantetheine-phosphate adenylyltransferase [Brucella melitensis
           M5-90]
          Length = 164

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 70/165 (42%), Positives = 101/165 (61%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGH+D++  AL   + +++AIG +  K   F S  ER  LI+ S  
Sbjct: 1   MTIAIYAGSFDPVTNGHIDVLKGALRLADQVIVAIGMHPGKKPLF-SFDERVALIEASAK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   + RVSVI+F+GL ++ A+   AQ++VRGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  AVLHKDAARVSVIAFDGLVIDAARKHGAQLMVRGLRDGTDLDYEMQMAGMNGTMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A  + R +T+TL+R + S+  DI  FVP  V   L     S
Sbjct: 120 VFLPADPAVRTITATLVRQIASMGGDIKPFVPVAVAAALNTKFKS 164


>gi|49475755|ref|YP_033796.1| phosphopantetheine adenylyltransferase [Bartonella henselae str.
           Houston-1]
 gi|49238562|emb|CAF27802.1| Phosphopantetheine adenylyltransferase [Bartonella henselae str.
           Houston-1]
          Length = 177

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 70/171 (40%), Positives = 103/171 (60%), Gaps = 1/171 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           MM+ A+Y GSFDP+TNGH+DI+  +    + +++AIG  + K   F S +ER +LI Q+ 
Sbjct: 5   MMKIALYAGSFDPLTNGHLDILKASFVLADKVIVAIGIQAKKESLF-SFEERVDLITQAG 63

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +   S+R+ VISFE L ++ A++I A  ++RGLRD TD DYEM+M  +N  + PE+ 
Sbjct: 64  KELLNMGSDRLQVISFETLLIDKAREIGASFLIRGLRDGTDLDYEMQMAGMNGLMAPELQ 123

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYD 171
           T+ L A    R +TSTL+R + S+  D+  FVP  V   L     S    D
Sbjct: 124 TVFLPAGVLGRVITSTLVRQIASMGGDVAPFVPANVARALHLKFQSSRGSD 174


>gi|17232192|ref|NP_488740.1| phosphopantetheine adenylyltransferase [Nostoc sp. PCC 7120]
 gi|29427884|sp|Q8YN70|COAD_ANASP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|17133837|dbj|BAB76399.1| pantetheine-phosphate adenylyltransferase [Nostoc sp. PCC 7120]
          Length = 191

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 50/161 (31%), Positives = 88/161 (54%), Gaps = 6/161 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y GSFDPIT GH+DII +     + +++A+  N  K   F S+QER E I+++  H 
Sbjct: 2   IAIYPGSFDPITLGHLDIIQRGSRLFDLVIVAVLRNPSKVPLF-SVQERLEQIRRTTKHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               ++      F+GL VN A+   AQV++RGLR ++DF+ E++M   N+ L  +I T+ 
Sbjct: 61  PNVEAD-----GFDGLTVNYAQQRQAQVLLRGLRAISDFEVELQMAHTNKTLSTQIETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           L       +++S++++ +      +   VP  + + +    
Sbjct: 116 LATSNEYSFLSSSVVKEIARFGGSVDHLVPPHIALDIYKCY 156


>gi|90424087|ref|YP_532457.1| phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           BisB18]
 gi|122476231|sp|Q214P8|COAD_RHOPB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|90106101|gb|ABD88138.1| Phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           BisB18]
          Length = 165

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 96/165 (58%), Gaps = 1/165 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++ +A++  + L++AIG +  K   F + + R E+++   
Sbjct: 1   MPRIALYPGSFDPVTNGHLDVVSRAVALCDRLIVAIGVHPGKKPLFSTQE-RLEMVETVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +       +++ L V  A+ + A +++RGLRD TD DYEM++  +N  + P++ 
Sbjct: 60  APVAAAAHCAFDCTTYDNLTVTAAQRVGATIMIRGLRDGTDLDYEMQIAGMNETMAPDVH 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T+ + A  S R +T+TL+R +  +  D+++FVP  V   L     
Sbjct: 120 TVFIPAGVSVRPITATLVRQIAQMGGDVSAFVPPQVAHSLTTKFA 164


>gi|282898914|ref|ZP_06306898.1| Coenzyme A biosynthesis protein [Cylindrospermopsis raciborskii
           CS-505]
 gi|281196225|gb|EFA71138.1| Coenzyme A biosynthesis protein [Cylindrospermopsis raciborskii
           CS-505]
          Length = 180

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 51/181 (28%), Positives = 92/181 (50%), Gaps = 10/181 (5%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y GSFDPIT GH+D+I +A      +++A+  N  KT  F ++++R + I  +  H 
Sbjct: 2   IAIYPGSFDPITLGHLDLIERATRLFSRVIVAVLRNPNKTPLF-TVEQRLKQISSATSHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V SF+GL VN A+   A V++RGLR ++DF+ E++M   N+ L  ++ T+ 
Sbjct: 61  PSVE-----VDSFDGLTVNYAQMRQAGVLLRGLRAVSDFEIELQMAHTNKTLSTQVETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYD----SIKLFPNT 179
           L       +++S++++ +      +   VP  + + +      +   +     I  FPN 
Sbjct: 116 LATSNEHSFLSSSVVKEIARFGGSVDHLVPPHIAMDIYQCYSQIPLSENPMTRISQFPNI 175

Query: 180 I 180
            
Sbjct: 176 P 176


>gi|323340651|ref|ZP_08080903.1| pantetheine-phosphate adenylyltransferase [Lactobacillus ruminis
           ATCC 25644]
 gi|323091774|gb|EFZ34394.1| pantetheine-phosphate adenylyltransferase [Lactobacillus ruminis
           ATCC 25644]
          Length = 160

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 56/166 (33%), Positives = 95/166 (57%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  ++ G+FDP+TNGH+D+I++A    +++++ +  N+ K   F S +ER  LI+    
Sbjct: 1   MKV-IFPGTFDPLTNGHLDLIVRASKMFDEVIVLLAENTSKKTLF-SFEERKLLIEDE-- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             I    N   + S   L V+ A+ + A+ IVRG+R+  DF+YE  + S+NR L PEI T
Sbjct: 57  --IKALGNVSVISSPHELTVDAARRLGARGIVRGVRNAVDFEYEKSIASMNRHLAPEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           I L   E   +V+S++I+ +     D+   VP+   + LKN +  +
Sbjct: 115 ILLTTDEKYGFVSSSMIKEVAGFGGDLCGLVPEKTALALKNKLKEV 160


>gi|161619046|ref|YP_001592933.1| phosphopantetheine adenylyltransferase [Brucella canis ATCC 23365]
 gi|254704387|ref|ZP_05166215.1| phosphopantetheine adenylyltransferase [Brucella suis bv. 3 str.
           686]
 gi|260566366|ref|ZP_05836836.1| phosphopantetheine adenylyltransferase [Brucella suis bv. 4 str.
           40]
 gi|261755062|ref|ZP_05998771.1| phosphopantetheine adenylyltransferase [Brucella suis bv. 3 str.
           686]
 gi|189082556|sp|A9M5A7|COAD_BRUC2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|161335857|gb|ABX62162.1| pantetheine-phosphate adenylyltransferase [Brucella canis ATCC
           23365]
 gi|260155884|gb|EEW90964.1| phosphopantetheine adenylyltransferase [Brucella suis bv. 4 str.
           40]
 gi|261744815|gb|EEY32741.1| phosphopantetheine adenylyltransferase [Brucella suis bv. 3 str.
           686]
          Length = 164

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 70/165 (42%), Positives = 101/165 (61%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGH+D++  AL   + +++AIG +  K   F S  ER  LI+ S  
Sbjct: 1   MTIAIYAGSFDPVTNGHIDVLKGALRLADQVIVAIGMHPGKKPLF-SFDERVALIEVSAK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   + RVSVI+F+GL ++ A+   AQ++VRGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  AVLHKDAARVSVIAFDGLVIDAARKHGAQLMVRGLRDGTDLDYEMQMAGMNGTMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A  + R +T+TL+R + S+  DI  FVP  V   L     S
Sbjct: 120 VFLPADPAVRTITATLVRQIASMGGDIKPFVPVAVAAALNTKFKS 164


>gi|118589191|ref|ZP_01546598.1| Coenzyme A biosynthesis
           protein:Cytidylyltransferase:Cytidyltransferase-related
           [Stappia aggregata IAM 12614]
 gi|118438520|gb|EAV45154.1| Coenzyme A biosynthesis
           protein:Cytidylyltransferase:Cytidyltransferase-related
           [Stappia aggregata IAM 12614]
          Length = 168

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 65/161 (40%), Positives = 101/161 (62%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGHMDI+ Q+L+  + +V+AIG +  K+  F   +    +   + 
Sbjct: 1   MNRIALYPGSFDPVTNGHMDILRQSLALADRVVVAIGVHPGKSPLFSFKERVELIHASAR 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F P+ + R+ VI+F+ L +  A+   A  +VRGLRD TD DYEM+M  +N  L P+I 
Sbjct: 61  SEFTPEEAERIDVIAFDNLVIETARQQKAAYLVRGLRDGTDLDYEMQMAGMNGTLEPDIR 120

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ L A    R++T+TL+R +  +  +I++FVP+PV   L+
Sbjct: 121 TVFLPASPPVRHITATLVRQIAKMGGEISAFVPEPVAEPLR 161


>gi|116494807|ref|YP_806541.1| phosphopantetheine adenylyltransferase [Lactobacillus casei ATCC
           334]
 gi|227535193|ref|ZP_03965242.1| phosphopantetheine adenylyltransferase [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
 gi|239631594|ref|ZP_04674625.1| phosphopantetheine adenylyltransferase [Lactobacillus paracasei
           subsp. paracasei 8700:2]
 gi|122263775|sp|Q039M3|COAD_LACC3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|116104957|gb|ABJ70099.1| Phosphopantetheine adenylyltransferase [Lactobacillus casei ATCC
           334]
 gi|227187238|gb|EEI67305.1| phosphopantetheine adenylyltransferase [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
 gi|239526059|gb|EEQ65060.1| phosphopantetheine adenylyltransferase [Lactobacillus paracasei
           subsp. paracasei 8700:2]
          Length = 167

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 54/163 (33%), Positives = 87/163 (53%), Gaps = 5/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
            + AV+ GSFDP TNGH+D + +A    +++V+A   N+ K   F S ++   LI +S  
Sbjct: 3   KKIAVFPGSFDPFTNGHLDTVKRASRLFDEVVVAAMTNTSKKPLFSSEEK-LALISESTA 61

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                 +        + L V  A+ I AQ ++RG+R++ DF YE  + +VN  L PEI T
Sbjct: 62  GLPNVKAMAAP----KRLTVEFARSIGAQFMIRGIRNVADFGYEADIATVNHDLDPEIET 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L A +    ++ST+I+ + +   D+  FVP PV   L   +
Sbjct: 118 VFLLADKQYDALSSTIIKEVAAFGGDVHRFVPAPVEAALYAKL 160


>gi|294631619|ref|ZP_06710179.1| pantetheine-phosphate adenylyltransferase [Streptomyces sp. e14]
 gi|292834952|gb|EFF93301.1| pantetheine-phosphate adenylyltransferase [Streptomyces sp. e14]
          Length = 159

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 89/165 (53%), Gaps = 7/165 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GSFDPITNGH+DII +A    +++ +A+  N  K   F  I ER ELI+    
Sbjct: 1   MRRAVCPGSFDPITNGHLDIIARASRLYDEVYVAVMINQSKKGLFE-IDERIELIRDVTS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +       V V +F GL V+  K      IV+GLR ++DFDYE++M  +N  L   + T
Sbjct: 60  EYGN-----VRVEAFHGLLVDFCKQRDIPAIVKGLRAVSDFDYELQMAQMNNGLS-GVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + +    +  +++S+L++ + +   D++  VP  V   L   +  
Sbjct: 114 LFVPTNPTYSFLSSSLVKEVATWGGDVSHLVPPQVLAALSARLRK 158


>gi|126696313|ref|YP_001091199.1| phosphopantetheine adenylyltransferase [Prochlorococcus marinus
           str. MIT 9301]
 gi|166216570|sp|A3PCX3|COAD_PROM0 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|126543356|gb|ABO17598.1| putative pantetheine-phosphate adenylyltransferase [Prochlorococcus
           marinus str. MIT 9301]
          Length = 157

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 58/161 (36%), Positives = 94/161 (58%), Gaps = 7/161 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y G+FDP+TNGH+D+I +A      LV+A+  N+ KT  F +++ R   IK S+ 
Sbjct: 1   MKI-LYPGTFDPLTNGHLDLIERAEKIFGKLVVAVLENTSKTPTF-NLERRIIQIKNSLS 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          VIS+ GL V+ A D+ A +I+RGLR M+DF+YE+++   N+ L  +I T
Sbjct: 59  HLPNIE-----VISYSGLTVDCANDLKANLILRGLRAMSDFEYELQIAHTNKSLNNDIET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           I L    +  +++S+L++ +     +I   VP  V   LK+
Sbjct: 114 IFLSTNTNYSFLSSSLVKEVAKFGGEINHMVPPSVEKDLKD 154


>gi|78222968|ref|YP_384715.1| phosphopantetheine adenylyltransferase [Geobacter metallireducens
           GS-15]
 gi|123571855|sp|Q39UT4|COAD_GEOMG RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|78194223|gb|ABB31990.1| Phosphopantetheine adenylyltransferase [Geobacter metallireducens
           GS-15]
          Length = 163

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 55/164 (33%), Positives = 96/164 (58%), Gaps = 6/164 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + AVY GSFDPIT GH+DII + L   +++++A+  NS K   F SI ER ++I++ +  
Sbjct: 4   KVAVYPGSFDPITYGHLDIIDRGLRIFDEIIVAVARNSAKNSLF-SIDERVDMIQRVLA- 61

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                + R  V +F+GL V+     +A VI+RGLR ++DF+YE ++  +NR +  ++ T+
Sbjct: 62  ----DNVRARVDTFDGLLVDYVLSQNATVIIRGLRAISDFEYEFQIAQMNRSISQDVETL 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            +       Y++S++++ + S++  I   VP  V   LK+    
Sbjct: 118 FMMTSVPFGYLSSSIVKEVSSLNGPIDGLVPPLVREALKDKFSK 161


>gi|37520416|ref|NP_923793.1| pantetheine-phosphate adenylyltransferase [Gloeobacter violaceus
           PCC 7421]
 gi|61212698|sp|Q7NMB9|COAD_GLOVI RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|35211409|dbj|BAC88788.1| pantetheine-phosphate adenylyltransferase [Gloeobacter violaceus
           PCC 7421]
          Length = 161

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 51/162 (31%), Positives = 93/162 (57%), Gaps = 6/162 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y GSFDP+T GH+DII +A    + +V+A+  N  K   F +++ER   I++++ H 
Sbjct: 2   IALYPGSFDPLTYGHLDIIERAARLFDRVVVAVLRNPAKVPLF-TVEERLSQIQKAVRHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V +F GL V +A+ + A+V++RGLR ++DF+ E++M   NR L  EI T+ 
Sbjct: 61  DNVE-----VEAFHGLTVTVARRLDARVLLRGLRAVSDFEAELQMAQTNRTLATEIETLF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           L       +++S+L++++ +    ++  VP+ +   L+    
Sbjct: 116 LSTSTEHSFLSSSLVKNIAAAGGPVSHMVPEHIEKELRTRFA 157


>gi|295109967|emb|CBL23920.1| pantetheine-phosphate adenylyltransferase, bacterial [Ruminococcus
           obeum A2-162]
          Length = 164

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 57/170 (33%), Positives = 94/170 (55%), Gaps = 6/170 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDP T GH+D+I +A    + +V+ +  NS K+  F S++ER  +++++  
Sbjct: 1   MVTAVYPGSFDPATYGHLDVIRRASVSFDRVVVGVLHNSSKSPLF-SVEERVNILEKATK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                       +S      N A++  AQVIVRGLR +TDF+YE++M   NR L P++ T
Sbjct: 60  DIPNVIIKPFDGLSV-----NFARENHAQVIVRGLRAVTDFEYELQMAQTNRVLAPDVDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYD 171
           I L       YV+ST+++ +     D+++F P  +   L+  +  + K +
Sbjct: 115 IFLTTSLEYAYVSSTIMKEVARFGGDLSNFAPPEIIKTLRMKLQQVNKKN 164


>gi|329296442|ref|ZP_08253778.1| pantetheine-phosphate adenylyltransferase [Plautia stali symbiont]
          Length = 161

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 55/166 (33%), Positives = 92/166 (55%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+T GH+DI+ +A    + +V+AI  +  K   F S+ ER +L +Q  
Sbjct: 1   MSTKAIYPGTFDPMTLGHLDIVTRAAQMFDRIVLAIAASPSKKPLF-SLDERVDLARQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A+  +A V+VRGLR ++DF+YE+++  +NR L P + 
Sbjct: 60  AHLPNVE-----VVGFSDLMANFAQAQNANVLVRGLRAVSDFEYELQLAHINRHLLPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           ++ L   E   +V+S+L++ +     D+ +F+P  V   L   +  
Sbjct: 115 SVFLMPSEGFSFVSSSLVKEVARHQGDVQAFLPAVVHQALLAKLAQ 160


>gi|296331077|ref|ZP_06873551.1| phosphopantetheine adenylyltransferase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305674232|ref|YP_003865904.1| phosphopantetheine adenylyltransferase [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296151721|gb|EFG92596.1| phosphopantetheine adenylyltransferase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305412476|gb|ADM37595.1| phosphopantetheine adenylyltransferase [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 161

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 54/166 (32%), Positives = 90/166 (54%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDP+T GH+DII +     E + + +  NS K   F S++ER EL+++  
Sbjct: 1   MASIAVCPGSFDPVTYGHLDIIRRGAHIFEQVYVCVLNNSSKKPLF-SVEERCELLREVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +     V + +GL ++ AK   A+ I+RGLR ++DF+YEM+ TSVNR L   I 
Sbjct: 60  KDIPNIT-----VETSQGLLIDYAKRKKAKAILRGLRAVSDFEYEMQGTSVNRVLDESIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T  +       +++S++++ +   +  ++ FVP  V + L+     
Sbjct: 115 TFFMMTNNQYSFLSSSIVKEVARYNGSVSEFVPPEVELALQQKFRQ 160


>gi|300114345|ref|YP_003760920.1| pantetheine-phosphate adenylyltransferase [Nitrosococcus watsonii
           C-113]
 gi|299540282|gb|ADJ28599.1| pantetheine-phosphate adenylyltransferase [Nitrosococcus watsonii
           C-113]
          Length = 160

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 49/161 (30%), Positives = 90/161 (55%), Gaps = 6/161 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            AVY G+FDPIT GH D++ +A      +++A+  + VK   F S++ER  + ++ +  +
Sbjct: 5   TAVYPGTFDPITRGHSDLVERAAPLFGRIIVAVAASPVKAPCF-SLEERVSMAEEVLAGY 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V  F  L  + A+   A+V++RGLR ++DF+YE ++ ++NR L  E+ T+ 
Sbjct: 64  PNVE-----VRGFGVLLADFARSCGARVLLRGLRAVSDFEYEFQLANMNRHLVSEVETLF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           L   E   Y++++L+R + ++  D++ FV   V   L   +
Sbjct: 119 LTPAEQYAYISASLVREVAALGGDVSPFVHPRVLTALAEKL 159


>gi|189346704|ref|YP_001943233.1| phosphopantetheine adenylyltransferase [Chlorobium limicola DSM
           245]
 gi|229488128|sp|B3ECH9|COAD_CHLL2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|189340851|gb|ACD90254.1| pantetheine-phosphate adenylyltransferase [Chlorobium limicola DSM
           245]
          Length = 170

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 60/180 (33%), Positives = 102/180 (56%), Gaps = 10/180 (5%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KA+Y G+FDP TNGH+D++ +AL+  +++V+ I  NS K   F S++ER  +I++ I
Sbjct: 1   MTQKAIYPGTFDPFTNGHLDVLERALNIFQEVVVVIADNSQKQTLF-SVEERLSMIREII 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             +   S   +     +GL  + A+   A+ IVRG+R + DF+YE +++ +NR L PE+ 
Sbjct: 60  EDYPAVSVEVLH----DGLLADYARQKGARAIVRGVRQVKDFEYEFQISLLNRHLYPEVT 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTI 180
           T+ L       YV S++I+ +  +  D++ FV   V   L   +      +S +  PN I
Sbjct: 116 TVFLMPNVKYTYVASSIIKEVAMLGGDVSKFVHPSVLKSLHGKLD-----ESKQHKPNNI 170


>gi|254719162|ref|ZP_05180973.1| phosphopantetheine adenylyltransferase [Brucella sp. 83/13]
 gi|265984157|ref|ZP_06096892.1| phosphopantetheine adenylyltransferase [Brucella sp. 83/13]
 gi|306838153|ref|ZP_07471009.1| pantetheine-phosphate adenylyltransferase [Brucella sp. NF 2653]
 gi|264662749|gb|EEZ33010.1| phosphopantetheine adenylyltransferase [Brucella sp. 83/13]
 gi|306406743|gb|EFM62966.1| pantetheine-phosphate adenylyltransferase [Brucella sp. NF 2653]
          Length = 164

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 71/165 (43%), Positives = 101/165 (61%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGH+D++  AL   + +++AIG +  K   F S  ER  LIK S  
Sbjct: 1   MTIAIYAGSFDPVTNGHIDVLKGALRLADQVIVAIGMHPGKKPLF-SFDERVALIKASAK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   + RVSVI+F+GL ++ A+   AQ++VRGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  AVLHKDAARVSVIAFDGLVIDAARKHGAQLMVRGLRDGTDLDYEMQMAGMNGTMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A  + R +T+TL+R + S+  DI  FVP  V   L     S
Sbjct: 120 VFLPADPAVRTITATLVRQIASMGGDIKPFVPVAVAAALNTKFKS 164


