RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780181|ref|YP_003064594.1| phosphopantetheine adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62] (182 letters) >gnl|CDD|173914 cd02163, PPAT, Phosphopantetheine adenylyltransferase. Phosphopantetheine adenylyltransferase (PPAT). PPAT is an essential enzyme in bacteria, responsible for catalyzing the rate-limiting step in coenzyme A (CoA) biosynthesis. The dinucleotide-binding fold of PPAT is homologous to class I aminoacyl-tRNA synthetases. CoA has been shown to inhibit PPAT and competes with ATP, PhP, and dPCoA. PPAT is a homohexamer in E. coli. Length = 153 Score = 175 bits (447), Expect = 5e-45 Identities = 66/159 (41%), Positives = 97/159 (61%), Gaps = 6/159 (3%) Query: 4 KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63 AVY GSFDPITNGH+DII +A +++++A+ N K K S++ER ELI+++ H Sbjct: 1 IAVYPGSFDPITNGHLDIIERASKLFDEVIVAVAVNPSK-KPLFSLEERVELIREATKHL 59 Query: 64 IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123 V V F+GL V+ A+ A VIVRGLR ++DF+YE +M +NR L PEI T+ Sbjct: 60 P-----NVEVDGFDGLLVDFARKHGANVIVRGLRAVSDFEYEFQMAGMNRKLAPEIETVF 114 Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162 L A +++S+L++ + D++ FVP V LK Sbjct: 115 LMASPEYSFISSSLVKEIARFGGDVSGFVPPVVAKALKE 153 >gnl|CDD|31013 COG0669, CoaD, Phosphopantetheine adenylyltransferase [Coenzyme metabolism]. Length = 159 Score = 169 bits (431), Expect = 3e-43 Identities = 66/162 (40%), Positives = 104/162 (64%), Gaps = 6/162 (3%) Query: 1 MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60 MM+ AVY GSFDPITNGH+DII +A + +++++A+ N K K S++ER ELI+++ Sbjct: 1 MMKIAVYPGSFDPITNGHLDIIKRASALFDEVIVAVAINPSK-KPLFSLEERVELIREAT 59 Query: 61 FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120 H V V+ F GL V+ AK + A V+VRGLR ++DF+YE++M +NR L PE+ Sbjct: 60 KHL-----PNVEVVGFSGLLVDYAKKLGATVLVRGLRAVSDFEYELQMAHMNRKLAPEVE 114 Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162 T+ L +++S+L+R + + D++ FVP+ V L+ Sbjct: 115 TVFLMPSPEYSFISSSLVREIAAFGGDVSEFVPEAVARALRA 156 >gnl|CDD|144891 pfam01467, CTP_transf_2, Cytidylyltransferase. This family includes: Cholinephosphate cytidylyltransferase. Glycerol-3-phosphate cytidylyltransferase. Length = 148 Score = 64.4 bits (157), Expect = 2e-11 Identities = 33/112 (29%), Positives = 55/112 (49%), Gaps = 9/112 (8%) Query: 6 VYTGSFDPITNGHMDIIIQALS-FVEDLVIAI-GCNSVK--TKGFLSIQERSELIKQSIF 61 ++ G+FDPI GH+ ++ QA F D ++ + S TK S +ER E+++ ++ Sbjct: 1 LFGGTFDPIHLGHLRLLEQAKELFDLDKIVGVPSDESPHKDTKNLFSAEERLEMLELAL- 59 Query: 62 HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNR 113 + + V FE L V A V +RG R +T+ E ++ VNR Sbjct: 60 ----EVDPNLEVDDFEDLDVYFIIGADALVNLRGWRGVTELLPEFQIVVVNR 107 >gnl|CDD|185678 cd02039, cytidylyltransferase_like, Cytidylyltransferase-like domain. Cytidylyltransferase-like domain. Many of these proteins are known to use CTP or ATP and release pyrophosphate. Protein families that contain at least one copy of this domain include citrate lyase ligase, pantoate-beta-alanine ligase, glycerol-3-phosphate cytidyltransferase, ADP-heptose synthase, phosphocholine cytidylyltransferase, lipopolysaccharide core biosynthesis protein KdtB, the bifunctional protein NadR, and a number whose function is unknown. Length = 143 Score = 44.7 bits (106), Expect = 1e-05 Identities = 22/109 (20%), Positives = 44/109 (40%), Gaps = 7/109 (6%) Query: 4 KAVYTGSFDPITNGHMDIIIQALS-FVEDLVIAIGCNSVK---TKGFLSIQERSELIK-- 57 + G F+P GH+ +I +AL +++++I I N K K S+ ER E++K Sbjct: 1 