>gi|119509994|ref|ZP_01629135.1| phosphopantetheine adenylyltransferase [Nodularia spumigena
           CCY9414]
 gi|119465318|gb|EAW46214.1| phosphopantetheine adenylyltransferase [Nodularia spumigena
           CCY9414]
          Length = 183

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 47/161 (29%), Positives = 88/161 (54%), Gaps = 6/161 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y GSFDPIT GH+DII +     + +++A+  N  K   F ++QER + I+++  H 
Sbjct: 2   IAIYPGSFDPITLGHLDIIQRGSRLFDLVIVAVLRNPHKIPLF-TVQERLDQIRRTTQHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V  F+GL VN A+   A+V++RGLR ++DF+ E++M   N+ +  +I T+ 
Sbjct: 61  SNVE-----VDGFDGLTVNYAQQRQAEVLLRGLRAISDFEVELQMAHTNKTISTQIETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           L       +++S++++ +      +   VP+ + + +    
Sbjct: 116 LATSNEYSFLSSSVVKEIARFGGSVDHLVPEEIALDIYKCY 156


>gi|145590103|ref|YP_001156700.1| phosphopantetheine adenylyltransferase [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|189082579|sp|A4T072|COAD_POLSQ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|145048509|gb|ABP35136.1| Phosphopantetheine adenylyltransferase [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 165

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 98/165 (59%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP T GH D++ +A S   +L++ +  +  K   F  +QER ++ K+ + 
Sbjct: 1   MTVAVYPGTFDPFTRGHEDLVRRASSIFSELIVGVADSRSKRPFFG-LQERIDIAKEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+     + V V+ F GL  + A++ +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HY-----HNVKVVGFSGLLKDFAREHNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   +  ++++ T +R + S+  D++ FV   V  +L   + S
Sbjct: 115 LFLTPSDQYQFISGTFVREIASMGGDVSKFVFPSVEKWLVQKIAS 159


>gi|67906519|gb|AAY82626.1| hypothetical protein [uncultured bacterium MedeBAC35C06]
          Length = 161

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 62/165 (37%), Positives = 94/165 (56%), Gaps = 5/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDPIT GHMDII +A    + +++AI  +  K   F S++ER +L +    
Sbjct: 1   MKVAIYPGSFDPITLGHMDIIDRACYLFDKVIVAIAKSESKNPLF-SLEERIKLTETIYK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V     L V+LA+D  A  IVRGLR + DF+YE ++ ++NR L P+I +
Sbjct: 60  DHPKVEV----VGFPRKLTVDLARDYGASAIVRGLRAVADFEYEFQLATMNRALAPDIES 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           I L  KES  YV+S+LI+ +  +  +I++FV   V   L   + +
Sbjct: 116 IFLTPKESLIYVSSSLIKEIADLKGNISNFVHPVVESALIAKLDN 160


>gi|258405795|ref|YP_003198537.1| pantetheine-phosphate adenylyltransferase [Desulfohalobium
           retbaense DSM 5692]
 gi|257798022|gb|ACV68959.1| pantetheine-phosphate adenylyltransferase [Desulfohalobium
           retbaense DSM 5692]
          Length = 165

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 53/162 (32%), Positives = 95/162 (58%), Gaps = 6/162 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
             A+Y G+FDP+TNGH+ +I + L   + +++++  ++ K   F +++ER E+ ++   H
Sbjct: 4   TIALYPGTFDPLTNGHVSLIRRGLKVFDTVIVSVAKDTSKVPLF-TLEERVEMAQEVFAH 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                  RV V  FEGL V+ A+   A VI+RGLR ++DF+YE +M  +NR L  +I T+
Sbjct: 63  -----ERRVVVEPFEGLLVDYAESREATVILRGLRAISDFEYEFQMALMNRRLNRDIQTV 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
            +    +  Y++ST+I+    +  D+   +P+P    L+N +
Sbjct: 118 FMMTDYTWLYISSTIIKESARLGGDVRGLLPEPCWDRLQNKL 159


>gi|163843362|ref|YP_001627766.1| phosphopantetheine adenylyltransferase [Brucella suis ATCC 23445]
 gi|189082557|sp|B0CGP5|COAD_BRUSI RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|163674085|gb|ABY38196.1| pantetheine-phosphate adenylyltransferase [Brucella suis ATCC
           23445]
          Length = 164

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 71/165 (43%), Positives = 102/165 (61%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGH+D++  AL   + +++AIG +  K   F S  ER  LI+ S  
Sbjct: 1   MTIAIYAGSFDPVTNGHIDVLKGALRLADQVIVAIGMHPGKKPLF-SFDERVALIEASAK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   + RVSVI+F+GL ++ A+   AQ++VRGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  AVLHKDAARVSVIAFDGLVIDAARKHGAQLMVRGLRDGTDLDYEMQMAGMNGTMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A  + R +T+TL+R + S+  DI  FVP PV   L     S
Sbjct: 120 VFLPADPAVRTITATLVRQIASMGGDIKPFVPVPVAAALNTKFKS 164


>gi|153214728|ref|ZP_01949573.1| phosphopantetheine adenylyltransferase [Vibrio cholerae 1587]
 gi|229524826|ref|ZP_04414231.1| phosphopantetheine adenylyltransferase [Vibrio cholerae bv.
           albensis VL426]
 gi|229527275|ref|ZP_04416668.1| phosphopantetheine adenylyltransferase [Vibrio cholerae 12129(1)]
 gi|262192403|ref|ZP_06050555.1| phosphopantetheine adenylyltransferase [Vibrio cholerae CT 5369-93]
 gi|124115164|gb|EAY33984.1| phosphopantetheine adenylyltransferase [Vibrio cholerae 1587]
 gi|229335283|gb|EEO00767.1| phosphopantetheine adenylyltransferase [Vibrio cholerae 12129(1)]
 gi|229338407|gb|EEO03424.1| phosphopantetheine adenylyltransferase [Vibrio cholerae bv.
           albensis VL426]
 gi|262031667|gb|EEY50253.1| phosphopantetheine adenylyltransferase [Vibrio cholerae CT 5369-93]
 gi|327483102|gb|AEA77509.1| Phosphopantetheine adenylyltransferase [Vibrio cholerae LMA3894-4]
          Length = 164

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 87/160 (54%), Gaps = 6/160 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D+I +A    ++++IA+  +  K   F +++ER E  +    H 
Sbjct: 8   RVIYPGTFDPITNGHLDLIERAAQMFDEVIIAVAASPSKNTLF-TLEERVEFARHVTSHL 66

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
              S+       F GL V+ AK   A V++RGLR   DF+YE  +T++ R L P + ++ 
Sbjct: 67  DNVSAK-----GFSGLLVDFAKAEKANVLIRGLRTTVDFEYEFGLTNMYRRLMPGLESVF 121

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L   E   +++STL+R +     ++  FVP  V   L   
Sbjct: 122 LTPAEEHAFISSTLVREVAIHGGNVDEFVPTIVANALHQK 161


>gi|291550317|emb|CBL26579.1| pantetheine-phosphate adenylyltransferase, bacterial [Ruminococcus
           torques L2-14]
          Length = 163

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 58/168 (34%), Positives = 99/168 (58%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KA+Y GSFDP+T GH DII ++   V+ L++ +  N  K   F S++ER +++K+   
Sbjct: 1   MLKAIYPGSFDPVTRGHYDIICRSCKIVDKLIVGVLNNKAKMPLF-SVEERVKMLKEVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      +I F+GL V+ A+ I A V++RGLR +TDF+YE++M+  N+ + P+I T
Sbjct: 60  DLPNVE-----IIPFDGLLVDFAEQIGADVVIRGLRAITDFEYELQMSQTNQRMKPDIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + L       Y++ST +R + +   D++ FVP+ V + L+  +    +
Sbjct: 115 MFLTTSIEYSYLSSTTVREIAAFGGDVSQFVPEAVEIALREKMKEKRR 162


>gi|291614822|ref|YP_003524979.1| pantetheine-phosphate adenylyltransferase [Sideroxydans
           lithotrophicus ES-1]
 gi|291584934|gb|ADE12592.1| pantetheine-phosphate adenylyltransferase [Sideroxydans
           lithotrophicus ES-1]
          Length = 158

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 46/165 (27%), Positives = 89/165 (53%), Gaps = 7/165 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M K VY G+FDPIT GH D++ +A     ++V+A+  +        +++ER E+ ++   
Sbjct: 1   MIKVVYPGTFDPITRGHEDVVRRAAGLFGEVVVAVAASRS--ATLFTLEERVEMAREVFA 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F         V  F+ L ++  +  +A+V++RGLR ++DF++E +M  +NR L P++ T
Sbjct: 59  GFDNVK-----VEGFDTLLMSYVRAQNARVVLRGLRAVSDFEFEFQMAGMNRALHPDVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   E   +++++++R +     D++ FV   V   L+     
Sbjct: 114 LFLTPAEQYTFISASIVREIARFGGDVSKFVSPLVMAELEKKYQR 158


>gi|73666955|ref|YP_302971.1| CoA biosynthesis protein [Ehrlichia canis str. Jake]
 gi|72394096|gb|AAZ68373.1| Co enzyme A biosynthesis protein:Cytidyl transferase-related domain
           [Ehrlichia canis str. Jake]
          Length = 162

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 67/165 (40%), Positives = 104/165 (63%), Gaps = 5/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y G+FDPIT GH+DII +A + V+ L+I +  N VK   F S + R+ELI+  I 
Sbjct: 1   MKVGIYPGTFDPITFGHIDIIKRAYNLVDKLIIGVAKNCVKNTIF-SAEVRAELIQHEIQ 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                 +  V  I F+GL V  A++ +A VI+RGLR ++DFDYE +M+ VN  L P+I T
Sbjct: 60  LL----NIAVETIIFDGLLVYFAQENNASVIIRGLRAVSDFDYEFQMSWVNYKLTPQIET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           I L A E +++++S+ ++ +  ++ DI +FVP  V  +LKN   +
Sbjct: 116 IFLPASEDTQFISSSFVKEIARLNGDINAFVPISVQKYLKNFYQN 160


>gi|71277753|ref|YP_266980.1| phosphopantetheine adenylyltransferase [Colwellia psychrerythraea
           34H]
 gi|71143493|gb|AAZ23966.1| pantetheine-phosphate adenylyltransferase [Colwellia
           psychrerythraea 34H]
          Length = 156

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 51/162 (31%), Positives = 93/162 (57%), Gaps = 6/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A+Y G+FDP+TNGH D+I++A     +++I +  +  K   F  +++R  +++Q   
Sbjct: 1   MIRAIYPGTFDPVTNGHSDLIVRASKLFSEVIIGVASSPSKQPRF-DLEQRVAMLEQVTQ 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +     V+ F GL V+ AK   A+V++RGLR ++DF+YE ++ ++NR L  E+ +
Sbjct: 60  DLTNVT-----VVGFSGLLVDFAKQYQAKVLIRGLRAVSDFEYEFQLANMNRRLSSELES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           + L   E + +++STL++ +     D+  FV   V   L  I
Sbjct: 115 VFLTPAEENSFISSTLVKEVALHKGDVGQFVHPVVKAALDKI 156


>gi|284008830|emb|CBA75608.1| phosphopantetheine adenylyltransferase [Arsenophonus nasoniae]
          Length = 169

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 55/166 (33%), Positives = 90/166 (54%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPIT GH+DII +A    E +++AI  +S K   F ++ ER    K+  
Sbjct: 10  MKNKAIYPGTFDPITYGHLDIIERAALIFEQVILAIADSSRKNPMF-TLDERIVFAKKQT 68

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V  F  L VN A+   A +++RG+R ++DF+YE ++  +N  L  ++ 
Sbjct: 69  KHLTNVE-----VTGFCELTVNFAQKHQANILIRGVRSVSDFEYECQLAHMNSHLMADLE 123

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           TI L       +V+S+LI+ +     DI+SF+P+P+   +   +  
Sbjct: 124 TIFLLPSPKLSFVSSSLIKDVARHGGDISSFLPEPIAKAMLQKIEQ 169


>gi|190891759|ref|YP_001978301.1| phosphopantetheine adenylyltransferase protein [Rhizobium etli CIAT
           652]
 gi|229541044|sp|B3PZQ8|COAD_RHIE6 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|190697038|gb|ACE91123.1| phosphopantetheine adenylyltransferase protein [Rhizobium etli CIAT
           652]
          Length = 164

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 69/162 (42%), Positives = 108/162 (66%), Gaps = 1/162 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDPITNGH+D+++QAL+  E +++AIG +  K   F S  ER+ELI+ S+ 
Sbjct: 1   MTTAFYPGSFDPITNGHVDVLVQALNVAEKVIVAIGIHPGKAPLF-SFDERAELIRLSLA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  +  ++V++F+ L V+ A+   A +++RGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  QALPGKTGDITVVAFDNLVVDAARAHGATLLIRGLRDGTDLDYEMQMAGMNRAMAPDIQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           I L A  +SR +T+TL+R + ++  D+++FVP  V   L + 
Sbjct: 120 IFLPAGTASRPITATLVRQIAAMGGDVSAFVPPAVLQALTSK 161


>gi|123968510|ref|YP_001009368.1| phosphopantetheine adenylyltransferase [Prochlorococcus marinus
           str. AS9601]
 gi|166216574|sp|A2BR50|COAD_PROMS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|123198620|gb|ABM70261.1| putative pantetheine-phosphate adenylyltransferase [Prochlorococcus
           marinus str. AS9601]
          Length = 157

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 59/161 (36%), Positives = 95/161 (59%), Gaps = 7/161 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y G+FDP+TNGH+D+I +A     +LV+A+  N+ KT  F +++ R   IK S+ 
Sbjct: 1   MKI-LYPGTFDPLTNGHLDLIERAEKIFGNLVVAVLENTSKTPTF-NLERRIIQIKNSLS 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          VIS+ GL V+ A D+ A +I+RGLR M+DF+YE+++   N+ L  +I T
Sbjct: 59  HLPNIE-----VISYSGLTVDCANDLKANLILRGLRAMSDFEYELQIAHTNKSLNNDIET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           I L    +  +++S+L++ +     +I   VP PV   LK 
Sbjct: 114 IFLSTNTNYSFLSSSLVKEVAKFGGEINHMVPPPVEKDLKE 154


>gi|163803275|ref|ZP_02197154.1| phosphopantetheine adenylyltransferase [Vibrio sp. AND4]
 gi|159172912|gb|EDP57750.1| phosphopantetheine adenylyltransferase [Vibrio sp. AND4]
          Length = 160

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 93/167 (55%), Gaps = 7/167 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y G+FDP+TNGH+++I +     +++VI +  +  K   F +++ER  L+++ + 
Sbjct: 1   MKV-IYPGTFDPLTNGHLNLIERTHEMFDEVVIGVAASPSKNTMF-TLEERVALMEEVVA 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H    +     V  F GL V+ A+   A+V++RGLR   DF+YE  +T++ R L P I +
Sbjct: 59  HLSGVT-----VKGFSGLLVDFARQEQAKVLIRGLRTTVDFEYEFGLTNMYRKLLPGIES 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L  +E   +++ST++R +      I  FVP+ V   +K  V    
Sbjct: 114 VFLTPEEEFAFLSSTIVREVAIHGGSIEQFVPEVVATAIKKKVDERQ 160


>gi|241204659|ref|YP_002975755.1| phosphopantetheine adenylyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858549|gb|ACS56216.1| pantetheine-phosphate adenylyltransferase [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 164

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 68/162 (41%), Positives = 108/162 (66%), Gaps = 1/162 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDPITNGH+D+++QAL+  E +++ IG +  K   F S +ER+ELI+ S+ 
Sbjct: 1   MTTAFYPGSFDPITNGHVDVLVQALNVAEKVIVGIGIHPGKAPLF-SFEERAELIRCSLA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  +  ++V++F+ L V+ A+   A +++RGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  EALPGKTGDIAVVAFDNLVVDAARTHGATLLIRGLRDGTDLDYEMQMAGMNRTMAPDIQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           I L A  +SR +T+TL+R + ++  D+++FVP  V   L + 
Sbjct: 120 IFLPAGTASRPITATLVRQIAAMGGDVSAFVPAAVLQALTSK 161


>gi|167856187|ref|ZP_02478924.1| phosphopantetheine adenylyltransferase [Haemophilus parasuis 29755]
 gi|219871557|ref|YP_002475932.1| phosphopantetheine adenylyltransferase [Haemophilus parasuis
           SH0165]
 gi|254764156|sp|B8F6N2|COAD_HAEPS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|167852676|gb|EDS23953.1| phosphopantetheine adenylyltransferase [Haemophilus parasuis 29755]
 gi|219691761|gb|ACL32984.1| phosphopantetheine adenylyltransferase [Haemophilus parasuis
           SH0165]
          Length = 155

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 55/161 (34%), Positives = 91/161 (56%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +  +Y G+FDPITNGH+DII ++      +++A+  N  K   F S+++R EL++QS 
Sbjct: 1   MNQTVIYAGTFDPITNGHLDIIQRSSRLFGKVIVAVAKNPSKQPLF-SLEQRVELVQQSC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       VI F GL V+ AK  +A  ++RG+R   D +YE+++  +N+ L  ++ 
Sbjct: 60  QMLNNVE-----VIGFSGLLVDFAKQHNATTLIRGIRGADDIEYEIQLAQLNQKLAGQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           TI L      RY++ST++R +     D+  FVP+ V   L+
Sbjct: 115 TIFLPPAVEWRYLSSTMVREIYRHQGDVGQFVPEIVLKSLR 155


>gi|167465472|ref|ZP_02330561.1| lipopolysaccharide core biosynthesis [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322382545|ref|ZP_08056425.1| phosphopantetheine adenylyltransferase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321153461|gb|EFX45866.1| phosphopantetheine adenylyltransferase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 169

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 50/162 (30%), Positives = 89/162 (54%), Gaps = 6/162 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + AVY GSFDP+T GH+DII +A    + L++A+  NS K   F +++ER +L++++  H
Sbjct: 9   KVAVYPGSFDPVTFGHLDIIQRAALVFDKLIVAVLNNSSKNPLF-TVEERIQLLQEATGH 67

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     V  F  L VN  +     ++VRGLR ++DF+YE+++ + N  L P++ T 
Sbjct: 68  IPNVE-----VDGFRDLLVNYLEQKQVNIVVRGLRAVSDFEYELQLATTNNKLNPKVETF 122

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
            + A     +++S++++ +      +T  VP+ V   L    
Sbjct: 123 FMTASPQYSFLSSSVVKEVARFHGPVTGLVPEVVENALVQKY 164


>gi|158522751|ref|YP_001530621.1| pantetheine-phosphate adenylyltransferase [Desulfococcus oleovorans
           Hxd3]
 gi|254764150|sp|A8ZXR7|COAD_DESOH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|158511577|gb|ABW68544.1| pantetheine-phosphate adenylyltransferase [Desulfococcus oleovorans
           Hxd3]
          Length = 168

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 56/167 (33%), Positives = 96/167 (57%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+TNGH+DII +     + ++++I  N  K K   S+ ER +++ +S+ 
Sbjct: 1   MKIAIYPGSFDPVTNGHIDIIQRGRHLFDKIIVSILLNPGK-KALFSLDERLDMLTESLK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                  + V V SF GL ++ A+  +A+ I+RG+R ++DF+YE +M  +NR L  +I T
Sbjct: 60  -----DIDGVEVDSFAGLLIDYAERKNAKAILRGMRAVSDFEYEFQMALMNRRLNRDIQT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L       Y +S++I+   +   DI+  VP  V   L+  +  +V
Sbjct: 115 VFLMTGMRWIYTSSSIIKEAATFGGDISGMVPAIVEKKLEEKIGYVV 161


>gi|219849854|ref|YP_002464287.1| phosphopantetheine adenylyltransferase [Chloroflexus aggregans DSM
           9485]
 gi|254763941|sp|B8G6P2|COAD_CHLAD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|219544113|gb|ACL25851.1| pantetheine-phosphate adenylyltransferase [Chloroflexus aggregans
           DSM 9485]
          Length = 161

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 51/166 (30%), Positives = 81/166 (48%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDP+T  H+DI  +A    + +++A+     K   F S +ER  L++ +  
Sbjct: 1   MRIAIYPGSFDPVTYAHLDIARRATRIFDRVIMAVFDRPQKRLLF-STEERLHLLRTATA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                 +      S+  L V  A+ + A  IVRGLR  +DF+ E +M  VN+ + P I  
Sbjct: 60  DLDHVEAM-----SYNTLTVEFARQVGACAIVRGLRAGSDFEAEFQMAQVNQTIDPGIEV 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + L A     +++ST +R + S+  D   F P  V   L+      
Sbjct: 115 VVLMAGRPFAHISSTAVREMASLGRDPVEFTPPVVVAALREKFAQR 160


>gi|78212895|ref|YP_381674.1| phosphopantetheine adenylyltransferase [Synechococcus sp. CC9605]
 gi|123578174|sp|Q3AJW3|COAD_SYNSC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|78197354|gb|ABB35119.1| coenzyme A biosynthesis protein [Synechococcus sp. CC9605]
          Length = 163