VGIIIGRFEPFHLGHLKLIKEALEEALDEVIIIIVSNPPKKKRNKDPFSLHERVEMLKEI 60 Query: 58 -QSIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYE 105 + +P V ++ + + + +V G + Sbjct: 61 LKDRLKVVPVDFPEVKILLAVVFILKILLKVGPDKVVVGEDFAFGKNAS 109 >gnl|CDD|31257 COG1057, NadD, Nicotinic acid mononucleotide adenylyltransferase [Coenzyme metabolism]. Length = 197 Score = 44.9 bits (106), Expect = 1e-05 Identities = 38/184 (20%), Positives = 66/184 (35%), Gaps = 28/184 (15%) Query: 1 MMRKAVYTGSFDPITNGHMDIIIQALSFVE-DLVIAIGCNS---VKTKGFLSIQERSELI 56 M + A++ GSFDP GH+ I +AL + D VI + K K S + R ++ Sbjct: 2 MKKIALFGGSFDPPHYGHLLIAEEALDQLGLDKVIFLPSPVPPHKKKKELASAEHRLAML 61 Query: 57 KQSI---------FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRG--LRDMTDF-DY 104 + +I I ++ + E L D+ I+ L + + D+ Sbjct: 62 ELAIEDNPRFEVSDREIKRGGPSYTIDTLEHLRQEYGPDVELYFIIGADNLASLPKWYDW 121 Query: 105 EMRMTSVNRCLCPEI------------ATIALFAKESSRYVTSTLIRHLISIDADITSFV 152 + + V + P + ++ST IR I A + + Sbjct: 122 DELLKLVTFVVAPRPGYGELELSLLSSGGAIILLDLPRLDISSTEIRERIRRGASVDYLL 181 Query: 153 PDPV 156 PD V Sbjct: 182 PDSV 185 >gnl|CDD|185680 cd02165, NMNAT, Nicotinamide/nicotinate mononucleotide adenylyltransferase. Nicotinamide/nicotinate mononucleotide (NMN/ NaMN)adenylyltransferase (NMNAT). NMNAT represents the primary bacterial and eukaryotic adenylyltransferases for nicotinamide-nucleotide and for the deamido form, nicotinate nucleotide. It is an indispensable enzyme in the biosynthesis of NAD(+) and NADP(+). Nicotinamide-nucleotide adenylyltransferase synthesizes NAD via the salvage pathway, while nicotinate-nucleotide adenylyltransferase synthesizes the immediate precursor of NAD via the de novo pathway. Human NMNAT displays unique dual substrate specificity toward both NMN and NaMN, and can participate in both de novo and salvage pathways of NAD synthesis. Length = 192 Score = 39.9 bits (94), Expect = 4e-04 Identities = 36/188 (19%), Positives = 65/188 (34%), Gaps = 43/188 (22%) Query: 5 AVYTGSFDPITNGHMDIIIQALSFVE-DLVIAIGC--NSVKTKGFLSIQERSELIKQSIF 61 A++ GSFDP GH+ I +AL + D V+ + K S + R E++K +I Sbjct: 2 ALFGGSFDPPHLGHLAIAEEALEELGLDRVLLLPSANPPHKPPKPASFEHRLEMLKLAI- 60 Query: 62 HFIPDSSNRVSVISFEGL------AVNLAKDISAQ--------VI-------------VR 94 + + + V E ++ +++ + +I Sbjct: 61 ----EDNPKFEVSDIEIKRDGPSYTIDTLEELRERYPNAELYFIIGSDNLIRLPKWYDWE 116 Query: 95 GLRDMTDF------DYEMRMTSVNRCLCPEIATIALFAKESSRYVTSTLIRHLISIDADI 148 L + Y + S+ + L P I L ++ST IR + I Sbjct: 117 ELLSLVHLVVAPRPGYPIEDASLEKLLLPGGRIILLDNPL--LNISSTEIRERLKNGKSI 174 Query: 149 TSFVPDPV 156 +P V Sbjct: 175 RYLLPPAV 182 >gnl|CDD|173919 cd02168, NMNAT_Nudix, Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional proteins, also containing a Nudix hydrolase domain. N-terminal NMNAT (Nicotinamide/nicotinate mononucleotide adenylyltransferase) domain of a novel bifunctional enzyme endowed with NMN adenylyltransferase and Nudix hydrolase activities. This domain is highly homologous to the archeal NMN adenyltransferase that catalyzes NAD synthesis from NMN and ATP. NMNAT is an essential enzyme in the biosynthesis of NAD(+) and NADP(+). Nicotinamide-nucleotide adenylyltransferase synthesizes NAD via the salvage pathway, while nicotinate-nucleotide adenylyltransferase synthesizes the immediate precursor of NAD via the de novo pathway. The C-terminal domain of this enzyme shares homology with the archaeal ADP-ribose pyrophosphatase, a member of the 'Nudix' hydrolase family. Length = 181 Score = 37.4 bits (87), Expect = 0.002 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Query: 