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 60/165 (36%), Positives = 93/165 (56%), Gaps = 7/165 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDP+TNGHMD+I +A+S   ++V+A+  N  K   F S+ ER E I+ +  
Sbjct: 1   MR-ALYPGSFDPLTNGHMDLIERAVSLFGEVVVAVLSNPSKRPAF-SVDERIEQIRTATC 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          VISF+GL VN A    A +I+RGLR M+DF+YE+++   NR L  ++ T
Sbjct: 59  HLSGVE-----VISFDGLTVNCAVTHRADLILRGLRAMSDFEYELQIAHTNRSLADDLET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + +       +++S++++ +      I   VP  V   L  +  S
Sbjct: 114 VFMATTARHSFLSSSVVKEVARFGGSIDHMVPPEVAKDLNRLFNS 158


>gi|194334179|ref|YP_002016039.1| phosphopantetheine adenylyltransferase [Prosthecochloris aestuarii
           DSM 271]
 gi|229500854|sp|B4S8K5|COAD_PROA2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|194311997|gb|ACF46392.1| pantetheine-phosphate adenylyltransferase [Prosthecochloris
           aestuarii DSM 271]
          Length = 168

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 55/164 (33%), Positives = 91/164 (55%), Gaps = 5/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y G+FDP TNGH+D+  +A +  + +V+ I  NS K   F S+ ER E+I++ I
Sbjct: 1   MTQIAIYPGTFDPFTNGHLDVFERASNIFDSVVVVIAENSRKNTLF-SVDERREMIEKII 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             +       +     +GL  + A+ + A+ IVRG+R + DF+YE +M+ +NR L P++ 
Sbjct: 60  GRYPGARVEVLH----DGLLADYARQVGAKAIVRGVRQVKDFEYEFQMSLLNRQLNPDVT 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           T+ L       YV S++IR +  +  D+ +FV   V   L    
Sbjct: 116 TVFLMPNVKYTYVASSIIREVAMLGGDVHNFVHPNVLEKLHEKY 159


>gi|306843963|ref|ZP_07476558.1| pantetheine-phosphate adenylyltransferase [Brucella sp. BO1]
 gi|306275718|gb|EFM57442.1| pantetheine-phosphate adenylyltransferase [Brucella sp. BO1]
          Length = 164

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 71/165 (43%), Positives = 101/165 (61%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGH+D++  AL   + +++AIG +  K   F S  ER  LIK S  
Sbjct: 1   MTIAIYAGSFDPVTNGHIDVLKGALRLADQVIVAIGMHPGKKPLF-SFDERVALIKASAK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   + RVSVI+F+GL ++ A+   AQ++VRGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  AVLHKDAVRVSVIAFDGLVIDAARKHGAQLMVRGLRDGTDLDYEMQMAGMNGTMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A  + R +T+TL+R + S+  DI  FVP  V   L     S
Sbjct: 120 VFLPADPAVRTITATLVRQIASMGGDIKPFVPVAVAAALNTKFKS 164


>gi|37912917|gb|AAR05253.1| predicted phosphopantetheine adenylyltransferase [uncultured marine
           proteobacterium ANT32C12]
          Length = 160

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 60/162 (37%), Positives = 91/162 (56%), Gaps = 5/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y GSFDPIT GHMDII +     + +++AI  +  K   F S+++R  L +    
Sbjct: 1   MRVGIYPGSFDPITFGHMDIIDRGCGLFDKVIVAIAKSESKNPLF-SVEDRINLAQSIYA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                            L V+LA+D +A  I+RGLR ++DF+YE ++ ++NR L P+I +
Sbjct: 60  DNDKVEVLGFP----RKLTVDLARDHNACAIIRGLRAVSDFEYEFQLATMNRSLAPDIES 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           I L  KES  YV+S+LI+ +  ++ DI+ FV   V   LK  
Sbjct: 116 IFLTPKESLIYVSSSLIKEISGLNGDISKFVHPIVEQALKAK 157


>gi|116074851|ref|ZP_01472112.1| putative pantetheine-phosphate adenylyltransferase [Synechococcus
           sp. RS9916]
 gi|116068073|gb|EAU73826.1| putative pantetheine-phosphate adenylyltransferase [Synechococcus
           sp. RS9916]
          Length = 162

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 55/159 (34%), Positives = 91/159 (57%), Gaps = 7/159 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDP+T GH+D+I +      ++V+A+  N  KT  F  +++R E I+ +  
Sbjct: 1   MR-ALYPGSFDPLTLGHLDLIERGCQLFGEVVVAVLQNPGKTPAF-PLEQRLEQIRTATA 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H        V VISF+GL V  A++  A +I+RGLR M+DF+YE+++   NR L  E  T
Sbjct: 59  HI-----QGVEVISFDGLTVQCAREQQANLILRGLRAMSDFEYELQIAHTNRSLSKEFET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           + L       +++S++++ +      ++  VP+ V   L
Sbjct: 114 VFLATSAHHSFLSSSVVKEVARFGGPVSHMVPEVVAQDL 152


>gi|295425146|ref|ZP_06817851.1| pantetheine-phosphate adenylyltransferase [Lactobacillus
           amylolyticus DSM 11664]
 gi|295065205|gb|EFG56108.1| pantetheine-phosphate adenylyltransferase [Lactobacillus
           amylolyticus DSM 11664]
          Length = 159

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 48/164 (29%), Positives = 85/164 (51%), Gaps = 5/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A++ GSFDPITNGH+D+  +A +  + + + I  N+ K   F S +      +    
Sbjct: 1   MTIALFPGSFDPITNGHLDVAKKAATMFDKVYVVIMTNTNKHYLFNSQERTQMAQET--- 57

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             + D  N   +   + L V++A+ + A  I+RG+R+  DF YE ++  +N  L  ++ T
Sbjct: 58  --LKDIPNIEVLAKPDQLTVDVARHLKASAIIRGVRNTEDFLYEQQIAGINERLNDQVHT 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + LF    + +V S++I+ +   + DI  F+P  V   LK  + 
Sbjct: 116 VLLFTDPENSFVASSMIKEVARFNGDIEQFLPANVADALKKKLR 159


>gi|191638321|ref|YP_001987487.1| phosphopantetheine adenylyltransferase [Lactobacillus casei BL23]
 gi|301066372|ref|YP_003788395.1| phosphopantetheine adenylyltransferase [Lactobacillus casei str.
           Zhang]
 gi|229500848|sp|B3WE28|COAD_LACCB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|190712623|emb|CAQ66629.1| Phosphopantetheine adenylyltransferase (Pantetheine-phosphate
           adenylyltransferase) (PPAT) (Dephospho-CoA
           pyrophosphorylase) [Lactobacillus casei BL23]
 gi|300438779|gb|ADK18545.1| Phosphopantetheine adenylyltransferase [Lactobacillus casei str.
           Zhang]
 gi|327382347|gb|AEA53823.1| CoaD [Lactobacillus casei LC2W]
 gi|327385548|gb|AEA57022.1| CoaD [Lactobacillus casei BD-II]
          Length = 167

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 53/163 (32%), Positives = 87/163 (53%), Gaps = 5/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
            + AV+ GSFDP TNGH+D + +A    +++V+A   N+ K   F S ++   LI +S  
Sbjct: 3   KKIAVFPGSFDPFTNGHLDTVKRASRLFDEVVVAAMTNTSKKPLFSSEEK-LALISESTA 61

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                 +        + L V  A+ I A+ ++RG+R++ DF YE  + +VN  L PEI T
Sbjct: 62  GLPNVKAMAAP----KRLTVEFARSIGARFMIRGIRNVADFGYEADIATVNHDLDPEIET 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L A +    ++ST+I+ + +   D+  FVP PV   L   +
Sbjct: 118 VFLLADKQYDALSSTIIKEVAAFGGDVHRFVPAPVEAALYAKL 160


>gi|239982546|ref|ZP_04705070.1| phosphopantetheine adenylyltransferase [Streptomyces albus J1074]
 gi|291454388|ref|ZP_06593778.1| pantetheine-phosphate adenylyltransferase [Streptomyces albus
           J1074]
 gi|291357337|gb|EFE84239.1| pantetheine-phosphate adenylyltransferase [Streptomyces albus
           J1074]
          Length = 159

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 58/165 (35%), Positives = 91/165 (55%), Gaps = 7/165 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GSFDPITNGH+DII +A    + + +A+  N  K   F  I ER ELI++   
Sbjct: 1   MRRAVCPGSFDPITNGHLDIIGRASRLYDVVHVAVMINQSKKGLFE-IDERIELIREVTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F       V V SF GL V+  K      IV+GLR ++DFDYE++M  +N      + T
Sbjct: 60  EFGN-----VQVESFHGLLVDFCKQRDIPAIVKGLRAVSDFDYELQMAQMN-IGLSGVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + +    +  +++S+L++ + +   D++  VP+PV   L + +  
Sbjct: 114 LFVPTNPTYSFLSSSLVKEVAAWGGDVSHLVPEPVLAALGDRLRR 158


>gi|240144127|ref|ZP_04742728.1| pantetheine-phosphate adenylyltransferase [Roseburia intestinalis
           L1-82]
 gi|257203919|gb|EEV02204.1| pantetheine-phosphate adenylyltransferase [Roseburia intestinalis
           L1-82]
 gi|291536222|emb|CBL09334.1| pantetheine-phosphate adenylyltransferase, bacterial [Roseburia
           intestinalis M50/1]
 gi|291538910|emb|CBL12021.1| pantetheine-phosphate adenylyltransferase, bacterial [Roseburia
           intestinalis XB6B4]
          Length = 161

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 60/164 (36%), Positives = 93/164 (56%), Gaps = 6/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+KA+Y GSFDP+T GH+DII ++   V++LV+ +  NS K   F S+ ER  +IK+   
Sbjct: 1   MKKAIYPGSFDPLTLGHLDIIERSARIVDELVVGVLNNSAKNSLF-SLDERVSMIKEMTD 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +     V SF GL V+  ++I A +IVRGLR +TDF+YE+++   N    PE+ T
Sbjct: 60  SMPNVT-----VTSFNGLLVDYMREIDATIIVRGLRAVTDFEYELQIAQTNHVENPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           I L       Y++ST+++   S   D++ FVP      + +   
Sbjct: 115 IFLTTSLQYSYLSSTIVKEFASYGGDLSKFVPARFIDRIYDKYQ 158


>gi|75675991|ref|YP_318412.1| phosphopantetheine adenylyltransferase [Nitrobacter winogradskyi
           Nb-255]
 gi|123613303|sp|Q3SRN1|COAD_NITWN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|74420861|gb|ABA05060.1| Phosphopantetheine adenylyltransferase [Nitrobacter winogradskyi
           Nb-255]
          Length = 165

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 95/165 (57%), Gaps = 1/165 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++  A++  + L++A+G +  KT  F S  +R  + +   
Sbjct: 1   MPRVALYPGSFDPVTNGHLDVVRHAVALCDRLIVAVGVHPGKTPVF-SADDRLAMARSVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                ++      ++++ L V  A  + A ++VRGLRD TD DYEM++  +N  + P++ 
Sbjct: 60  EPVAVEAGCAFDCVTYDDLTVAAAHKVGATILVRGLRDGTDLDYEMQIAGMNETMAPDVH 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T+ + A    R +T+TL+R + ++  D++ FVP  V   L+    
Sbjct: 120 TVFVPASPGVRPITATLVRQIATMGGDVSPFVPQLVASRLRTKFA 164


>gi|325294940|ref|YP_004281454.1| phosphopantetheine adenylyltransferase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065388|gb|ADY73395.1| Phosphopantetheine adenylyltransferase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 167

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 57/169 (33%), Positives = 94/169 (55%), Gaps = 3/169 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M++KA+Y G+FDP+T GH+DI+ + +   ++L+I I  N  K   F +++ER ++ ++S+
Sbjct: 1   MIKKAIYPGTFDPVTLGHIDIVRRGIELFQELIIGIAENPKKEPLF-TLEERKKMFEESL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     V V +F  L V  AK   A  I+RG+R ++D D+E  M S+NR L PEI 
Sbjct: 60  KEVGLYEK--VKVKTFNSLLVEFAKKEGAVAILRGIRIISDMDHEFTMASINRKLYPEIE 117

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           T+ L   +   Y++S+ +R +     D++ FV   V   LK  +    K
Sbjct: 118 TVFLMPSDEYAYLSSSAVREIAFYGGDVSQFVTKCVETKLKEKIELFRK 166


>gi|297202620|ref|ZP_06920017.1| pantetheine-phosphate adenylyltransferase [Streptomyces sviceus
           ATCC 29083]
 gi|197713195|gb|EDY57229.1| pantetheine-phosphate adenylyltransferase [Streptomyces sviceus
           ATCC 29083]
          Length = 159

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 55/163 (33%), Positives = 91/163 (55%), Gaps = 7/163 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GSFDPITNGH+DII +A    +++ +A+  N  K   F  I ER +LI++   
Sbjct: 1   MRRAVCPGSFDPITNGHLDIISRASRLYDEVYVAVMINKSKKGLFE-IDERIDLIREVTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +       V V +F GL V+  K+     IV+GLR ++DFDYE++M  +N  L   + T
Sbjct: 60  EYGN-----VIVEAFHGLLVDYCKERDIPAIVKGLRAVSDFDYELQMAQMNNGLS-GVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + +    +  +++S+L++ + +   D++  VP  V   L   +
Sbjct: 114 LFVPTNPTYSFLSSSLVKEVATWGGDVSHLVPPRVLEALNERL 156


>gi|261366433|ref|ZP_05979316.1| pantetheine-phosphate adenylyltransferase [Subdoligranulum
           variabile DSM 15176]
 gi|282571696|gb|EFB77231.1| pantetheine-phosphate adenylyltransferase [Subdoligranulum
           variabile DSM 15176]
          Length = 162

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 58/159 (36%), Positives = 89/159 (55%), Gaps = 6/159 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+T GH+DII ++    + L++A+  NS KT  F +++ER  ++++   
Sbjct: 1   MPIAMYPGSFDPVTRGHLDIIKRSSRMFDKLIVAVLVNSAKTPLF-TVEERVAMLRECCK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V SF GL V+ AK   A V+VRGLR +TDF+ E+++   N  + PEI T
Sbjct: 60  DMPNVE-----VDSFNGLTVSFAKQKGATVMVRGLRAVTDFENEIQLAHTNYAMMPEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           + L       Y++ST++R       D++ FVP  V   L
Sbjct: 115 MFLATAIKWSYLSSTIVREAAHYGQDVSRFVPPNVEKEL 153


>gi|225378033|ref|ZP_03755254.1| hypothetical protein ROSEINA2194_03693 [Roseburia inulinivorans DSM
           16841]
 gi|225210034|gb|EEG92388.1| hypothetical protein ROSEINA2194_03693 [Roseburia inulinivorans DSM
           16841]
          Length = 161

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 64/163 (39%), Positives = 92/163 (56%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+KA+Y GSFDP+T GH+DII +A   V++LV+ +  NS K   F S+ ER  +I++   
Sbjct: 1   MKKAIYPGSFDPLTLGHIDIIKRASGIVDELVVGVLNNSAKNSLF-SLDERVSMIEEMTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                S     V SF+GL V   K I A +IVRGLR +TDF+YE+++   N    PE+ T
Sbjct: 60  DLPNVS-----VTSFDGLLVEHMKQIGATIIVRGLRAVTDFEYELQIAQTNHVESPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           I L A     Y++ST+++   S   DI+ FVP      +    
Sbjct: 115 IFLTASLQYSYLSSTIVKEFASYGGDISKFVPAQFIDRIYAKY 157


>gi|302554403|ref|ZP_07306745.1| pantetheine-phosphate adenylyltransferase [Streptomyces
           viridochromogenes DSM 40736]
 gi|302472021|gb|EFL35114.1| pantetheine-phosphate adenylyltransferase [Streptomyces
           viridochromogenes DSM 40736]
          Length = 159

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 91/165 (55%), Gaps = 7/165 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GSFDPITNGH+DII +A    +++ +A+  N  K   F  I+ER +LI++   
Sbjct: 1   MRRAVCPGSFDPITNGHLDIISRASRLYDEVYVAVMINQAKKGLFE-IEERIDLIRRVTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +       V V +F GL V+  K      IV+GLR ++DFDYE++M  +N  L   + T
Sbjct: 60  EYGN-----VRVEAFHGLLVDFCKQREIPAIVKGLRAVSDFDYELQMAQMNNGLS-GVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + +    +  +++S+L++ + +   D++  VP  V   L   +  
Sbjct: 114 LFIPTNPTYSFLSSSLVKEVATWGGDVSHLVPAEVLQVLNERLRK 158


>gi|153839972|ref|ZP_01992639.1| pantetheine-phosphate adenylyltransferase [Vibrio parahaemolyticus
           AQ3810]
 gi|260362379|ref|ZP_05775337.1| pantetheine-phosphate adenylyltransferase [Vibrio parahaemolyticus
           K5030]
 gi|260877864|ref|ZP_05890219.1| pantetheine-phosphate adenylyltransferase [Vibrio parahaemolyticus
           AN-5034]
 gi|260897657|ref|ZP_05906153.1| pantetheine-phosphate adenylyltransferase [Vibrio parahaemolyticus
           Peru-466]
 gi|260899587|ref|ZP_05907982.1| pantetheine-phosphate adenylyltransferase [Vibrio parahaemolyticus
           AQ4037]
 gi|149746511|gb|EDM57500.1| pantetheine-phosphate adenylyltransferase [Vibrio parahaemolyticus
           AQ3810]
 gi|308087541|gb|EFO37236.1| pantetheine-phosphate adenylyltransferase [Vibrio parahaemolyticus
           Peru-466]
 gi|308089845|gb|EFO39540.1| pantetheine-phosphate adenylyltransferase [Vibrio parahaemolyticus
           AN-5034]
 gi|308108751|gb|EFO46291.1| pantetheine-phosphate adenylyltransferase [Vibrio parahaemolyticus
           AQ4037]
 gi|308115157|gb|EFO52697.1| pantetheine-phosphate adenylyltransferase [Vibrio parahaemolyticus
           K5030]
 gi|328471760|gb|EGF42637.1| phosphopantetheine adenylyltransferase [Vibrio parahaemolyticus
           10329]
          Length = 160

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 51/167 (30%), Positives = 92/167 (55%), Gaps = 7/167 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y G+FDP+TNGH+++I +     +++VI +  +  K   F +++ER  L+++ + 
Sbjct: 1   MKV-IYPGTFDPVTNGHLNLIERTHEMFDEVVIGVAASPSKNTMF-TLEERVALMEEVVA 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H    +     V  F GL V+ A+   A+V++RGLR   DF+YE  +T++ R L P I +
Sbjct: 59  HLPGVT-----VKGFSGLLVDFARQEQAKVLIRGLRTTVDFEYEFGLTNMYRKLLPGIES 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L  +E   +++ST++R +      I  FVP  V   ++  V    
Sbjct: 114 VFLTPEEEFAFLSSTIVREVAIHGGSIEQFVPAAVANAIEKKVNERQ 160


>gi|209885352|ref|YP_002289209.1| pantetheine-phosphate adenylyltransferase [Oligotropha
           carboxidovorans OM5]
 gi|226709010|sp|B6JFC5|COAD_OLICO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|209873548|gb|ACI93344.1| pantetheine-phosphate adenylyltransferase [Oligotropha
           carboxidovorans OM5]
          Length = 165

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 61/166 (36%), Positives = 98/166 (59%), Gaps = 1/166 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+Y GSFDP+TNGH+D++ QA + V+ L++AIG +  K   F S+ ER  +I +  
Sbjct: 1   MAHVALYPGSFDPVTNGHVDVVRQACTLVDRLIVAIGVHPGKAPLF-SVDERRAMIVEVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +   +  ++F+ L V  A+   A +++RGLRD TD DYEM++  +N+ L P + 
Sbjct: 60  SPLAATTGCAIECVTFDNLTVAAAEKSGATILIRGLRDGTDLDYEMQIAGMNQTLVPSVQ 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           TI + A  + R +T+TL+R + S+  D+++FVP  V   LK     
Sbjct: 120 TIFIPASPTVRPITATLVRQIASMGGDVSAFVPKAVAARLKAKFSQ 165


>gi|257063716|ref|YP_003143388.1| Phosphopantetheine adenylyltransferase [Slackia heliotrinireducens
           DSM 20476]
 gi|256791369|gb|ACV22039.1| Phosphopantetheine adenylyltransferase [Slackia heliotrinireducens
           DSM 20476]
          Length = 159

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++A+  G+FDPITNGH+D++ ++    +++++ +  +  K   F ++ ER  L +++  
Sbjct: 1   MKRALVPGTFDPITNGHIDVVERSADIFDEVIVGVAQSRKKGPTF-NLDERIALAQEATA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V+ F+ L VN AK I+A VIV+GLR +TDF+YE +MTS+N  L   I T
Sbjct: 60  HLPNVK-----VMGFDDLLVNFAKKINAHVIVKGLRAITDFEYEFQMTSMNYALDESIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + + ++    Y++S+++R L +   DI + VP  V   L    + 
Sbjct: 115 LFIMSQPQHMYLSSSIVRELAAFHGDIKALVPPCVEKALNEKFMR 159


>gi|167765562|ref|ZP_02437626.1| hypothetical protein CLOSS21_00056 [Clostridium sp. SS2/1]
 gi|317498518|ref|ZP_07956812.1| pantetheine-phosphate adenylyltransferase [Lachnospiraceae
           bacterium 5_1_63FAA]
 gi|167712747|gb|EDS23326.1| hypothetical protein CLOSS21_00056 [Clostridium sp. SS2/1]
 gi|291559028|emb|CBL37828.1| Phosphopantetheine adenylyltransferase [butyrate-producing
           bacterium SSC/2]
 gi|316894211|gb|EFV16399.1| pantetheine-phosphate adenylyltransferase [Lachnospiraceae
           bacterium 5_1_63FAA]
          Length = 159