5 AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGC--NSVKTKGFLSIQERSELI 56 VY G F P NGH+ +++ AL + ++I IG + K + +ER +I Sbjct: 2 LVYIGRFQPFHNGHLAVVLIALEKAKKVIILIGSARTARNIKNPWTSEEREVMI 55 >gnl|CDD|31845 COG1659, COG1659, Uncharacterized protein, linocin/CFP29 homolog [Function unknown]. Length = 267 Score = 36.9 bits (85), Expect = 0.003 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 2/100 (2%) Query: 23 IQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIPDSSNR-VSVISFEGLAV 81 + L+FVED I G ++ +G LS L IPD + +S + G+ Sbjct: 109 AKKLAFVEDRTIFEGYSAAGIEGILSASSNPALTLPEDPREIPDVIVQALSELRLAGVDG 168 Query: 82 NLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121 + ++A + + + +D Y +R +NR + +I Sbjct: 169 PYSLLLNADRYTKLVSETSDHGYPIR-EHLNRLVDGDIIW 207 >gnl|CDD|173912 cd02156, nt_trans, nucleotidyl transferase superfamily. nt_trans (nucleotidyl transferase) This superfamily includes the class I amino-acyl tRNA synthetases, pantothenate synthetase (PanC), ATP sulfurylase, and the cytidylyltransferases, all of which have a conserved dinucleotide-binding domain. Length = 105 Score = 36.7 bits (85), Expect = 0.004 Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 2/60 (3%) Query: 4 KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKT--KGFLSIQERSELIKQSIF 61 KA + G + GH +I +A + V+ I N + ++ER E I++ I Sbjct: 1 KARFPGEPGYLHIGHAKLICRAKGIADQCVVRIDDNPPVKVWQDPHELEERKESIEEDIS 60 >gnl|CDD|31256 COG1056, NadR, Nicotinamide mononucleotide adenylyltransferase [Coenzyme metabolism]. Length = 172 Score = 36.4 bits (84), Expect = 0.005 Identities = 17/37 (45%), Positives = 26/37 (70%) Query: 1 MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIG 37 M++ VY G F P+ GH+ +I +ALS V++L+I IG Sbjct: 2 RMKRGVYFGRFQPLHTGHLYVIKRALSKVDELIIVIG 38 >gnl|CDD|173917 cd02166, NMNAT_Archaea, Nicotinamide/nicotinate mononucleotide adenylyltransferase, archaeal. This family of archaeal proteins exhibits nicotinamide-nucleotide adenylyltransferase (NMNAT) activity utilizing the salvage pathway to synthesize NAD. In some cases, the enzyme was tested and found also to have the activity of nicotinate-nucleotide adenylyltransferase an enzyme of NAD de novo biosynthesis, although with a higher Km. In some archaeal species, a number of proteins which are uncharacterized with respect to activity, are also present. Length = 163 Score = 36.1 bits (84), Expect = 0.005 Identities = 43/176 (24%), Positives = 71/176 (40%), Gaps = 36/176 (20%) Query: 4 KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIG----CNSVK---TKGFLSIQERSELI 56 +A++ G F P GH+ +I L V++L+I IG ++++ T G ER +I Sbjct: 1 RALFIGRFQPFHLGHLKVIKWILEEVDELIIGIGSAQESHTLENPFTAG-----ERVLMI 55 Query: 57 KQSIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMT-DFDYEMRMTSVNRCL 115 ++++ D S R +I + N + V + +T FD + S N Sbjct: 56 RRALEEEGIDLS-RYYIIPVPDIERNS-------LWVSYVESLTPPFD---VVYSGN--- 101 Query: 116 CPEIATIALFAKESSRYV--------TSTLIRHLISIDADITSFVPDPVCVFLKNI 163 P +A + A R + T IR L+ D VP V +K I Sbjct: 102 -PLVARLFKEAGYEVRRPPMFNREEYSGTEIRRLMLGGEDWEELVPKSVAEVIKEI 156 >gnl|CDD|35535 KOG0314, KOG0314, KOG0314, Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]. Length = 448 Score = 30.8 bits (69), Expect = 0.25 Identities = 16/61 (26%), Positives = 26/61 (42%), Gaps = 2/61 (3%) Query: 59 SIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRG-LRDMTDFDYEMRMTSVNRCLCP 117 S H+ S V I F+GL + +A D+ ++IV L DFD ++ Sbjct: 3 STIHYKFRSQLNVDTIQFDGLHLIVA-DLKREIIVEDKLGKFGDFDLQIPNAQTKEHYND 61 Query: 118 