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 58/165 (35%), Positives = 88/165 (53%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDP+T GH+DII ++    + L+IA+  NS K   F + ++   + K +  
Sbjct: 1   MSIAVYPGSFDPVTYGHIDIIERSAKVFDKLIIAVLVNSAKKPMFTTQEKVDMIRKVTSH 60

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    V V+SF GL V+ AK   A V VRGLR +TDF+YE+++   N  L  ++ T
Sbjct: 61  LD------NVEVMSFSGLLVDFAKQQGASVSVRGLRAVTDFEYEIQIAQTNARLDKDLDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           +         YV+ST+++ + S   D++  VP  V   L+    S
Sbjct: 115 MFFTTSIEYSYVSSTIVKEIASYHGDVSEMVPPYVQECLEKKFKS 159


>gi|223042137|ref|ZP_03612308.1| phosphopantetheine adenylyltransferase [Actinobacillus minor 202]
 gi|223017076|gb|EEF15517.1| phosphopantetheine adenylyltransferase [Actinobacillus minor 202]
          Length = 163

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 55/161 (34%), Positives = 86/161 (53%), Gaps = 7/161 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M RK +Y G+FDPIT GH+DII +A S  + +++A+  N  K   F S++ER+ L+ +S 
Sbjct: 1   MNRKVIYAGTFDPITKGHLDIIQRAASLFDQVIVAVAKNPSKQPLF-SLEERTSLVSESC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRC-LCPEI 119
            H        V    F GL  + A +  AQ ++RG+R   D +YE+++  +N       +
Sbjct: 60  LHLSN-----VQAAGFSGLLADFALEHQAQALIRGIRGSDDLEYEIQLAQLNHKLAHEHL 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
            TI        RY++ST++R +     DI+ FVP  V   L
Sbjct: 115 ETIFFPPAVELRYISSTMVREIYKHHGDISHFVPPCVLNAL 155


>gi|154483593|ref|ZP_02026041.1| hypothetical protein EUBVEN_01297 [Eubacterium ventriosum ATCC
           27560]
 gi|149735503|gb|EDM51389.1| hypothetical protein EUBVEN_01297 [Eubacterium ventriosum ATCC
           27560]
          Length = 165

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 64/171 (37%), Positives = 100/171 (58%), Gaps = 6/171 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+A+Y GSFDP+T GH+DII +A   V++LV+ +  N+ KT  F S++ R +++++ + 
Sbjct: 1   MRRAIYPGSFDPVTFGHLDIIRRASKIVDELVVGVLNNNSKTPLF-SVENRVKMLEEVVR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V+SFEGL V+ AK I AQ+IVRGLR +TDF+YE++M+  N  L   I T
Sbjct: 60  DIPNVK-----VMSFEGLLVDFAKKIDAQIIVRGLRAVTDFEYELQMSQTNSILDDNIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDS 172
           I         Y++S+ +R      ADI+ FVP+ V   +   +    + + 
Sbjct: 115 IFFTTSLEYAYLSSSTVREAAFYGADISRFVPESVVNQVYERLKDKGEKNE 165


>gi|54307429|ref|YP_128449.1| phosphopantetheine adenylyltransferase [Photobacterium profundum
           SS9]
 gi|46911849|emb|CAG18647.1| putative Phosphopantetheine adenylyltransferase
           (Pantetheine-phosphateadenylyltransferase) (PPAT)
           (Dephospho-CoApyrophosphorylase) [Photobacterium
           profundum SS9]
          Length = 163

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 50/164 (30%), Positives = 93/164 (56%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDPITNGH+D+I +A +  + +V+ I  +  K   F   +      + ++
Sbjct: 3   MTTRVIYPGTFDPITNGHLDLIERAAAMFDHVVVGIAASPSKKPLFDLPE------RVAL 56

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              I      V ++ F GL V+ AK+ +A ++VRGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 57  TQAITKHLPNVEIVGFSGLLVDFAKESNANILVRGLRAVSDFEYEFQLANMNRRLMPELE 116

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           T+ L   E + +++ST+++ +     D++ FV   +   L   +
Sbjct: 117 TVFLTPSEENSFISSTIVKEVALHKGDVSQFVDLRITGALNAKL 160


>gi|304404204|ref|ZP_07385866.1| pantetheine-phosphate adenylyltransferase [Paenibacillus
           curdlanolyticus YK9]
 gi|304347182|gb|EFM13014.1| pantetheine-phosphate adenylyltransferase [Paenibacillus
           curdlanolyticus YK9]
          Length = 167

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 55/161 (34%), Positives = 87/161 (54%), Gaps = 6/161 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY GSFDP+T GH+DII +A    + L++A+  N+ K   F +I+ER +L+++    
Sbjct: 10  RIAVYPGSFDPVTLGHLDIIQRAAKQYDTLIVAVLNNTSKNPMF-TIEERKKLLEEVTRD 68

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     + SF  L V   K   A  IVRG+R ++DF+YE++M S N  L  EI TI
Sbjct: 69  IPNVK-----IDSFRDLLVRFMKSRQAGTIVRGIRSVSDFEYELQMASTNHLLDDEIETI 123

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            +       Y++S++++ +   + D++  VP  V   L   
Sbjct: 124 FMMTNPKFSYLSSSIVKEIARFNGDVSELVPPVVRDRLAAK 164


>gi|255524277|ref|ZP_05391236.1| pantetheine-phosphate adenylyltransferase [Clostridium
           carboxidivorans P7]
 gi|296185396|ref|ZP_06853806.1| pantetheine-phosphate adenylyltransferase [Clostridium
           carboxidivorans P7]
 gi|255512102|gb|EET88383.1| pantetheine-phosphate adenylyltransferase [Clostridium
           carboxidivorans P7]
 gi|296050230|gb|EFG89654.1| pantetheine-phosphate adenylyltransferase [Clostridium
           carboxidivorans P7]
          Length = 160

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 63/166 (37%), Positives = 97/166 (58%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR AVY GSFDPITNGH+DII ++    ++LV+ +  N  K KG   I+ER ELIK+++ 
Sbjct: 1   MRTAVYPGSFDPITNGHLDIIKRSSKVFDELVVGVLVNPQK-KGLFDIEERVELIKKAVK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V SF GL +N  +   A+VIV+GLR ++DF+YE +M+ +N  L P I T
Sbjct: 60  DIPNVK-----VESFSGLLINFLRQKHAKVIVKGLRAVSDFEYEFQMSLMNSKLDPNIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + + A   + +++S+ ++ +      I   VPD V   + N + +L
Sbjct: 115 VFMMASAGNSFLSSSSVKQVAMFGGCIQGLVPDSVMPAVINKIKNL 160


>gi|209549344|ref|YP_002281261.1| phosphopantetheine adenylyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|226709011|sp|B5ZPR5|COAD_RHILW RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|209535100|gb|ACI55035.1| pantetheine-phosphate adenylyltransferase [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 164

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 69/162 (42%), Positives = 108/162 (66%), Gaps = 1/162 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDPITNGH+D+++QAL+  E +++AIG +  K   F S +ER+ELI+ S+ 
Sbjct: 1   MTTAFYPGSFDPITNGHVDVLVQALNVAEKVIVAIGIHPGKAPLF-SFEERAELIRLSLA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  +  + V++F+ L V+ A+   A +++RGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  EVLPGKTGDIDVVAFDNLVVDAARSHGATLLIRGLRDGTDLDYEMQMAGMNRTMAPDIQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           I L A  +SR +T+TL+R + ++  D+++FVP  V   L + 
Sbjct: 120 IFLPAGTASRPITATLVRQIAAMGGDVSAFVPAAVLQALTSK 161


>gi|78187052|ref|YP_375095.1| phosphopantetheine adenylyltransferase [Chlorobium luteolum DSM
           273]
 gi|123582985|sp|Q3B3M9|COAD_PELLD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|78166954|gb|ABB24052.1| Coenzyme A biosynthesis protein [Chlorobium luteolum DSM 273]
          Length = 168

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 53/179 (29%), Positives = 91/179 (50%), Gaps = 13/179 (7%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KA+Y G+FDP TNGH+D++ +AL+  E++ + I  NS K   F   +    + + +I
Sbjct: 1   MKKKAIYPGTFDPFTNGHLDVLERALTIFEEVTVLIAENSNKNTLFTVEERMDAIREITI 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                           +GL    A+D+ A  I+RG+R + DF+YE +++ +NR L P++ 
Sbjct: 61  GMDGLHVEVL-----HDGLLAEYARDVGANAIIRGVRQVKDFEYEFQLSLLNRHLNPDVT 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNT 179
           T+ L       Y+ S++I+ +  +  D++ FV   V   L             +L PNT
Sbjct: 116 TVFLMPNVKYTYIASSIIKEVAMLGGDVSKFVHPSVLSMLHRK--------RKELKPNT 166


>gi|229512785|ref|ZP_04402253.1| phosphopantetheine adenylyltransferase [Vibrio cholerae TMA 21]
 gi|229350295|gb|EEO15247.1| phosphopantetheine adenylyltransferase [Vibrio cholerae TMA 21]
          Length = 164

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 52/160 (32%), Positives = 87/160 (54%), Gaps = 6/160 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D+I +A    ++++IA+  +  K   F +++ER +  +    H 
Sbjct: 8   RVIYPGTFDPITNGHLDLIERAAQMFDEVIIAVAASPSKNTLF-TLEERVKFARHVTSHL 66

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
              S+       F GL V+ AK   A V++RGLR   DF+YE  +T++ R L P + ++ 
Sbjct: 67  DNVSAK-----GFSGLLVDFAKAEKANVLIRGLRTTVDFEYEFGLTNMYRRLMPGLESVF 121

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L   E   +++STL+R +     ++  FVP  V   L   
Sbjct: 122 LTPAEEHAFISSTLVREVAIHGGNVDEFVPAIVANALHQK 161


>gi|119489847|ref|ZP_01622602.1| phosphopantetheine adenylyltransferase [Lyngbya sp. PCC 8106]
 gi|119454275|gb|EAW35426.1| phosphopantetheine adenylyltransferase [Lyngbya sp. PCC 8106]
          Length = 157

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 55/162 (33%), Positives = 90/162 (55%), Gaps = 6/162 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y GSFDPIT GH+DII +     E +++A+  N  KT  F +++ER E I  S+ H 
Sbjct: 2   IAIYPGSFDPITLGHLDIIERGCKLFELVIVAVLRNPNKTPLF-TVEERIEQINTSVQHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + + V SF+GL V  AK  +AQV++RGLR ++DF+ E++M   N+ L  +I T+ 
Sbjct: 61  -----HNLEVASFKGLTVEYAKQRNAQVLLRGLRVLSDFEMELQMAHTNKTLSDKIETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           L       +++S++++ +      I   VP  V   +    +
Sbjct: 116 LATSNEYSFLSSSVVKEIAKFSGSIDHLVPKHVAQDIYKRYL 157


>gi|116252155|ref|YP_767993.1| phosphopantetheine adenylyltransferase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|166216579|sp|Q1MGM6|COAD_RHIL3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|115256803|emb|CAK07893.1| putative phosphopantetheine adenylyltransferase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 164

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 70/162 (43%), Positives = 110/162 (67%), Gaps = 1/162 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDPITNGH+D+++QAL+  E +++AIG +  K   F S +ER+ELI++S+ 
Sbjct: 1   MTTAFYPGSFDPITNGHVDVLVQALNVAEKVIVAIGIHPGKAPLF-SFEERAELIRRSLA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  +  +SV++F+ L V+ A+   A +++RGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  EALPGKTGDISVVAFDNLVVDAARTHGATLLIRGLRDGTDLDYEMQMAGMNRTMAPDIQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           I L A  +SR +T+TL+R + ++  D+++FVP  V   L + 
Sbjct: 120 IFLPAGTASRPITATLVRQIAAMGGDVSAFVPAAVLQALTSK 161


>gi|322436433|ref|YP_004218645.1| pantetheine-phosphate adenylyltransferase [Acidobacterium sp.
           MP5ACTX9]
 gi|321164160|gb|ADW69865.1| pantetheine-phosphate adenylyltransferase [Acidobacterium sp.
           MP5ACTX9]
          Length = 169

 Score =  154 bits (390), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 60/164 (36%), Positives = 97/164 (59%), Gaps = 6/164 (3%)

Query: 1   MMRK-AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           M    A+Y G+FDP+TNGH+D+I +    V++LV+AI  NS K     ++ ER E+I ++
Sbjct: 6   MHTVKAIYPGTFDPLTNGHLDLIARGAKIVDELVVAILRNSEKGTPLFTVPERLEMIAEA 65

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           +      S     V +F+GL V+ A+   A+ ++RG+R ++D++YE +M  +NR L PE+
Sbjct: 66  VSGMPNVS-----VTTFDGLLVDFARQQGARAVLRGIRAISDYEYEFQMAMMNRKLDPEL 120

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            T+ +   E   YV+S LI+ +  +  D+TS VP  V   LK  
Sbjct: 121 ETLFMMPAEKYTYVSSRLIKGVFRLGGDVTSLVPPLVVERLKAK 164


>gi|86357732|ref|YP_469624.1| phosphopantetheine adenylyltransferase [Rhizobium etli CFN 42]
 gi|123511944|sp|Q2K8D9|COAD_RHIEC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|86281834|gb|ABC90897.1| phosphopantetheine adenylyltransferase protein [Rhizobium etli CFN
           42]
          Length = 164

 Score =  154 bits (390), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 70/162 (43%), Positives = 109/162 (67%), Gaps = 1/162 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDPITNGH+D+++QAL+  E +++AIG +  K   F S +ER+ELI+ S+ 
Sbjct: 1   MTTAFYPGSFDPITNGHVDVLVQALNVAEKVIVAIGIHPGKAPLF-SFEERAELIRLSLA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  S  ++V++F+ L V+ A+   A +++RGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  EALPGKSANITVVAFDNLVVDAARAHGATLLIRGLRDGTDLDYEMQMAGMNRTMAPDIQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           I L A  +SR +T+TL+R + ++  D+++FVP  V   L + 
Sbjct: 120 IFLPAGTASRPITATLVRQIAAMGGDVSAFVPAAVLQALTSK 161


>gi|307947100|ref|ZP_07662435.1| pantetheine-phosphate adenylyltransferase [Roseibium sp. TrichSKD4]
 gi|307770764|gb|EFO29990.1| pantetheine-phosphate adenylyltransferase [Roseibium sp. TrichSKD4]
          Length = 166

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 70/163 (42%), Positives = 101/163 (61%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDPITNGH+DI+ Q+L+  + +V+AIG +  KT  F   +    + + + 
Sbjct: 1   MTRIALYPGSFDPITNGHIDILGQSLALADRVVVAIGIHPGKTPLFTFEERVQLIHEAAG 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F  D + R+ VISF  L V+ A+  +A  +VRGLRD TD DYEM+M  +N  L P I 
Sbjct: 61  VEFGVDEARRIEVISFSNLVVDAARAQTAAYLVRGLRDGTDLDYEMQMAGMNGTLAPSIK 120

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           T+ L A  S R++T+TL+R +  +  DIT+FVP  V   L++ 
Sbjct: 121 TVFLPASPSVRHITATLVRQIAKMGGDITAFVPSCVVSPLRDR 163


>gi|75908187|ref|YP_322483.1| phosphopantetheine adenylyltransferase [Anabaena variabilis ATCC
           29413]
 gi|75701912|gb|ABA21588.1| Phosphopantetheine adenylyltransferase [Anabaena variabilis ATCC
           29413]
          Length = 212

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 51/161 (31%), Positives = 88/161 (54%), Gaps = 6/161 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            AVY GSFDPIT GH+DII +     + +++A+  N  K   F S+QER E I+++  H 
Sbjct: 23  IAVYPGSFDPITLGHLDIIQRGSRLFDLVIVAVLRNPNKVPLF-SVQERLEQIRRTTKHL 81

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               ++      F+GL VN A+   AQV++RGLR ++DF+ E++M   N+ L  +I T+ 
Sbjct: 82  PNVEAD-----GFDGLTVNYAQQRQAQVLLRGLRAISDFEVELQMAHTNKTLSTQIETVF 136

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           L       +++S++++ +      +   VP  + + +    
Sbjct: 137 LATSNEYSFLSSSVVKEIARFGGSVDHLVPPHIALDIYKCY 177


>gi|237806908|ref|YP_002891348.1| pantetheine-phosphate adenylyltransferase [Tolumonas auensis DSM
           9187]
 gi|259491326|sp|C4L7W3|COAD_TOLAT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|237499169|gb|ACQ91762.1| pantetheine-phosphate adenylyltransferase [Tolumonas auensis DSM
           9187]
          Length = 164

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 49/169 (28%), Positives = 90/169 (53%), Gaps = 6/169 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +K V+ G+FDP+T+GH D+I +A    +++++A+  +  K   F S++ER  L K+  
Sbjct: 1   MRQKVVFPGTFDPLTSGHFDLINRASILFDEVILAVAASPGKRPLF-SLEERLALAKEVC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +     +  F  L ++  K+  A +++RG+R  +DF+YE ++ ++ R + PE+ 
Sbjct: 60  QSLPNVT-----ITGFSNLLIDFMKEQQATILLRGIRTGSDFEYESQLAAMYRRMMPEME 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
            I L   E   +V+STL+R +     D   FV   V   +K   + L +
Sbjct: 115 IIFLPPAEQYAFVSSTLVREIALHGGDAGQFVTPNVAEAIKAKQLQLAQ 163


>gi|157363322|ref|YP_001470089.1| phosphopantetheine adenylyltransferase [Thermotoga lettingae TMO]
 gi|167009048|sp|A8F4E1|COAD_THELT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|157313926|gb|ABV33025.1| pantetheine-phosphate adenylyltransferase [Thermotoga lettingae
           TMO]
          Length = 164

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 62/168 (36%), Positives = 96/168 (57%), Gaps = 8/168 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDPIT GH+DI+ +AL   E+L I +  N  K+  F +++ER E+I     
Sbjct: 1   MK-AVYPGSFDPITYGHLDIVNRALKIFEELWIVVMSNPRKSPVF-TVEERVEMIS---- 54

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +      V V S++GL V+  +  + +V++RGLR +TDF YE+ M   N+ +C E  T
Sbjct: 55  -DLVKKEPNVHVDSYQGLLVDYLRSRNIKVVIRGLRAVTDFQYELEMAIANKSMCKEFET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + L   E   +++S L+R + S+  D+T +VP  V   L   + S  K
Sbjct: 114 VFLMTDERFSFLSSGLVREVASMGGDVTKWVPPNVAEAL-EKLRSKGK 160


>gi|283850640|ref|ZP_06367927.1| pantetheine-phosphate adenylyltransferase [Desulfovibrio sp.
           FW1012B]
 gi|283573883|gb|EFC21856.1| pantetheine-phosphate adenylyltransferase [Desulfovibrio sp.
           FW1012B]
          Length = 171

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 50/160 (31%), Positives = 84/160 (52%), Gaps = 6/160 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+TNGH+ ++ +A      +++A+  +S KT  F S++ER  + +    H  
Sbjct: 9   AVYPGTFDPLTNGHVSLVRRAAKIFGTVIVAVAGDSHKTPLF-SLEERVAIAEGVFAHDE 67

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                   V  F GL VN  K   A VI+RG+R ++DF++E +M  +NR L   I T+ +
Sbjct: 68  RVL-----VEGFSGLLVNYVKARQANVILRGMRAVSDFEFEFQMALMNRKLDRTIETVFI 122

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
                  Y++ST+++ +     +I   VP+ V   +    
Sbjct: 123 MTDYKWLYISSTIVKEVAKHGGEIRGMVPESVRERMLEKY 162


>gi|323136307|ref|ZP_08071389.1| pantetheine-phosphate adenylyltransferase [Methylocystis sp. ATCC
           49242]
 gi|322398381|gb|EFY00901.1| pantetheine-phosphate adenylyltransferase [Methylocystis sp. ATCC
           49242]
          Length = 190

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 61/165 (36%), Positives = 96/165 (58%), Gaps = 1/165 (0%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y+G+FDP+T GH+D+I Q  +  + +V+AIG +  K     + +ER+ +I ++   
Sbjct: 26  RTALYSGTFDPLTYGHLDVIRQGAAMFDRIVVAIGVHPGKAPWL-TFEERAAVIAEACED 84

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
           F       + V SF+GL V  A+   A  I+RGLRD TDFDYEM+M  +N  L PE+ T+
Sbjct: 85  FELSRPCAIEVTSFDGLVVEAARACGACAILRGLRDGTDFDYEMQMAGMNGTLAPEVHTL 144

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
            L A    R+++ TL+R + S+  D+++F P      LK  +   
Sbjct: 145 FLPAAPGLRHISGTLVRQIASLGGDVSAFAPPASVEALKRAIARR 189


>gi|33861441|ref|NP_893002.1| putative pantetheine-phosphate adenylyltransferase [Prochlorococcus
           marinus subsp. pastoris str. CCMP1986]
 gi|61212717|sp|Q7V1I7|COAD_PROMP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|33634018|emb|CAE19343.1| putative pantetheine-phosphate adenylyltransferase [Prochlorococcus
           marinus subsp. pastoris str. CCMP1986]
          Length = 159

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 60/165 (36%), Positives = 99/165 (60%), Gaps = 7/165 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y G+FDP+TNGH+D+I +A     ++V+A+  N+ K   F ++ +R   IK ++ 
Sbjct: 1   MKI-LYPGTFDPLTNGHLDLIQRAEKLFGNVVVAVLENTSKKPTF-NLNKRLVQIKNAVS 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H    S     VIS+EGL V+ AK+++A +I+RGLR M+DF+YE+++   N+ L  EI T
Sbjct: 59  HLSNIS-----VISYEGLTVDCAKEVNANLILRGLRAMSDFEYELQIAHTNKSLNTEIET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           I L    +  +++S+L++ +     +I   VPD V   LKN    
Sbjct: 114 IFLSTNTNYSFLSSSLVKEVAKFGGEIDHMVPDSVERDLKNYFKK 158


>gi|121603804|ref|YP_981133.1| pantetheine-phosphate adenylyltransferase [Polaromonas
           naphthalenivorans CJ2]
 gi|120592773|gb|ABM36212.1| pantetheine-phosphate adenylyltransferase [Polaromonas
           naphthalenivorans CJ2]
          Length = 173

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 51/158 (32%), Positives = 86/158 (54%), Gaps = 6/158 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY+G+FDP T GH D++ +A    + LVIA+     K   F S+  R + ++ +  +
Sbjct: 13  RIAVYSGTFDPFTLGHDDVVRRAAGLFDQLVIAVAVAHHKKTLF-SLDARVQHVRNATEN 71

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               S     V++F+GL ++     +A  +VRG+R++TDFDYE +M ++NR L P++ T+
Sbjct: 72  IANVS-----VMAFDGLMMDFCAAQNACAVVRGIRNLTDFDYEAQMAAMNRKLRPQVETV 126

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
            L        ++STL+R +  +   +   V   V   L
Sbjct: 127 FLLPDAPLACISSTLVREISKLGGQVGQMVSPQVAAAL 164


>gi|229827748|ref|ZP_04453817.1| hypothetical protein GCWU000182_03140 [Abiotrophia defectiva ATCC
           49176]
 gi|229787947|gb|EEP24061.1| hypothetical protein GCWU000182_03140 [Abiotrophia defectiva ATCC
           49176]
          Length = 159

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 60/165 (36%), Positives = 103/165 (62%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KAVY GSFDP+TNGH+D+I +A + V++++I +  N  K+  F +++ER E++K+S+ 
Sbjct: 1   MVKAVYPGSFDPVTNGHIDVITRAAAIVDEVIIGVLVNKKKSPFF-TMEERFEMLKKSVE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +     V +FEG  V+ AK+  A++IVRGLR +TD++ EM++   NR +C +I T
Sbjct: 60  DIPNVT-----VKTFEGTTVDFAKENDARIIVRGLRAVTDYENEMQIAQTNRQICEDIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L       +++ST+++ + S   D++S+VP  V   L+     
Sbjct: 115 LFLITSLEYAFLSSTIVKEIASFGKDVSSWVPKVVEDRLREKFKY 159


>gi|312879962|ref|ZP_07739762.1| Phosphopantetheine adenylyltransferase [Aminomonas paucivorans DSM
           12260]
 gi|310783253|gb|EFQ23651.1| Phosphopantetheine adenylyltransferase [Aminomonas paucivorans DSM
           12260]
          Length = 166

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 56/163 (34%), Positives = 92/163 (56%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +AVY GSFDPITNGH+ I  +A    ++LV+A+  N  K   F S++ER  + ++++ 
Sbjct: 1   MIRAVYPGSFDPITNGHLYIAERAAFSFDELVVAVLHNPQKRATF-SVEERQIMAREALS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H        V V +FEGL V+  +   +++IVRGLR ++DF+YE ++  +NR L PEI T
Sbjct: 60  HLPN-----VRVAAFEGLLVDFMRHQQSRIIVRGLRALSDFEYEFQLAQMNRQLAPEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + +       Y++S  ++ +      +   VP  V   L+  +
Sbjct: 115 LFIVTDAQYSYLSSRGVKEVFHFGGSVQDMVPPGVYRRLRERI 157


>gi|325981157|ref|YP_004293559.1| pantetheine-phosphate adenylyltransferase [Nitrosomonas sp. AL212]
 gi|325530676|gb|ADZ25397.1| pantetheine-phosphate adenylyltransferase [Nitrosomonas sp. AL212]
          Length = 159

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 53/163 (32%), Positives = 94/163 (57%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KA+Y G+FDPIT GH D++ +A    + +V+AI  +S K   F +++ER E+ ++ + 
Sbjct: 1   MDKAIYPGTFDPITRGHEDLVRRASRLFDQIVVAIAVSSSKKPFF-TLEERVEMAREVLS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V++F GL +N  +   +++IVRGLR  +DF+YE +M  +NR L P++ T
Sbjct: 60  DCSNVK-----VMAFSGLLMNFLQQQRSRIIVRGLRAASDFEYEFQMAGMNRGLYPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + +   E   +V++T++R + S+  +  +FV   V   L   +
Sbjct: 115 LFMTPSEQYMFVSATIVREIASLGGNADTFVHPLVAKKLSEKL 157


>gi|238916966|ref|YP_002930483.1| pantetheine-phosphate adenylyltransferase [Eubacterium eligens ATCC
           27750]
 gi|259491311|sp|C4Z0C3|COAD_EUBE2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|238872326|gb|ACR72036.1| pantetheine-phosphate adenylyltransferase [Eubacterium eligens ATCC
           27750]
          Length = 161

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 59/163 (36%), Positives = 94/163 (57%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+KA+Y GSFDP+T GH+DII ++ S V+ L++ +  NS KT  F S++ER  ++++   
Sbjct: 1   MKKAIYPGSFDPVTLGHLDIIRRSASLVDHLIVGVLNNSTKTPLF-SVEERVNMLREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V+SF GL V+ A + +  VI+RGLR +TDF+YE+ M+  NR   P I T
Sbjct: 60  DLSNVE-----VLSFSGLLVDFAAEHNVSVIIRGLRAVTDFEYELAMSQTNRVAAPGIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           I L       Y++S++++ +     DI  FVP+ +   +    
Sbjct: 115 IFLTTSLKYAYLSSSIVKEMAMYGGDIHKFVPEEIIDRVYEKY 157


>gi|126700176|ref|YP_001089073.1| phosphopantetheine adenylyltransferase [Clostridium difficile 630]
 gi|254976147|ref|ZP_05272619.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           QCD-66c26]
 gi|255093537|ref|ZP_05323015.1| phosphopantetheine adenylyltransferase [Clostridium difficile CIP
           107932]
 gi|255101720|ref|ZP_05330697.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           QCD-63q42]
 gi|255307589|ref|ZP_05351760.1| phosphopantetheine adenylyltransferase [Clostridium difficile ATCC
           43255]
 gi|255315280|ref|ZP_05356863.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           QCD-76w55]
 gi|255517948|ref|ZP_05385624.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           QCD-97b34]
 gi|255651064|ref|ZP_05397966.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           QCD-37x79]
 gi|255656536|ref|ZP_05401945.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           QCD-23m63]
 gi|260684130|ref|YP_003215415.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           CD196]
 gi|260687789|ref|YP_003218923.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           R20291]
 gi|296450013|ref|ZP_06891777.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           NAP08]
 gi|296878394|ref|ZP_06902402.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           NAP07]
 gi|306520920|ref|ZP_07407267.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           QCD-32g58]
 gi|115251613|emb|CAJ69446.1| Phosphopantetheine adenylyltransferase (Pantetheine-phosphate
           adenylyltransferase) [Clostridium difficile]
 gi|260210293|emb|CBA64591.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           CD196]
 gi|260213806|emb|CBE05771.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           R20291]
 gi|296261283|gb|EFH08114.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           NAP08]
 gi|296430692|gb|EFH16531.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           NAP07]
          Length = 165

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 64/161 (39%), Positives = 95/161 (59%), Gaps = 6/161 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           RKA++ GSFDPITNGH+DII +A    ++L I +  N  K KG  S  ER +LI++S  H
Sbjct: 6   RKAIFAGSFDPITNGHLDIICRASKLFDELQIGVLNNPNK-KGLFSFDERVKLIEKSTSH 64

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     V++F+GL +N  ++     +VRG+R   D DYE++M  +NR L P+I TI
Sbjct: 65  LNNIK-----VVTFDGLLINYCQENGIGALVRGVRSGADVDYELQMAHMNRELNPDIETI 119

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            L +     +++S+LI+ ++  DADI + VP  V   LK  
Sbjct: 120 ILPSCTKYSFISSSLIKEVLLFDADIKNLVPKIVLEELKKK 160


>gi|256061182|ref|ZP_05451334.1| phosphopantetheine adenylyltransferase [Brucella neotomae 5K33]
 gi|261325186|ref|ZP_05964383.1| phosphopantetheine adenylyltransferase [Brucella neotomae 5K33]
 gi|261301166|gb|EEY04663.1| phosphopantetheine adenylyltransferase [Brucella neotomae 5K33]
          Length = 164

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 70/165 (42%), Positives = 101/165 (61%), Gaps = 1/165 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGH+D++  AL   + +++AIG +  K   F S  ER  LI+ S  
Sbjct: 1   MTIAIYAGSFDPVTNGHIDVLKGALRLADQVIVAIGMHPGKKPLF-SFDERVALIEASAK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   + RVSVI+F+GL ++ A+   AQ++VRGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  AVLHKDAARVSVIAFDGLVIDAARKHGAQLMVRGLRDGTDLDYEMQMAGMNGTMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A  + R +T+TL+R + S+  DI  FVP  V   L     S
Sbjct: 120 VFLPADPAVRTITTTLVRQIASMGGDIKPFVPVAVAAALNTKFKS 164


>gi|300868604|ref|ZP_07113219.1| Phosphopantetheine adenylyltransferase [Oscillatoria sp. PCC 6506]
 gi|300333410|emb|CBN58411.1| Phosphopantetheine adenylyltransferase [Oscillatoria sp. PCC 6506]
          Length = 160

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 55/164 (33%), Positives = 90/164 (54%), Gaps = 6/164 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y GSFDPIT GH+DII +     E +++A+  N  K+  F +++ER + I+ S  H 
Sbjct: 2   IAIYPGSFDPITFGHLDIIERGCKLFEQVIVAVLRNPNKSPLF-TVEERIDQIRHSTQHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    + SFEGL VN A+   A+V++RGLR +TDF+ E++M   N+ L  EI T+ 
Sbjct: 61  PNVE-----IASFEGLTVNYARIRQAKVLLRGLRVLTDFEMELQMAHTNKTLLGEIETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           L       +++S++++ +      +   VP  V V +     +L
Sbjct: 116 LATSNEYSFLSSSVVKEIARFGGSVDHLVPKHVAVDIYKCYKNL 159


>gi|40063042|gb|AAR37898.1| pantetheine-phosphate adenylyltransferase [uncultured marine
           bacterium 560]
          Length = 160

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 63/162 (38%), Positives = 100/162 (61%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+Y GSFDPITNGH+D+I +A    ++++IAI  N+ KT     I +R E +++SI
Sbjct: 1   MKTIAIYPGSFDPITNGHIDLIHRACKLFDEVIIAITQNANKTSLL-PINQRIEAVEKSI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V+SF  L V+ A+D +AQ+I+RGLR ++DF+YE +++ +N+ L   I 
Sbjct: 60  TSISN-----TRVLSFNSLLVDFARDHNAQIIIRGLRAVSDFEYEFQLSGMNKRLNHRIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           T+ +   E    ++S+L+R + S+  DI++FVP PV   L N
Sbjct: 115 TLFMTPSEEFANISSSLVREIFSLGGDISAFVPAPVEKILHN 156


>gi|172035794|ref|YP_001802295.1| coenzyme A biosynthesis protein [Cyanothece sp. ATCC 51142]
 gi|226709002|sp|B1WS35|COAD_CYAA5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|171697248|gb|ACB50229.1| coenzyme A biosynthesis protein [Cyanothece sp. ATCC 51142]
          Length = 157

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 50/159 (31%), Positives = 87/159 (54%), Gaps = 6/159 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y GSFDPIT GH+DII + +   E +++ +  N  K   F  +++R E I +   H 
Sbjct: 2   IAIYPGSFDPITLGHLDIIERGVVLFEKVIVTVMYNPNKRPLF-PVEKRIEQITKCTQHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V S++GL V+ AK   AQV++RGLR ++DF+ E++M   N+ L  ++ TI 
Sbjct: 61  PGVE-----VDSYKGLTVDYAKLRKAQVLLRGLRVLSDFEKELQMAHTNKTLAEDVQTIF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           L   +   +++S+ ++ +      ++  VP+ V   L+ 
Sbjct: 116 LATNKEYSFLSSSTVKEIAQFGGSVSHMVPENVLRDLRE 154


>gi|148976959|ref|ZP_01813614.1| phosphopantetheine adenylyltransferase [Vibrionales bacterium
           SWAT-3]
 gi|145963833|gb|EDK29093.1| phosphopantetheine adenylyltransferase [Vibrionales bacterium
           SWAT-3]
          Length = 160

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 58/163 (35%), Positives = 91/163 (55%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M    +Y G+FDP+TNGH+DII++A S  + + + +  +  K   F  + ER EL++ ++
Sbjct: 1   MTTHVIYPGTFDPVTNGHLDIIVRAASMFDHITVGVAASPSKKTMFK-LDERVELLRDAV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H    S     V  F GL V+ AK+  A V+VRGLR   DF+YE  +TS+ R L P + 
Sbjct: 60  SHLPNVS-----VEGFSGLLVDFAKEQKANVLVRGLRTTMDFEYEFGLTSMYRKLLPGLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           ++ L   E   +++ST++R +     DI+ FVP  V   +K  
Sbjct: 115 SVFLTPSEEYAFLSSTIVREVAIHGGDISQFVPQKVADEIKLK 157


>gi|282898068|ref|ZP_06306063.1| Coenzyme A biosynthesis protein [Raphidiopsis brookii D9]
 gi|281197212|gb|EFA72113.1| Coenzyme A biosynthesis protein [Raphidiopsis brookii D9]
          Length = 170

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 50/177 (28%), Positives = 89/177 (50%), Gaps = 12/177 (6%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y GSFDPIT GH+D+I +A      +++A+  N  KT  F ++++R   I  +  H 
Sbjct: 2   IAIYPGSFDPITLGHLDLIERATRLFSRVIVAVLRNPNKTPLF-TVEQRLNQISSATSHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    V SF+GL VN A+   A V++RGLR ++DF+ E++M   N+ L  ++ T+ 
Sbjct: 61  PSVE-----VDSFDGLTVNYAQMRQAGVLLRGLRAVSDFEIELQMAHTNKTLSTQVETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTI 180
           L       +++S++++ +      +   VP  + + +      +        FPN  
Sbjct: 116 LATSNEHSFLSSSVVKEIARFGGSVDHLVPPHIAMDIYQCYSQIP------QFPNIP 166


>gi|160892738|ref|ZP_02073528.1| hypothetical protein CLOL250_00269 [Clostridium sp. L2-50]
 gi|156865779|gb|EDO59210.1| hypothetical protein CLOL250_00269 [Clostridium sp. L2-50]
          Length = 161

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 92/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+T GH+D+I ++    ++++I +  N+ KT  F S++ER  ++ + + 
Sbjct: 1   MSSAIYPGSFDPVTLGHLDVIKRSAEMFDEVIIGVLNNTSKTPLF-SVKERVNMLSEVVS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    V V SF GL ++ A+    + I+RGLR +TDF+YE+++   NR + PEI T
Sbjct: 60  DIPN-----VRVESFGGLLIDFARQNGVKTIIRGLRAVTDFEYELQIAQSNRKVAPEIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L       Y++S++++       D+T FVP  V   +K     
Sbjct: 115 VFLTTSIEYAYLSSSIVKEYARYGVDVTQFVPIEVVDRIKEKYNR 159


>gi|149181730|ref|ZP_01860222.1| phosphopantetheine adenylyltransferase [Bacillus sp. SG-1]
 gi|148850578|gb|EDL64736.1| phosphopantetheine adenylyltransferase [Bacillus sp. SG-1]
          Length = 172

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 63/163 (38%), Positives = 95/163 (58%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDPIT GH+DII +     + L I +  NS K   F S++ER ELI++  
Sbjct: 13  MSSIAVCPGSFDPITYGHLDIITRGAKVFDKLYITVLNNSSKKPMF-SVEERMELIREVT 71

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     V V SF+GL ++ AK ++A  I+RGLR ++DF+YEM++TS+NR L   I 
Sbjct: 72  KDIPN-----VVVDSFQGLLMDYAKSVNANAILRGLRAVSDFEYEMQITSMNRVLDESIE 126

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           T  +       +++S++++ +   DADI+  VP PV + L+  
Sbjct: 127 TFFIMTNNQYSFLSSSIVKEVAKYDADISELVPKPVEIALQAK 169


>gi|257095541|ref|YP_003169182.1| pantetheine-phosphate adenylyltransferase [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257048065|gb|ACV37253.1| pantetheine-phosphate adenylyltransferase [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 167

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 90/167 (53%), Gaps = 6/167 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
            R A+Y G+FDP+T GH D++ +A    + L++AI  +  K   F S+ ER E+  + + 
Sbjct: 5   KRVAIYAGTFDPMTRGHEDLVRRAACLFDRLIVAIAESQPKRPFF-SLAERVEMAGEILA 63

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +         +  F GL ++      A+VI+RGLR ++DFDYE +M  +NR L PE+ T
Sbjct: 64  PYPNAE-----ICGFNGLLMDFVHAKGAKVIIRGLRAISDFDYEFQMAGMNRNLYPEVET 118

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L   E   ++++T++R +  +  D++ FV   +   L   V  + 
Sbjct: 119 VFLTPGEQYLFISATMVREIALLGGDVSKFVQPAIGGRLAKRVREIS 165


>gi|169826992|ref|YP_001697150.1| phosphopantetheine adenylyltransferase [Lysinibacillus sphaericus
           C3-41]
 gi|229500838|sp|B1HPW8|COAD_LYSSC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|168991480|gb|ACA39020.1| Phosphopantetheine adenylyltransferase [Lysinibacillus sphaericus
           C3-41]
          Length = 163

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 57/162 (35%), Positives = 91/162 (56%), Gaps = 6/162 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           + AV  GSFDP+T GH+DII +A    + + +A+  NS K   F S++ER  L+ +    
Sbjct: 4   KIAVVPGSFDPVTFGHLDIIKRAADVFDIVYVAVLNNSAKNPLF-SVEERMALMAEVTKA 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V + S  GL ++ AK+  A+ IVRGLR ++DF+YEM++TS+NR L   I T 
Sbjct: 63  LPN-----VRIESSSGLLIDYAKEKKAKAIVRGLRAVSDFEYEMQITSMNRFLDETIETF 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
            +  K    +++S++++ +    +D+   VPD V   LK   
Sbjct: 118 FIMTKNQYSFLSSSIVKEVAKYGSDVNELVPDCVVQALKEKY 159


>gi|224418121|ref|ZP_03656127.1| phosphopantetheine adenylyltransferase [Helicobacter canadensis MIT
           98-5491]
 gi|253827448|ref|ZP_04870333.1| phosphopantetheine adenylyltransferase [Helicobacter canadensis MIT
           98-5491]
 gi|313141656|ref|ZP_07803849.1| phosphopantetheine adenylyltransferase [Helicobacter canadensis MIT
           98-5491]
 gi|253510854|gb|EES89513.1| phosphopantetheine adenylyltransferase [Helicobacter canadensis MIT
           98-5491]
 gi|313130687|gb|EFR48304.1| phosphopantetheine adenylyltransferase [Helicobacter canadensis MIT
           98-5491]
          Length = 166

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 51/164 (31%), Positives = 98/164 (59%), Gaps = 2/164 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y G+FDPITNGH+D+I +A    + L+IA+  +  K   F + +ER ++++ +I
Sbjct: 1   MAKIAIYPGTFDPITNGHLDVIQRACKLFDGLIIAVAKSDSKKPLF-TQEERIKMVQFAI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +S  +SV  F  L  + A++  + +++RGLR ++DF+YE++M   N  L  ++ 
Sbjct: 60  NELGE-TSCTLSVSGFSHLVADFAREQESNILIRGLRAVSDFEYELQMGYANASLNRKLE 118

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           TI L     + +++S+++R ++  + +I+  VP  V  F++N  
Sbjct: 119 TIYLMPSLQNAFISSSVVRSILLHNGNISHLVPKSVNDFIRNHY 162


>gi|9971914|gb|AAG10476.1|AF279106_38 predicted phosphopantetheine adenylyltransferase [uncultured marine
           gamma proteobacterium EBAC31A08]
          Length = 195

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 62/160 (38%), Positives = 91/160 (56%), Gaps = 5/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDPITNGH DII +     + +V+AI  +  K   F S+++R  L +    
Sbjct: 1   MKVAIYPGSFDPITNGHTDIIDRGCGLFDKVVVAIAKSESKNPLF-SLEDRINLAQS--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +     V     L V+LAKD  A  I+RGLR ++DF+YE ++ ++NR L P I +
Sbjct: 57  -IFKGNEKVEVVGFPRKLTVDLAKDYGACAIIRGLRAVSDFEYEFQLATMNRSLAPNIES 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           I L  KES  YV+S+LI+ +  +  DI+ FV   V   L+
Sbjct: 116 IFLTPKESLIYVSSSLIKEISDLKGDISKFVHPIVEQALR 155


>gi|240947964|ref|ZP_04752390.1| phosphopantetheine adenylyltransferase [Actinobacillus minor NM305]
 gi|240297720|gb|EER48181.1| phosphopantetheine adenylyltransferase [Actinobacillus minor NM305]
          Length = 163

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 56/161 (34%), Positives = 87/161 (54%), Gaps = 7/161 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M RK +Y G+FDPIT GH+DII +A S  + +++AI  N  K   F S++ER+ L+ +S 
Sbjct: 1   MSRKVIYAGTFDPITKGHLDIIQRAASLFDQVIVAIAKNPSKQPLF-SLEERTALVSESC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRC-LCPEI 119
            H        V  + F GL  + A +  AQ ++RG+R   D +YE+++  +N       +
Sbjct: 60  LHLSN-----VQAVGFSGLLADFALEHQAQALIRGIRGSDDLEYEIQLAQLNHKLAHEHL 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
            TI        RY++ST++R +     DI+ FVP  V   L
Sbjct: 115 ETIFFPPSVELRYISSTMVREIYKHHGDISHFVPPCVLNAL 155


>gi|258543483|ref|YP_003188916.1| pantetheine-phosphate adenylyltransferase [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256634561|dbj|BAI00537.1| pantetheine-phosphate adenylyltransferase [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256637619|dbj|BAI03588.1| pantetheine-phosphate adenylyltransferase [Acetobacter pasteurianus
           IFO 3283-03]
 gi|256640671|dbj|BAI06633.1| pantetheine-phosphate adenylyltransferase [Acetobacter pasteurianus
           IFO 3283-07]
 gi|256643728|dbj|BAI09683.1| pantetheine-phosphate adenylyltransferase [Acetobacter pasteurianus
           IFO 3283-22]
 gi|256646783|dbj|BAI12731.1| pantetheine-phosphate adenylyltransferase [Acetobacter pasteurianus
           IFO 3283-26]
 gi|256649836|dbj|BAI15777.1| pantetheine-phosphate adenylyltransferase [Acetobacter pasteurianus
           IFO 3283-32]
 gi|256652824|dbj|BAI18758.1| pantetheine-phosphate adenylyltransferase [Acetobacter pasteurianus
           IFO 3283-01-42C]
 gi|256655880|dbj|BAI21807.1| pantetheine-phosphate adenylyltransferase [Acetobacter pasteurianus
           IFO 3283-12]
          Length = 179

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 90/167 (53%), Gaps = 1/167 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
            R   Y G+FDP+T GH+D+I +A   V+ LVI +  N  K    + + ER   +++++ 
Sbjct: 10  KRVGFYAGTFDPVTVGHLDVIERASRLVDRLVIGVAYNPGKNP-LMPLDERIACVEEALP 68

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               ++   + V+ F  L V   ++  A +I RGLR ++DFDYE++M+ VNR L   I +
Sbjct: 69  AIRHNTGGDIVVVPFNSLLVKAVREHGATLIFRGLRVLSDFDYEIQMSGVNRKLDAGIES 128

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + L A E +++++S L++ + S   DI+ FV       L   +    
Sbjct: 129 VFLMASEHTQFISSRLVKEIASYGGDISEFVTPGTQARLLARLADRK 175


>gi|222085991|ref|YP_002544523.1| pantetheine-phosphate adenylyltransferase [Agrobacterium
           radiobacter K84]
 gi|254763920|sp|B9JFA5|COAD_AGRRK RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|221723439|gb|ACM26595.1| pantetheine-phosphate adenylyltransferase [Agrobacterium
           radiobacter K84]
          Length = 167

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 70/168 (41%), Positives = 109/168 (64%), Gaps = 1/168 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDP+TNGH+D+++QAL+    +++AIG +  K   F S +ER+ELI +S+ 
Sbjct: 1   MTTAFYPGSFDPMTNGHLDVLVQALNVASKVIVAIGIHPGKKPLF-SFEERAELINRSLA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  +  +SV+SF+ L V+ A+   A ++VRGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  DALPKKAADISVVSFDNLVVDAARKHGASLLVRGLRDGTDLDYEMQMAGMNRQMAPDIQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + L A  +SR +T+TL+R + S+  ++++FVP  V   L   +    K
Sbjct: 120 LFLPAGTASRPITATLVRQIASMGGNVSAFVPPAVLEALTGKLKDPAK 167


>gi|154685921|ref|YP_001421082.1| phosphopantetheine adenylyltransferase [Bacillus amyloliquefaciens
           FZB42]
 gi|166216057|sp|A7Z4C5|COAD_BACA2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|154351772|gb|ABS73851.1| CoaD [Bacillus amyloliquefaciens FZB42]
          Length = 160

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 89/165 (53%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDP+T GH+DII +  +  E + + +  NS K   F +++ER EL+++  
Sbjct: 1   MASIAVCPGSFDPVTYGHLDIIRRGANVFEQVYVCVLNNSSKQPLF-TVEERCELLREVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +     V + +GL ++ AK   A+ I+RGLR ++DF+YEM+ TSVNR L   I 
Sbjct: 60  KDIPNVT-----VETSQGLLIDYAKKKRAKAIIRGLRAVSDFEYEMQGTSVNRVLDESIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T  +       +++S++++ +   +  ++ FVP  V   L     
Sbjct: 115 TFFMMTNNQYSFLSSSIVKEVAKYNGPVSEFVPPEVEQALMQKFK 159


>gi|113953655|ref|YP_730569.1| phosphopantetheine adenylyltransferase [Synechococcus sp. CC9311]
 gi|123327830|sp|Q0IAF3|COAD_SYNS3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|113881006|gb|ABI45964.1| pantetheine-phosphate adenylyltransferase [Synechococcus sp.
           CC9311]
          Length = 160

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 61/165 (36%), Positives = 93/165 (56%), Gaps = 7/165 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDP+T GH+D+I +  S   ++V+A+  N  K+  F S+ +R E I Q+  
Sbjct: 1   MR-ALYPGSFDPLTLGHLDLIERGCSLFGEVVVAVLQNPGKSPAF-SLDQRLEQITQATS 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H        V+V SF GL VN A++  AQ+I+RGLR M+DF+YE+++   NR L  E  T
Sbjct: 59  HL-----QGVTVTSFNGLTVNCAREHHAQLILRGLRAMSDFEYELQIAHTNRSLDSEFET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           I L       +++S++++ +      +   VP  V   LK    S
Sbjct: 114 IFLSTAAHYSFLSSSVVKEVARFGGRVEHMVPAVVAEDLKRFFNS 158


>gi|332187824|ref|ZP_08389558.1| pantetheine-phosphate adenylyltransferase [Sphingomonas sp. S17]
 gi|332012174|gb|EGI54245.1| pantetheine-phosphate adenylyltransferase [Sphingomonas sp. S17]
          Length = 167

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 54/170 (31%), Positives = 93/170 (54%), Gaps = 5/170 (2%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R  VY G+FDP+T GHMDII +    V+ LVI +  N  K+  F ++ ER  ++++ +
Sbjct: 1   MTRIGVYPGTFDPVTLGHMDIIRRGAKLVDRLVIGVTTNPSKSPMF-TLDERMAMVRREV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     + V++F+ L ++ A+   A+VIVRGLR + DF+YE +M  +N+ + P + 
Sbjct: 60  ADVAG----EIHVVAFDSLLMDFAEREGAKVIVRGLRAVADFEYEYQMAGMNQQINPRVE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKY 170
           T+ L A  + + + S L++ +     +I  FV   VC  +   V  + + 
Sbjct: 116 TVFLMADVALQPIASRLVKEIAMFGGNIAKFVSPAVCTDVVERVEKIGRK 165


>gi|291448057|ref|ZP_06587447.1| phosphopantetheine adenylyltransferase [Streptomyces roseosporus
           NRRL 15998]
 gi|291351004|gb|EFE77908.1| phosphopantetheine adenylyltransferase [Streptomyces roseosporus
           NRRL 15998]
          Length = 159

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 55/166 (33%), Positives = 90/166 (54%), Gaps = 7/166 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GSFDPITNGH+DII +A    + + +A+  N  K KG  ++ ER ELI++   
Sbjct: 1   MRRAVCPGSFDPITNGHLDIIGRASKLYDVVHVAVMINQSK-KGLFTVDERIELIREVTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F         V SF GL V+  +      IV+GLR ++DFDYE++M  +N  L   + T
Sbjct: 60  DFGNVE-----VESFHGLLVDFCRQREIPAIVKGLRAVSDFDYELQMAQMNNGLS-GVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + +    +  +++S+L++ + +   D++  +P  V   L   +   
Sbjct: 114 LFVPTNPTYSFLSSSLVKEVATWGGDVSHLLPPTVHEALVKRLGER 159


>gi|328885308|emb|CCA58547.1| Phosphopantetheine adenylyltransferase [Streptomyces venezuelae
           ATCC 10712]
          Length = 169

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 56/164 (34%), Positives = 89/164 (54%), Gaps = 7/164 (4%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R+AV  GSFDPITNGH+DII +A    + + +A+  N  K KG  ++ ER ELI++    
Sbjct: 12  RRAVCPGSFDPITNGHLDIIARASKLYDVVHVAVMINQSK-KGLFTVDERIELIREVTAD 70

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
           F         V SF GL V+  K      IV+GLR ++DFDYE++M  +N  L   + T+
Sbjct: 71  FGNVE-----VESFHGLLVDFCKQRDIPAIVKGLRAVSDFDYELQMAQMNNGLT-GVETL 124

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            +    +  +++S+L++ + +   D++  VP  V   L   +  
Sbjct: 125 FVPTNPTYSFLSSSLVKEVAAWGGDVSHLVPPTVLPRLTERLAR 168


>gi|78779300|ref|YP_397412.1| phosphopantetheine adenylyltransferase [Prochlorococcus marinus
           str. MIT 9312]
 gi|123554228|sp|Q31AW9|COAD_PROM9 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|78712799|gb|ABB49976.1| Phosphopantetheine adenylyltransferase [Prochlorococcus marinus
           str. MIT 9312]
          Length = 157

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 57/161 (35%), Positives = 94/161 (58%), Gaps = 7/161 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y G+FDP+TNGH+D+I +A     +LV+A+  N+ KT  F +++ R   IK S+ 
Sbjct: 1   MKI-LYPGTFDPLTNGHLDLIERAEKIFGNLVVAVLENTSKTPTF-NLERRIIQIKYSLS 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          +IS+ GL V+ A D+ A +I+RGLR M+DF+YE+++   N+ L  +I T
Sbjct: 59  HLPNIE-----IISYSGLTVDCANDLKANLILRGLRAMSDFEYELQIAHTNKSLNNDIET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           I L    +  +++S+L++ +     +I   VP  V   LK 
Sbjct: 114 IFLSTNTNYSFLSSSLVKEVAKFGGEINHMVPPSVEKDLKE 154


>gi|326790888|ref|YP_004308709.1| phosphopantetheine adenylyltransferase [Clostridium lentocellum DSM
           5427]
 gi|326541652|gb|ADZ83511.1| Phosphopantetheine adenylyltransferase [Clostridium lentocellum DSM
           5427]
          Length = 162

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 59/160 (36%), Positives = 92/160 (57%), Gaps = 5/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y GSFDP+TNGH+DII +A   V++L++A+  N  K  G LS++ER  ++K++  
Sbjct: 1   MNRGIYPGSFDPMTNGHLDIITRAAKIVDELIVAVLLNPKKGTGLLSVEERIAVMKEATK 60

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          + SF GL V+ A    A+VI+RGLR+ +DF+ EM M  +N  L   + T
Sbjct: 61  HLENVK-----IDSFSGLLVDFAHQKQARVIIRGLRNGSDFEQEMNMAQINSSLLKGLET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L       Y++ST +R ++    +  +FVP  V   LK
Sbjct: 116 VFLMTAPEHAYMSSTAVREIVCFGGEYEAFVPPAVADKLK 155


>gi|330430828|gb|AEC22162.1| phosphopantetheine adenylyltransferase [Pusillimonas sp. T7-7]
          Length = 168

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 51/174 (29%), Positives = 98/174 (56%), Gaps = 8/174 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A    + +V+ +  +  K   F ++ ER E+ ++ + 
Sbjct: 1   MITAVYPGTFDPLTRGHEDLVRRAAGLFDHVVVGVAHSHAKKPFF-TVDERVEIAQEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+         V SF GL  +  ++ + +VIVRGLR ++DF+YE +M  +NR L PE+ T
Sbjct: 60  HYSNVE-----VKSFAGLLKDFVREQNGRVIVRGLRAVSDFEYEFQMAGMNRHLLPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKL 175
           + +   +  ++++ T++R +  +  D++ FV   V  +L +   + ++ D  + 
Sbjct: 115 LFMTPSDQYQFISGTIVREIAILGGDVSKFVFPSVERWLHSK--AKIRRDEQEQ 166


>gi|82703847|ref|YP_413413.1| coenzyme A biosynthesis protein [Nitrosospira multiformis ATCC
           25196]
 gi|123543782|sp|Q2Y5F0|COAD_NITMU RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|82411912|gb|ABB76021.1| Phosphopantetheine adenylyltransferase [Nitrosospira multiformis
           ATCC 25196]
          Length = 165

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 55/168 (32%), Positives = 94/168 (55%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KA+Y G+FDPIT GH D++ +A     ++V+A+  +S K   F + +ER  +++Q + 
Sbjct: 1   MDKAIYPGTFDPITRGHEDLVRRASGLFREVVVAVAASSGKKPFF-TQEERVAMVRQVLT 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +         V+ F GL +  A+   A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  DYPNVK-----VMPFSGLLMEFAQQQQARVIVRGLRAVSDFEYEFQMAGMNRTLYPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + L   E   ++++T++R +     +I  FV   +   L   + S  K
Sbjct: 115 LFLTPSEQYMFISATIVREIALFGGNIEKFVHPLISTQLGMKIASKDK 162


>gi|315648196|ref|ZP_07901297.1| pantetheine-phosphate adenylyltransferase [Paenibacillus vortex
           V453]
 gi|315276842|gb|EFU40185.1| pantetheine-phosphate adenylyltransferase [Paenibacillus vortex
           V453]
          Length = 171

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 57/163 (34%), Positives = 90/163 (55%), Gaps = 6/163 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY GSFDP+T GHMDII +A    + L++ +  N  K   F +++ER+EL++Q+  H
Sbjct: 10  RVAVYPGSFDPVTMGHMDIITRASKQFDLLIVGVLNNLSKNPLF-TVEERTELLRQATKH 68

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                     + SF  L  N  +  +AQVIVRG+R +TDF+YE+++ S N  L P+  TI
Sbjct: 69  LPNVE-----IDSFRDLLANYIRQKNAQVIVRGIRTVTDFEYELQLASTNHKLNPDAETI 123

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
            +       +++S+L++ +   + D T  V   V   L+    
Sbjct: 124 FMMTHPKYSFLSSSLVKEIAHFNGDTTDLVSREVDAALRRKFS 166


>gi|325661178|ref|ZP_08149805.1| phosphopantetheine adenylyltransferase [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|331085067|ref|ZP_08334154.1| phosphopantetheine adenylyltransferase [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|325472685|gb|EGC75896.1| phosphopantetheine adenylyltransferase [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|330408767|gb|EGG88232.1| phosphopantetheine adenylyltransferase [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 163

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 59/168 (35%), Positives = 100/168 (59%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A+Y GSFDP+T GH+D+I ++    ++L++ +  N  KT  F S++ER  ++++   
Sbjct: 1   MLRAIYPGSFDPVTFGHLDMIRRSGQIADELIVGVLNNKAKTPLF-SVEERVRILEEVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V++F+GL V  AK I A+VIVRGLR +TDF+YE++M+  N  L PEI T
Sbjct: 60  DLPNVK-----VMAFDGLLVEFAKQIGAKVIVRGLRAITDFEYELQMSQTNHKLEPEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + L       +++ST ++ + +   DIT FVP+ V   ++  + +  +
Sbjct: 115 MFLTTSLEYSFLSSTTVKEVAAFGGDITQFVPELVVDKIEEKMKTKRR 162


>gi|298490253|ref|YP_003720430.1| pantetheine-phosphate adenylyltransferase ['Nostoc azollae' 0708]
 gi|298232171|gb|ADI63307.1| pantetheine-phosphate adenylyltransferase ['Nostoc azollae' 0708]
          Length = 183

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 50/163 (30%), Positives = 88/163 (53%), Gaps = 6/163 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y GSFDPIT GH+DII +     + +V+A+  N  K   F ++Q+R E I+ +  H 
Sbjct: 2   IAIYPGSFDPITLGHLDIIQRGSRLFDGVVVAVLRNPNKKPLF-TVQQRLEQIRLATKHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               ++     SF+GL VN A+   AQV++RGLR ++DF+ E++M   N+ L  +I T+ 
Sbjct: 61  PNVEAD-----SFDGLTVNYAQMRQAQVLLRGLRAVSDFEIELQMAHTNKTLSTQIETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           L       +++S++++ +      +   VP  + + +      
Sbjct: 116 LATSNEYSFLSSSVVKEIAKFGGSVNHLVPPHIAIDIYKCYNQ 158


>gi|148242295|ref|YP_001227452.1| phosphopantetheine adenylyltransferase [Synechococcus sp. RCC307]
 gi|166216614|sp|A5GT90|COAD_SYNR3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|147850605|emb|CAK28099.1| Phosphopantetheine adenylyltransferase [Synechococcus sp. RCC307]
          Length = 166

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 53/167 (31%), Positives = 96/167 (57%), Gaps = 7/167 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDP+T GH+D+I +A    +++++A+  N  K   F S++ER E +     
Sbjct: 1   MR-ALYPGSFDPVTFGHLDLIQRASQLFDEVIVAVLRNPNKQPSF-SLEERLEQLSSVTS 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H       +V V SFEGL V+ A +  A+VI+RGLR ++DF++E+++   N  L  ++ T
Sbjct: 59  HLP-----QVRVTSFEGLTVHFALEQDARVILRGLRALSDFEFELQLAHTNASLSGQVDT 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + +       +++S++++ +     D+   VP+ V + L+ +    V
Sbjct: 114 LFMATAVPHSFLSSSVVKEVARFGGDVQHLVPETVAIDLRRLFNQRV 160


>gi|182415453|ref|YP_001820519.1| pantetheine-phosphate adenylyltransferase [Opitutus terrae PB90-1]
 gi|226706701|sp|B1ZWG7|COAD_OPITP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|177842667|gb|ACB76919.1| pantetheine-phosphate adenylyltransferase [Opitutus terrae PB90-1]
          Length = 160

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 51/163 (31%), Positives = 84/163 (51%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T GH+D++ +A+   + + +A+  N+ K   F S Q      + ++ 
Sbjct: 1   MRHCIYPGTFDPVTYGHLDVLARAVKLFDHVTVAVAENTPKGPLFTSAQ------RIAML 54

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    VSV SF  L V  A    A  ++RGLR  +DF++E  M  +NR L  +I T
Sbjct: 55  QPNVTRFPNVSVTSFNSLLVEFAMAQKAIAVIRGLRAFSDFEFEFHMALMNRHLESQIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           I +   E   Y +S+L++ +     D++ FVP  V   L+ + 
Sbjct: 115 IFVMPNEQFSYTSSSLVKDVAKHGGDVSHFVPPNVAAALEAVF 157


>gi|220933485|ref|YP_002512384.1| pantetheine-phosphate adenylyltransferase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|254764184|sp|B8GUN6|COAD_THISH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|219994795|gb|ACL71397.1| pantetheine-phosphate adenylyltransferase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 159

 Score =  154 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 56/164 (34%), Positives = 88/164 (53%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AVY G+FDPITNGH DI+ +A    + +V+A+  +  K   F   +      +  +
Sbjct: 1   MQVIAVYPGTFDPITNGHTDIVRRATRLFDRVVVAVAASPAKQPFFNLDE------RVGL 54

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     V V  F GL     ++  AQVI+RGLR ++DF++E ++  +NR L PE+ 
Sbjct: 55  ARDALSGLGNVEVTGFSGLLAKFMREQQAQVILRGLRAVSDFEHEFQLAGMNRHLAPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           T+ L   E   YV+S+L+R + ++  D++ FV  PV   LK  +
Sbjct: 115 TLFLTPAEEFAYVSSSLVREIAALGGDVSHFVSGPVVAALKARM 158


>gi|159027223|emb|CAO89318.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 157

 Score =  154 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 48/157 (30%), Positives = 87/157 (55%), Gaps = 6/157 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            A+Y GSFDP+T GH+DII +++   E +++A+ CN  K   F ++++R E I     H 
Sbjct: 2   IAIYPGSFDPVTLGHLDIIERSVPLFERVIVAVLCNPHKNPLF-TVEQRIEQISYCTKHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                    + SF GL V  A+   A+V++RGLR ++DF+ E++M   N+ L   I T+ 
Sbjct: 61  KNVE-----IDSFSGLTVEYARLKGAKVLLRGLRVLSDFEKELQMAHTNKTLWEGIETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           L   +   +++S++++ +      ++  VP+ V   +
Sbjct: 116 LATTKEYSFLSSSVVKEIAQFGGSVSHLVPENVSRDI 152


>gi|253577773|ref|ZP_04855045.1| pantetheine-phosphate adenylyltransferase [Ruminococcus sp.
           5_1_39B_FAA]
 gi|251850091|gb|EES78049.1| pantetheine-phosphate adenylyltransferase [Ruminococcus sp.
           5_1_39BFAA]
          Length = 164

 Score =  154 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 57/164 (34%), Positives = 95/164 (57%), Gaps = 6/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDP T GH+D+I +A    + +++ +  NS K+  F S+QER  +++++  
Sbjct: 1   MKIAVYPGSFDPATYGHLDVIRRAAVSFDKVIVGVLHNSSKSPLF-SVQERVNILEKATR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V  FEGL+VN A++  AQVI+RGLR +TDF+YE++M   NR L P++ T
Sbjct: 60  DVPNVE-----VKPFEGLSVNFARENHAQVIIRGLRAVTDFEYELQMAQTNRVLAPDVDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L       Y++ST+++ +     D++ F P  +   +   + 
Sbjct: 115 VFLTTSLEYAYLSSTILKEVAHFGGDLSKFAPAEITDAVIEKIR 158


>gi|92117311|ref|YP_577040.1| phosphopantetheine adenylyltransferase [Nitrobacter hamburgensis
           X14]
 gi|122417963|sp|Q1QMG7|COAD_NITHX RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|91800205|gb|ABE62580.1| Coenzyme A biosynthesis protein [Nitrobacter hamburgensis X14]
          Length = 165

 Score =  154 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 93/165 (56%), Gaps = 1/165 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++  A+   + L++AIG +  KT  F + + R  +++   
Sbjct: 1   MSRVALYPGSFDPVTNGHVDVVRHAVVLCDQLIVAIGVHPGKTPLFPAGE-RLAMVRSVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +       +++ L V  A+   A +++RGLRD TD DYEM++  +N  + P + 
Sbjct: 60  APVAEKAGCAFDCTTYDDLTVAAAQKAGATILIRGLRDGTDLDYEMQIAGMNETMAPGVH 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           T+ + A    R +T+TL+R + ++  D+++FVP  V   LK    
Sbjct: 120 TVFVPASPGVRPITATLVRQIAAMGGDVSAFVPQSVASSLKTKFA 164


>gi|315500083|ref|YP_004088886.1| pantetheine-phosphate adenylyltransferase [Asticcacaulis
           excentricus CB 48]
 gi|315418095|gb|ADU14735.1| pantetheine-phosphate adenylyltransferase [Asticcacaulis
           excentricus CB 48]
          Length = 163

 Score =  154 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 58/165 (35%), Positives = 94/165 (56%), Gaps = 5/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
            R  +Y G+FDPITNGH DII +A+  V+ LVI +  N+ K   F ++ ER E++++S  
Sbjct: 3   KRIGLYPGTFDPITNGHSDIIGRAVKLVDHLVIGVARNTGKAPVF-TLDERVEMLRESCA 61

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F         V+ F+ L ++ A+++ A VI+RGLR + DF+YE +MT++N+ +  EI T
Sbjct: 62  PFADRVE----VLPFDSLLMHFAEELGASVIIRGLRAVADFEYEFQMTAMNQQMNREIET 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L A    + + S L++ +  +  +I  FV   V   L   V  
Sbjct: 118 VFLMADPRHQAIASRLVKEIAQLGGNIAPFVSKSVAERLLAKVGK 162


>gi|182435705|ref|YP_001823424.1| phosphopantetheine adenylyltransferase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|229541062|sp|B1VYY6|COAD_STRGG RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|178464221|dbj|BAG18741.1| putative pantetheine-phosphate adenylyltransferase [Streptomyces
           griseus subsp. griseus NBRC 13350]
          Length = 159

 Score =  154 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 56/166 (33%), Positives = 90/166 (54%), Gaps = 7/166 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GSFDPITNGH+DII +A    + + +A+  N  K KG  ++ ER ELI++   
Sbjct: 1   MRRAVCPGSFDPITNGHLDIIGRASKLYDVVHVAVMINQSK-KGLFTVDERIELIREVTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F         V SF GL V+  K      IV+GLR ++DFDYE++M  +N  L   + T
Sbjct: 60  DFGNVE-----VESFHGLLVDFCKQREIPAIVKGLRAVSDFDYELQMAQMNNGLS-GVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + +    +  +++S+L++ + +   D++  +P  V   L   +   
Sbjct: 114 LFVPTNPTYSFLSSSLVKEVATWGGDVSHLLPPTVHEALVKRLGER 159


>gi|148360797|ref|YP_001252004.1| phosphopantetheine adenylyltransferase [Legionella pneumophila str.
           Corby]
 gi|166216557|sp|A5IH08|COAD_LEGPC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|148282570|gb|ABQ56658.1| phosphopantetheine adenylyltransferase [Legionella pneumophila str.
           Corby]
          Length = 163

 Score =  154 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 54/163 (33%), Positives = 94/163 (57%), Gaps = 6/163 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KA+Y G+FDP T  H+DII +A +   +L++A+  N  K   F+  + R+ L+++S+
Sbjct: 1   MKQKAIYPGTFDPCTKWHIDIITRASTIFPELIVAVASNKNKAAYFI-WESRNSLLEESV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H             F+ L  +   + +A +I+RGLR ++DF+YE ++  +NR L  ++ 
Sbjct: 60  GHLTGVRGV-----GFDNLLNDFVLEQNAGIILRGLRAVSDFEYEFQLAGMNRKLSKKVE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           T+ L   E   Y++STL+R + +++ DI+ FVP  V   LK  
Sbjct: 115 TLFLTPAEHLMYISSTLVREIAALNGDISQFVPPNVVRELKKR 157


>gi|225027128|ref|ZP_03716320.1| hypothetical protein EUBHAL_01384 [Eubacterium hallii DSM 3353]
 gi|224955592|gb|EEG36801.1| hypothetical protein EUBHAL_01384 [Eubacterium hallii DSM 3353]
          Length = 160

 Score =  154 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 62/165 (37%), Positives = 91/165 (55%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDPIT GH+DII +  +  + ++I +  N  K   F SI+ER ELIK+   
Sbjct: 1   MATAVYPGSFDPITLGHLDIIKRTAAVFDKVIIGVLINKAKKPLF-SIEERVELIKEVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           +          ++SF GL +  +  + A VIVRG+R ++DF+YE+ M   N+ L P I T
Sbjct: 60  NIPNVE-----IVSFNGLLIEFSDKMKADVIVRGIRAVSDFEYELMMAQTNKQLNPNIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           +         +V+S++IR L + D DIT FVP+ V   +      
Sbjct: 115 MFFATSAEYSFVSSSMIRELAAFDGDITPFVPEEVSKRVYEKYKQ 159


>gi|193212899|ref|YP_001998852.1| phosphopantetheine adenylyltransferase [Chlorobaculum parvum NCIB
           8327]
 gi|229488129|sp|B3QNZ9|COAD_CHLP8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|193086376|gb|ACF11652.1| pantetheine-phosphate adenylyltransferase [Chlorobaculum parvum
           NCIB 8327]
          Length = 166

 Score =  154 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 58/168 (34%), Positives = 91/168 (54%), Gaps = 5/168 (2%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M RKA+Y G+FDP TNGH+D++ +AL+  + + + +  NS K   F S+ ER E++ + +
Sbjct: 1   MTRKAIYPGTFDPFTNGHLDVLERALNIFDHVEVVLAENSQKQTLF-SVDERLEMVHEVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F   S + +      GL  + A+   A  IVRG+R + DF+YE +M+ +NR L PE+ 
Sbjct: 60  REFSNVSVDVLH----AGLLADYARQAGASAIVRGVRQVKDFEYEFQMSLLNRHLYPEVT 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           T+ L       YV ST+IR +  +  D++ FV   V   L        
Sbjct: 116 TVFLMPNVKYTYVASTIIREVSMLGGDVSKFVHPFVLDKLNAKRAERE 163


>gi|259047459|ref|ZP_05737860.1| pantetheine-phosphate adenylyltransferase [Granulicatella adiacens
           ATCC 49175]
 gi|259035650|gb|EEW36905.1| pantetheine-phosphate adenylyltransferase [Granulicatella adiacens
           ATCC 49175]
          Length = 177

 Score =  154 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 61/164 (37%), Positives = 93/164 (56%), Gaps = 5/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRKAV  GSFDPITNGH+DII ++    +++++ +  N  K   F S+ ER  L+++ I 
Sbjct: 1   MRKAVVAGSFDPITNGHLDIIERSGELFDEVIVVLSHNVQKNYLF-SLDERKSLVEKVIE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H          V    GL V  A  + A V+VRG+R+ TDF+YE  + S NR    E+ T
Sbjct: 60  HVPN----ARVVAVSGGLTVEAAVQLGASVLVRGVRNATDFEYEATLASHNRVQNGEVET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L +KE  R+V+S++++ L     D++ FVP+ V   L+    
Sbjct: 116 VLLLSKEEYRFVSSSMMKELARFGGDVSPFVPEVVKRALEEKYK 159


>gi|194336288|ref|YP_002018082.1| pantetheine-phosphate adenylyltransferase [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|229500851|sp|B4SGQ2|COAD_PELPB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|194308765|gb|ACF43465.1| pantetheine-phosphate adenylyltransferase [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 163

 Score =  154 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 52/168 (30%), Positives = 92/168 (54%), Gaps = 5/168 (2%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KA+Y G+FDP TNGH+D++ +AL+  E++++ I  N  K   F +I+ER  + ++  
Sbjct: 1   MKQKAIYPGTFDPFTNGHLDVLERALNIFEEVIVVIAENCQKHALF-TIEEREAMTREVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             +   +   +      GL  + A+ + A+ IVRG+R + DF+YE +M+ +NR L PE+ 
Sbjct: 60  CDYPGVTVEVLH----RGLLADYARQVGARAIVRGVRQVKDFEYEFQMSLLNRQLYPEVT 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           T+ L       YV S++I+ +  +  D++ FV   V   +        
Sbjct: 116 TVFLMPNVKYTYVASSIIKEVAMLGGDVSKFVHPCVLEMMHQKREEQN 163


>gi|50085927|ref|YP_047437.1| phosphopantetheine adenylyltransferase [Acinetobacter sp. ADP1]
 gi|61211481|sp|Q6F8K0|COAD_ACIAD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|49531903|emb|CAG69615.1| phosphopantetheine adenylyltransferase [Acinetobacter sp. ADP1]
          Length = 163

 Score =  154 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 52/158 (32%), Positives = 91/158 (57%), Gaps = 6/158 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
             + +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER +L + S+ 
Sbjct: 3   KTRVIYPGTFDPITNGHVDLVTRASRMFDEVVVAIAIGHHKKPLF-SLEERVKLAQLSLS 61

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + V  + F+GL VN  ++ +A  ++RGLR ++DF+YE ++ ++NR L      
Sbjct: 62  HL-----HNVEFVGFDGLLVNFFREQNATAVLRGLRAVSDFEYEFQLANMNRQLDHHFEA 116

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVF 159
           + L   E   +++STL+R +  +  D+  FVP  V   
Sbjct: 117 VFLTPSEQYSFISSTLVREIARLRGDVAKFVPQAVVEA 154


>gi|257459646|ref|ZP_05624755.1| pantetheine-phosphate adenylyltransferase [Campylobacter gracilis
           RM3268]
 gi|257443071|gb|EEV18205.1| pantetheine-phosphate adenylyltransferase [Campylobacter gracilis
           RM3268]
          Length = 158

 Score =  154 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 93/160 (58%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           RK +Y G+FDPITNGH+D+I +AL   +++++A+  N  K   F S+Q R E+ + +   
Sbjct: 5   RKCIYPGTFDPITNGHLDVIKRALGLFDEVIVAVALNESKKPYF-SLQSRLEMARAATRG 63

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               S     V SF+ L V+ AK    + ++RGLR ++DF+YE+++   N  L  E  ++
Sbjct: 64  LRGVS-----VQSFDNLLVDFAKSCGVRFVIRGLRAVSDFEYELQIGYANASLWEEFESV 118

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L     + +++S+++R ++S   D++  VP  +  FLK 
Sbjct: 119 YLMPTLKNAFISSSIVRSVLSHGGDVSHLVPSEILEFLKK 158


>gi|257898722|ref|ZP_05678375.1| phosphopantetheine adenylyltransferase [Enterococcus faecium Com15]
 gi|257836634|gb|EEV61708.1| phosphopantetheine adenylyltransferase [Enterococcus faecium Com15]
          Length = 163

 Score =  154 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 49/159 (30%), Positives = 87/159 (54%), Gaps = 5/159 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++A++ GSFDP T GH+D + +A    +++VI +  N+ K   F   + R  LI +++ 
Sbjct: 1   MKRALFPGSFDPFTKGHLDTVERAAKLFDEVVIGVFINTSKKSLFPPEE-RMTLITKAVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H                L V  AK+I A  +VRG+R + DF+YE  +  +NR L  E+ T
Sbjct: 60  HLPNVKVMHQE----NQLTVETAKEIGADALVRGIRSIKDFEYEREIAQMNRHLNEELET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           + L AK    +V+S++++ ++    D++S++P  +   L
Sbjct: 116 VFLLAKPEYSHVSSSILKEVLHFGGDVSSYLPPVINEAL 154


>gi|331701114|ref|YP_004398073.1| phosphopantetheine adenylyltransferase [Lactobacillus buchneri NRRL
           B-30929]
 gi|329128457|gb|AEB73010.1| Phosphopantetheine adenylyltransferase [Lactobacillus buchneri NRRL
           B-30929]
          Length = 159

 Score =  154 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 56/165 (33%), Positives = 89/165 (53%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KA+Y GSFDPIT GH+D+I +A    + + +AI  N+ K   F + +ER+E  +Q++ 
Sbjct: 1   MTKALYAGSFDPITFGHIDVIKRASRIFDKVYVAISINTHKHALF-TDEERAEFARQALN 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V+  E L V LA  + A V+VRG+R  +D D EM +  +N  L  +I T
Sbjct: 60  QLPNVD-----VVVSEELTVQLAHSLGATVLVRGVRGGSDLDSEMSIAGLNEKLADDIQT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           I +    + R ++S++I+ +     D++ FVP PV   L +    
Sbjct: 115 IFIPTAANYRDLSSSMIKEIAKFHGDVSKFVPGPVAQALNDKYQQ 159


>gi|296535361|ref|ZP_06897561.1| pantetheine-phosphate adenylyltransferase [Roseomonas cervicalis
           ATCC 49957]
 gi|296264303|gb|EFH10728.1| pantetheine-phosphate adenylyltransferase [Roseomonas cervicalis
           ATCC 49957]
          Length = 183

 Score =  154 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 64/151 (42%), Positives = 94/151 (62%), Gaps = 1/151 (0%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R  VY G+FDP+TNGH+DII +A   ++ LVI +  N+ K   F  ++ER EL+K     
Sbjct: 16  RSGVYPGTFDPVTNGHIDIINRAARILDRLVIGVAMNAGKGPLF-PLEERVELVKAETDA 74

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               +   + V+ F+ L V  A+++ AQVIVRGLR +TDFDYE +M  +NR L PEI  +
Sbjct: 75  IARRTGTVIEVVPFDSLLVGFAREVGAQVIVRGLRAVTDFDYEFQMAGLNRRLDPEIELV 134

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVP 153
            L A E + +++S  ++ +  +  DITSFVP
Sbjct: 135 FLMASEGNHFISSRFVKEIARLGGDITSFVP 165


>gi|295398771|ref|ZP_06808780.1| pantetheine-phosphate adenylyltransferase [Aerococcus viridans ATCC
           11563]
 gi|294972985|gb|EFG48803.1| pantetheine-phosphate adenylyltransferase [Aerococcus viridans ATCC
           11563]
          Length = 166

 Score =  154 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 48/165 (29%), Positives = 88/165 (53%), Gaps = 5/165 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           +A+Y GSFDP+T GH+D+I +A    + + +A+  N+ KT  F   ++     + +    
Sbjct: 6   RALYAGSFDPLTMGHVDMIERAAKMFDYVYVAVATNTTKTSLFTGEEKLVLAQEATQHLD 65

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                N   +    GL VN A+++   +++RGLR+ +DF+ E  +  +N+   P+I T+ 
Sbjct: 66  -----NVEVIYLKSGLTVNFARELDCGILIRGLRNGSDFEQETNIALMNKHQAPDIETVL 120

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           L + E  R+V+S++I+ +   + DI+  VP  V   +K     L 
Sbjct: 121 LLSSEKYRFVSSSIIKEVAKFNGDISGVVPPNVNEAIKAKYAELN 165


>gi|68171712|ref|ZP_00545068.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related
           [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658395|ref|YP_507539.1| pantetheine-phosphate adenylyltransferase [Ehrlichia chaffeensis
           str. Arkansas]
 gi|67998868|gb|EAM85564.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related
           [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599852|gb|ABD45321.1| pantetheine-phosphate adenylyltransferase [Ehrlichia chaffeensis
           str. Arkansas]
          Length = 165

 Score =  154 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 64/165 (38%), Positives = 100/165 (60%), Gaps = 5/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y G+FDPIT GH+DII +A + V+ LVI +  +  K   F S + R+ELI+    
Sbjct: 1   MKIGIYPGTFDPITFGHIDIIKRAYNLVDKLVIGVARSCTKKTIF-SAEVRAELIQHE-- 57

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             I      V+ + F+GL V  AK+ +A VI+RGLR ++DFDYE +M+ VN  L  +I T
Sbjct: 58  --IKLLGMAVNTVIFDGLLVYFAKENNASVIIRGLRAVSDFDYEFQMSWVNYKLTSQIET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           I L A E +++++S+ ++ +  ++ D++ FVP  V   LKN    
Sbjct: 116 IFLPASEDTQFISSSFVKEIARLNGDVSVFVPVNVQECLKNFYQK 160


>gi|310659143|ref|YP_003936864.1| pantetheine-phosphate adenylyltransferase [Clostridium sticklandii
           DSM 519]
 gi|308825921|emb|CBH21959.1| pantetheine-phosphate adenylyltransferase [Clostridium sticklandii]
          Length = 162

 Score =  154 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 59/166 (35%), Positives = 94/166 (56%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + AVY GSFDPITNGH+D+I +A    + L++A+  N  K   F ++ ER +++K SI
Sbjct: 1   MAKIAVYPGSFDPITNGHIDVIKRASKVFDHLIVAVLVNDSKKSMF-TLDERLDILKHSI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                D+ + VS  SF GL V+  K+     IVRGLR ++DF++E++M  +NR L  E  
Sbjct: 60  -----DNLDNVSFDSFSGLLVDYCKEKQLSAIVRGLRAISDFEFELQMAQMNRQLYDETE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T+     E   Y++S+L++ +      I   +PD   + +K  +  
Sbjct: 115 TVFFTTSEQYSYLSSSLVKEVAKFGGKIDGLIPDYAIIKMKQKLSR 160


>gi|304414129|ref|ZP_07395497.1| Phosphopantetheine adenylyltransferase [Candidatus Regiella
           insecticola LSR1]
 gi|304283343|gb|EFL91739.1| Phosphopantetheine adenylyltransferase [Candidatus Regiella
           insecticola LSR1]
          Length = 158

 Score =  154 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 59/159 (37%), Positives = 97/159 (61%), Gaps = 7/159 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y G+FDPITNGH+D+I +A +  E +++AI  ++ K   F +++ER  L ++   
Sbjct: 1   MR-AIYPGTFDPITNGHLDVITRAAAMFEQIIVAIAQSAGKQPLF-TLEERVVLAEKVTA 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F         VI+F+GL VN A++  A +++RGLR + DF+YE ++  +NR L PE+ T
Sbjct: 59  TFKNVK-----VITFDGLMVNCAREKGANILIRGLRSVADFEYESQLAKMNRHLMPELET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           + L   E   +++S L++ +  +  DI SF+P  V   L
Sbjct: 114 LFLLPSEKYSFLSSALVKEVALLGGDIASFLPAAVTEAL 152


>gi|254392465|ref|ZP_05007645.1| phosphopantetheine adenylyltransferase [Streptomyces clavuligerus
           ATCC 27064]
 gi|294815346|ref|ZP_06773989.1| phosphopantetheine adenylyltransferase [Streptomyces clavuligerus
           ATCC 27064]
 gi|197706132|gb|EDY51944.1| phosphopantetheine adenylyltransferase [Streptomyces clavuligerus
           ATCC 27064]
 gi|294327945|gb|EFG09588.1| phosphopantetheine adenylyltransferase [Streptomyces clavuligerus
           ATCC 27064]
          Length = 170

 Score =  154 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 53/163 (32%), Positives = 91/163 (55%), Gaps = 7/163 (4%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R+AV  GSFDPITNGH+DII +A    +++ +A+  N  K KG  ++ ER +LI++    
Sbjct: 12  RRAVCPGSFDPITNGHLDIIARASRLYDEVYVAVMINQSK-KGLFTVDERMDLIRRVTTE 70

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
           +   +     V S  GL V+  K      IV+GLR ++DFDYE++M  +N  L   + T+
Sbjct: 71  YGNVT-----VESHHGLLVDFCKARGIPAIVKGLRAVSDFDYELQMAQMNNGLS-GVETL 124

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
            +    +  +++S+L++ + +   D++  +PD V   L   + 
Sbjct: 125 FVPTNPTYSFLSSSLVKEVAAWGGDVSHLLPDAVHRALVERLR 167


>gi|320105935|ref|YP_004181525.1| pantetheine-phosphate adenylyltransferase [Terriglobus saanensis
           SP1PR4]
 gi|319924456|gb|ADV81531.1| pantetheine-phosphate adenylyltransferase [Terriglobus saanensis
           SP1PR4]
          Length = 180

 Score =  154 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 58/164 (35%), Positives = 94/164 (57%), Gaps = 6/164 (3%)

Query: 1   MMRK-AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           M    A+Y G+FDP TNGH+D+I +    V+ LV+AI  NS K +   +  ER+ ++ + 
Sbjct: 1   MKTVKAIYPGTFDPPTNGHLDLIERGAKIVDHLVVAILRNSSKAEPLFTTAERAAMLTEC 60

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           +  F   S     V +F+GL V+ AK   A+ ++RG+R ++D++YE +M  +NR L PE+
Sbjct: 61  VKPFGNVS-----VATFDGLLVDFAKQEGARALLRGIRAISDYEYEFQMAMMNRKLAPEL 115

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            TI +   E   YV+S LI+ +  +  D+   +P  V   LK+ 
Sbjct: 116 ETIFMMPAEKYTYVSSRLIKGVYRLGGDVAELIPPLVLERLKHK 159


>gi|262172685|ref|ZP_06040363.1| phosphopantetheine adenylyltransferase [Vibrio mimicus MB-451]
 gi|261893761|gb|EEY39747.1| phosphopantetheine adenylyltransferase [Vibrio mimicus MB-451]
          Length = 164

 Score =  154 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 50/160 (31%), Positives = 86/160 (53%), Gaps = 6/160 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D++ +A    ++++IAI  +  K   F S+ ER    ++   H 
Sbjct: 8   RVIYPGTFDPITNGHLDLVERAAQMFDEVIIAIAASPSKNTMF-SLDERVRFAREVTAHL 66

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
              ++       F GL V+ A+   A V++RGLR   DF+YE  +T++ R L P + ++ 
Sbjct: 67  DNVTAK-----GFSGLLVDFAQTEKANVLIRGLRTTVDFEYEFGLTNMYRRLMPGLESVF 121

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L   E   +++ST++R +     ++  FVP  V   L   
Sbjct: 122 LTPSEEHAFISSTIVREVAIHGGNVDEFVPSIVAEALHQK 161


>gi|170748568|ref|YP_001754828.1| pantetheine-phosphate adenylyltransferase [Methylobacterium
           radiotolerans JCM 2831]
 gi|229500839|sp|B1LVR4|COAD_METRJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|170655090|gb|ACB24145.1| pantetheine-phosphate adenylyltransferase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 167

 Score =  154 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 63/168 (37%), Positives = 99/168 (58%), Gaps = 1/168 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++ QA   V+ LVIAIG +  K   F S +ER+ L+ ++ 
Sbjct: 1   MTRTALYAGSFDPVTNGHLDVVRQACRLVDRLVIAIGVHPGKAPLF-SAEERAALLTETC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     + +++F  LAV+ A+   A + +RGLRD TD DYEM++  +N  + PE+ 
Sbjct: 60  GPVAQAEGAALEIVTFNDLAVSAARRCGAAIFIRGLRDGTDLDYEMQLAGMNGAMAPEVQ 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           T+ L A   +R +T+TL+R +  +  D++ FVP  V   L+    +  
Sbjct: 120 TVFLPASTQARPITATLVRQIAGMGGDVSPFVPAAVAARLRQRFAAHS 167


>gi|188585975|ref|YP_001917520.1| Phosphopantetheine adenylyltransferase [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|229500843|sp|B2A2L7|COAD_NATTJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|179350662|gb|ACB84932.1| Phosphopantetheine adenylyltransferase [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 162

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 48/168 (28%), Positives = 88/168 (52%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y GSFDP TNGH+DII +A    + +++A+  N  K   F   + R  L   +  
Sbjct: 1   MKTVIYPGSFDPPTNGHLDIIQRAARVFDKVIVAVLNNPEKNPMFTVAERRKMLEMITKE 60

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           +        V +  F GL V+  ++    ++++GLR ++DF+ EM+M   NR L P+I T
Sbjct: 61  Y------ANVEIDDFNGLLVDYVREKQVSIVIKGLRAISDFENEMQMALTNRKLAPDIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           I +       +++S++++ +++ D  I   VP+ +  ++     S  K
Sbjct: 115 IFMMTNHKCSFLSSSVVKEVVAFDGCIEGLVPEQIQDYIIEKRNSQRK 162


>gi|225165683|ref|ZP_03727485.1| Pantetheine-phosphate adenylyltransferase [Opitutaceae bacterium
           TAV2]
 gi|224800072|gb|EEG18499.1| Pantetheine-phosphate adenylyltransferase [Opitutaceae bacterium
           TAV2]
          Length = 165

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 51/168 (30%), Positives = 88/168 (52%), Gaps = 5/168 (2%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY G+FDPIT GH+D++ +A    + + IAI  ++       S  ER EL++ +  
Sbjct: 1   MRHCVYPGTFDPITYGHLDVLARATRIFDKVTIAIANDNSAKAPLFSAAERLELLRANTR 60

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F   ++       F GL V+ A++  A  I+RGLR ++DF++E  M  +NR L P + T
Sbjct: 61  QFDNVTTAI-----FSGLLVDFAREQEACAIIRGLRALSDFEFEFNMALMNRHLEPGVET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
             +  + +  + +S+L++ +     D++ FVP  V   L+       +
Sbjct: 116 FFVMPRGAYSFTSSSLVKQVARYGGDVSHFVPPDVAAALRRAYHEGKR 163


>gi|288553185|ref|YP_003425120.1| lipopolysaccharide core biosynthesis [Bacillus pseudofirmus OF4]
 gi|288544345|gb|ADC48228.1| lipopolysaccharide core biosynthesis [Bacillus pseudofirmus OF4]
          Length = 161

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 58/166 (34%), Positives = 93/166 (56%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   AV  GSFDP+T GH+DII +     + +++A+  N  K   F S +ER +L+K+  
Sbjct: 1   MASIAVCPGSFDPVTYGHLDIITRGAKVFDQVIVAVLHNRNKQPMF-SAEERVQLLKEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V + SF GL +N  ++  A  I+RGLR ++DF+YEM+  S+N+ L PEI 
Sbjct: 60  SHL-----DNVVIDSFNGLLINYMQEKKANTIIRGLRAVSDFEYEMQAASINKKLGPEIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           T  +       Y++S++++ +   +AD++  VPD V   LK     
Sbjct: 115 TFFMMTNNHYSYLSSSIVKEVAKYEADVSDIVPDIVAEALKKKFKE 160


>gi|206900253|ref|YP_002250864.1| pantetheine-phosphate adenylyltransferase [Dictyoglomus
           thermophilum H-6-12]
 gi|226709003|sp|B5YEA6|COAD_DICT6 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|206739356|gb|ACI18414.1| pantetheine-phosphate adenylyltransferase [Dictyoglomus
           thermophilum H-6-12]
          Length = 164

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 53/168 (31%), Positives = 92/168 (54%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KAVY GSFDP+TNGH+DII +     +++++ +  N  K   F S++ER ++++ S+ 
Sbjct: 1   MIKAVYPGSFDPVTNGHIDIIQRGAKIYDEIIVLVAENISKKPLF-SLEERLDMLEHSLK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    V +  F GL V+  + I+ ++I+RGLR ++DF+YE +    N+ L P+  T
Sbjct: 60  DIPN-----VRIDHFSGLLVDYLRKINVKIIIRGLRAVSDFEYEFQQALTNKKLYPDCET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + L +     +++S++++ + S    I   VPD V   L        K
Sbjct: 115 VFLVSDLKYTFLSSSVVKEIASFGGCIKGLVPDYVAEKLYEKFGVKPK 162


>gi|153954011|ref|YP_001394776.1| hypothetical protein CKL_1386 [Clostridium kluyveri DSM 555]
 gi|219854625|ref|YP_002471747.1| hypothetical protein CKR_1282 [Clostridium kluyveri NBRC 12016]
 gi|189082562|sp|A5N7Z7|COAD_CLOK5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254763945|sp|B9E1F8|COAD_CLOK1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|146346892|gb|EDK33428.1| CoaD [Clostridium kluyveri DSM 555]
 gi|219568349|dbj|BAH06333.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 164

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 57/168 (33%), Positives = 96/168 (57%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A+Y GSFDPITNGH+DII +A    ++L++ +  N  K KG  +++ER ELI++ + 
Sbjct: 1   MSRAIYPGSFDPITNGHLDIIDRASKVFDELIVGVLVNPDK-KGLFTVEERVELIERVVK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V SF GL ++  K   +QVIV+GLR ++DF+YE +M+ +N+ L P I T
Sbjct: 60  DIPNVK-----VESFSGLLIDFMKKKQSQVIVKGLRAVSDFEYECQMSLMNKKLDPNIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + + A   + +++S+ ++ +      I   VP+ V + +        K
Sbjct: 115 VFMMASAMNSFLSSSSVKQVAMFGGCIEGLVPEEVIIDIIKKFDKAYK 162


>gi|148552952|ref|YP_001260534.1| phosphopantetheine adenylyltransferase [Sphingomonas wittichii RW1]
 gi|189082592|sp|A5V280|COAD_SPHWW RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|148498142|gb|ABQ66396.1| pantetheine-phosphate adenylyltransferase [Sphingomonas wittichii
           RW1]
          Length = 165

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 55/169 (32%), Positives = 91/169 (53%), Gaps = 6/169 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY G+FDPIT GHMDII +    V+ LVI +  N+ K+  F +++ER  ++++   
Sbjct: 1   MRTGVYPGTFDPITLGHMDIIRRGAKLVDKLVIGVTTNASKSPMF-TVEERLAMVRRETA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V++F+ L ++ A+ + A +IVRGLR + DF+YE +M  +N+ L   + T
Sbjct: 60  DLPGVE-----VVAFDSLLMDFAESMGAAIIVRGLRAVADFEYEYQMAGMNQQLNNRVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKY 170
           + L A  + + + S L++ +      I  FVP  V   +   V  + K 
Sbjct: 115 VFLMADVALQPIASRLVKEIALYGGAIDRFVPKRVVQEVVARVEKIGKK 163


>gi|296139281|ref|YP_003646524.1| pantetheine-phosphate adenylyltransferase [Tsukamurella
           paurometabola DSM 20162]
 gi|296027415|gb|ADG78185.1| pantetheine-phosphate adenylyltransferase [Tsukamurella
           paurometabola DSM 20162]
          Length = 157

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 57/164 (34%), Positives = 90/164 (54%), Gaps = 7/164 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KA   GSFDP+TNGH+DI  +A    ++LV+ +  N  K   F +I ER  LI++++ 
Sbjct: 1   MSKACCPGSFDPMTNGHLDIFRRAAKLFDELVVTVVVNPNKQGMF-TIDERIALIEENVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                S     V  +EGL V+ A+D     IV+GLR+ TDFDYE+ M  +N+ L   + T
Sbjct: 60  DLPGVS-----VERWEGLLVDYARDRGMACIVKGLRNSTDFDYELPMAGMNQHLT-GVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
             L       YV+S+L++ +  +  DI++ +P  V   ++  + 
Sbjct: 114 AFLTTSPQYSYVSSSLVKEVAKLGGDISALIPPNVQDAVRAKLS 157


>gi|103487674|ref|YP_617235.1| phosphopantetheine adenylyltransferase [Sphingopyxis alaskensis
           RB2256]
 gi|123253061|sp|Q1GR20|COAD_SPHAL RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|98977751|gb|ABF53902.1| Coenzyme A biosynthesis protein [Sphingopyxis alaskensis RB2256]
          Length = 168

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 53/173 (30%), Positives = 83/173 (47%), Gaps = 5/173 (2%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY G+FDPIT GHMDII +    V+ LVI +  N  K+  F   +  + + ++   
Sbjct: 1   MRVGVYPGTFDPITLGHMDIIRRGAKLVDRLVIGVTTNITKSPLFDDDERIAMVKREVAA 60

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    + V+ F  L ++ A+   A VIVRGLR + DF+YE +M  +N+ L   I T
Sbjct: 61  I-----EGDIQVVGFNSLLMDFAQREGATVIVRGLRAVADFEYEYQMAGMNQQLNDRIET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIK 174
           + L A    + + S L++ +     +I  FV   VC  +   +         +
Sbjct: 116 VFLMADVGLQPIASRLVKEIAIFGGEIHKFVTPAVCKAVIARIAERGLRQGER 168


>gi|313680142|ref|YP_004057881.1| phosphopantetheine adenylyltransferase [Oceanithermus profundus DSM
           14977]
 gi|313152857|gb|ADR36708.1| Phosphopantetheine adenylyltransferase [Oceanithermus profundus DSM
           14977]
          Length = 164

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 47/162 (29%), Positives = 87/162 (53%), Gaps = 4/162 (2%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            VY GSFDP TNGH+D++ +A    + + +A+  N  K   F+        I ++    +
Sbjct: 3   VVYPGSFDPFTNGHLDVVRRASRLFDKVTVAVLHNPNKLSSFMFSVGERMQIIRASVADM 62

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
            +      V +F+GL  +  +   A++IV+GLR ++D++YE++M  +NR L PE+ T+ +
Sbjct: 63  DNVE----VDAFDGLLADYMRARGARIIVKGLRAVSDYEYELQMAHLNRQLNPEVETLFI 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            A     +++S++I+ +     D++ FVP+P    L      
Sbjct: 119 LAATRWSFISSSMIKEIARHGGDVSRFVPEPTLKALNAHFGR 160


>gi|268679910|ref|YP_003304341.1| pantetheine-phosphate adenylyltransferase [Sulfurospirillum
           deleyianum DSM 6946]
 gi|268617941|gb|ACZ12306.1| pantetheine-phosphate adenylyltransferase [Sulfurospirillum
           deleyianum DSM 6946]
          Length = 160

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 54/163 (33%), Positives = 94/163 (57%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y G+FDPITNGHMD+I +A    + +++A+  +  K   F  IQ R ++++ +I 
Sbjct: 1   MRVAIYPGTFDPITNGHMDVIKRARKLFDKVLVAVALSEDKRPLF-DIQTRVKMVESAI- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    V V  F+GL VN +K    +V++RGLR ++DF++E++M   N  L  EI T
Sbjct: 59  ----CDLEGVEVEPFDGLLVNFSKSKDIRVMIRGLRAVSDFEFELQMGYANASLWSEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L     + +++S+++R +     DI   VP+ +  ++K+  
Sbjct: 115 VYLMPSLKNAFISSSVVRSIAKHGGDIAHLVPEAIQPYIKSRF 157


>gi|291544857|emb|CBL17966.1| Phosphopantetheine adenylyltransferase [Ruminococcus sp. 18P13]
          Length = 168

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 50/164 (30%), Positives = 89/164 (54%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R AV  GSFDP+T GH+DII +A    + +++ I  N+ KT  F S + R  +I++  
Sbjct: 1   MRRIAVCPGSFDPVTLGHLDIIQRASKLFDKVIVLISVNAAKTPSFSSTE-RVMMIQEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   + V +   +GL  +  +D+ A  IV+GLR ++DF+YE +M   N+ L     
Sbjct: 60  K-----DLDNVVIDILDGLLADYVRDVGAIAIVKGLRAVSDFEYEFQMALANKKLYAGAE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           T+ L     + Y++S++++ +     DI+ FVP  +   +++ +
Sbjct: 115 TVFLTTTAENMYLSSSVVKQIAYFGGDISHFVPMEILGDIQDRL 158


>gi|239618076|ref|YP_002941398.1| pantetheine-phosphate adenylyltransferase [Kosmotoga olearia TBF
           19.5.1]
 gi|259491317|sp|C5CFP6|COAD_KOSOT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|239506907|gb|ACR80394.1| pantetheine-phosphate adenylyltransferase [Kosmotoga olearia TBF
           19.5.1]
          Length = 160

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 48/164 (29%), Positives = 91/164 (55%), Gaps = 7/164 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDPIT GHMDI+ +A    +++V+ +  N  K   F +  ER  ++++++ 
Sbjct: 1   MK-AIYPGSFDPITYGHMDILKRASKIFDEVVVLVMKNINKRYFF-TFSERLSMVEKAVE 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                        S+EGL V+ A+    +++VRGLR ++DF+ E+++  +N+ +  ++ T
Sbjct: 59  -----GIQNARADSYEGLLVDYARKAGIKIVVRGLRAISDFEMEIQVAHINKAMYADLET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + L       +++S+++R   S   D++ +VP  V   LK    
Sbjct: 114 VFLMTDPKYSFLSSSIVREAASFGGDVSLWVPPYVEEALKRKFS 157


>gi|162449985|ref|YP_001612352.1| pantetheine-phosphate adenylyltransferase [Sorangium cellulosum 'So
           ce 56']
 gi|161160567|emb|CAN91872.1| Pantetheine-phosphate adenylyltransferase [Sorangium cellulosum 'So
           ce 56']
          Length = 165

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 57/170 (33%), Positives = 94/170 (55%), Gaps = 8/170 (4%)

Query: 1   MMR--KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQ 58
           M +   AVY GSFDPIT GH+D+I +A     +++IA+G +  K   F +  ER EL++Q
Sbjct: 1   MSKDLLAVYAGSFDPITFGHLDLIQRASKLFGEVIIAVGRHPTKHPLF-TYSERLELLRQ 59

Query: 59  SIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPE 118
           +             + SFEGL +   + + A+VIVRGLR  TDF+YE+++   N  + P 
Sbjct: 60  TTS-----EVTNARIDSFEGLLIQYCQRVGARVIVRGLRAATDFEYELQIAHANADMLPG 114

Query: 119 IATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLV 168
           + T+ L  +    +V+++L+R + S   D++ + P  VC  L+    +  
Sbjct: 115 VDTVFLPTRTHYGFVSASLVREIASHGGDVSHYAPAAVCDALRAKFGAAK 164


>gi|297583930|ref|YP_003699710.1| pantetheine-phosphate adenylyltransferase [Bacillus
           selenitireducens MLS10]
 gi|297142387|gb|ADH99144.1| pantetheine-phosphate adenylyltransferase [Bacillus
           selenitireducens MLS10]
          Length = 164

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 53/168 (31%), Positives = 90/168 (53%), Gaps = 6/168 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
            +  +  GSFDP+T GH+DII +A    +++++++  NS K   F S  ER  LI+++  
Sbjct: 3   KKTGIVPGSFDPVTLGHLDIIQRASGIFDEVIVSVLTNSSKKPLF-SADERVALIEEATA 61

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                      V  F+GL +  A+   AQ I++GLR ++DF+YE++M S+NR L   I T
Sbjct: 62  GMNNVK-----VDQFDGLLIEYARKKEAQAIIKGLRAVSDFEYELQMASINRKLDDHIET 116

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
             +    +  Y++S++++ L    A+    VPD V   L++      K
Sbjct: 117 FFMMTSPAYSYLSSSIVKELARFHAETKDLVPDCVEQALQHKFSQNDK 164


>gi|160897248|ref|YP_001562830.1| pantetheine-phosphate adenylyltransferase [Delftia acidovorans
           SPH-1]
 gi|160362832|gb|ABX34445.1| pantetheine-phosphate adenylyltransferase [Delftia acidovorans
           SPH-1]
          Length = 171

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 52/163 (31%), Positives = 92/163 (56%), Gaps = 6/163 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
            AVY G+FDPIT GH D++ +A      +++A+     K   F +++ER +++++++  +
Sbjct: 11  IAVYPGTFDPITLGHEDVVRRATQLFSHVIVAVAAGHHKKTMF-NLEERMQMVREAVSIY 69

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                  V V SF GL  +   +   + +VRGLR +TDFDYE ++  +NR L PE+ T+ 
Sbjct: 70  P-----HVQVESFHGLLRDFVVERGGKAMVRGLRAVTDFDYEFQLAGMNRTLMPEVETVF 124

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           L   +  ++++ST +R + ++D +I  FV   V   L   V +
Sbjct: 125 LTPSDRYQFISSTFVREIATLDGEIDKFVSPSVRTRLLQKVQA 167


>gi|260654804|ref|ZP_05860292.1| pantetheine-phosphate adenylyltransferase [Jonquetella anthropi
           E3_33 E1]
 gi|260630519|gb|EEX48713.1| pantetheine-phosphate adenylyltransferase [Jonquetella anthropi
           E3_33 E1]
          Length = 170

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 59/171 (34%), Positives = 96/171 (56%), Gaps = 6/171 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           +A+Y GSFDPITNGH+ I  +A +  E+L ++I  N  K   F SI+ER E+ ++++ H 
Sbjct: 6   RAIYPGSFDPITNGHVFIAERAAALFEELYVSILVNPQKKSAF-SIEERQEMAQEALSHL 64

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                  V V +FEGL V+  + I  +V+VRGLR ++DF+YE +M  +NR L PEI T+ 
Sbjct: 65  PN-----VRVNAFEGLLVDFMRQIQCRVVVRGLRALSDFEYEFQMAQMNRQLAPEIETLF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIK 174
           +  +    Y++S  ++ +      + + VP  V   L+   +     D  +
Sbjct: 120 IVTEARYSYLSSHAVKDVFRFGGAVQNMVPPGVYRRLRERFLPFRGTDRQE 170


>gi|269215475|ref|ZP_06159329.1| pantetheine-phosphate adenylyltransferase [Slackia exigua ATCC
           700122]
 gi|269130962|gb|EEZ62037.1| pantetheine-phosphate adenylyltransferase [Slackia exigua ATCC
           700122]
          Length = 159

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 50/164 (30%), Positives = 94/164 (57%), Gaps = 6/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++A+  G+FDPITNGH+D+I +     +++V+ +  ++ K   F +++ER  L+++S  
Sbjct: 1   MKRALVPGTFDPITNGHLDVIERTAGIFDEVVVGVAASAKKRPIF-TLEERVALVQESTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                ++       F+ L VN A+   A V+V+GLR  TDF+YE +M+++N  L  ++ T
Sbjct: 60  CLENVTAV-----GFDDLLVNFARQAGATVVVKGLRATTDFEYEFQMSAINFKLDGDVDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           + + +     +++S+++R L+    DI+S VP      LK    
Sbjct: 115 MFIMSSPDKMHLSSSIVRELMQFHGDISSMVPPCAERALKEKFS 158


>gi|218132210|ref|ZP_03461014.1| hypothetical protein BACPEC_00067 [Bacteroides pectinophilus ATCC
           43243]
 gi|217992903|gb|EEC58903.1| hypothetical protein BACPEC_00067 [Bacteroides pectinophilus ATCC
           43243]
          Length = 168

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 52/162 (32