E 118 + Sbjct: 62 D 62 >gnl|CDD|31222 COG1019, COG1019, Predicted nucleotidyltransferase [General function prediction only]. Length = 158 Score = 29.5 bits (66), Expect = 0.55 Identities = 10/61 (16%), Positives = 24/61 (39%), Gaps = 4/61 (6%) Query: 2 MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSV----KTKGFLSIQERSELIK 57 K G+FD + +GH ++ A + + I + + + K + + R ++ Sbjct: 5 FMKVAVGGTFDRLHDGHKKLLEVAFEIGDRVTIGLTSDELAKKKKKEKIEPYEVRLRNLR 64 Query: 58 Q 58 Sbjct: 65 N 65 >gnl|CDD|173918 cd02167, NMNAT_NadR, Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional NadR-like proteins. NMNAT domain of NadR protein. The NadR protein (NadR) is a bifunctional enzyme possessing both NMN adenylytransferase (NMNAT) and ribosylnicotinamide kinase (RNK) activities. Its function is essential for the growth and survival of H. influenzae and thus may present a new highly specific anti-infectious drug target. The N-terminal domain that hosts the NMNAT activity is closely related to archaeal NMNAT. The bound NAD at the active site of the NMNAT domain reveals several critical interactions between NAD and the protein.The NMNAT domain of hiNadR defines yet another member of the pyridine nucleotide adenylyltransferase. Length = 158 Score = 29.0 bits (65), Expect = 0.71 Identities = 13/32 (40%), Positives = 22/32 (68%) Query: 6 VYTGSFDPITNGHMDIIIQALSFVEDLVIAIG 37 + G F P+ GH+ +I +ALS V++L+I +G Sbjct: 3 IVFGKFAPLHTGHVYLIYKALSQVDELLIIVG 34 >gnl|CDD|39748 KOG4548, KOG4548, KOG4548, Mitochondrial ribosomal protein L17 [Translation, ribosomal structure and biogenesis]. Length = 263 Score = 29.2 bits (65), Expect = 0.74 Identities = 16/73 (21%), Positives = 28/73 (38%), Gaps = 9/73 (12%) Query: 46 FLSIQERSELIKQSIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVR---GLRDMTDF 102 + QE E Q+ D + F G+ N KD+ + ++ R +T+ Sbjct: 70 LKAFQEEKEKAWQAQLRKEVDEED-----EFIGITANDRKDMWKKDLLDFDLPFR-ITEA 123 Query: 103 DYEMRMTSVNRCL 115 D + S+ R L Sbjct: 124 DPKNDRKSLEREL 136 >gnl|CDD|185681 cd09286, NMNAT_Eukarya, Nicotinamide/nicotinate mononucleotide adenylyltransferase, Eukaryotic. Nicotinamide/nicotinate mononucleotide (NMN/ NaMN)adenylyltransferase (NMNAT). NMNAT represents the primary bacterial and eukaryotic adenylyltransferases for nicotinamide-nucleotide and for the deamido form, nicotinate nucleotide. It is an indispensable enzyme in the biosynthesis of NAD(+) and NADP(+). Nicotinamide-nucleotide adenylyltransferase synthesizes NAD via the salvage pathway, while nicotinate-nucleotide adenylyltransferase synthesizes the immediate precursor of NAD via the de novo pathway. Human NMNAT displays unique dual substrate specificity toward both NMN and NaMN, and can participate in both de novo and salvage pathways of NAD synthesis. This subfamily consists strictly of eukaryotic members and includes secondary structural elements not found in all NMNATs. Length = 225 Score = 28.0 bits (63), Expect = 1.5 Identities = 8/14 (57%), Positives = 11/14 (78%) Query: 6 VYTGSFDPITNGHM 19 + GSF+PITN H+ Sbjct: 4 LACGSFNPITNMHL 17 >gnl|CDD|173921 cd02170, cytidylyltransferase, cytidylyltransferase. The cytidylyltransferase family includes cholinephosphate cytidylyltransferase (CCT), glycerol-3-phosphate cytidylyltransferase, RafE and phosphoethanolamine cytidylyltransferase (ECT). All enzymes catalyze the transfer of a cytidylyl group from CTP to various substrates. Length = 136 Score = 28.0 bits (63), Expect = 1.5 Identities = 13/60 (21%), Positives = 31/60 (51%), Gaps = 4/60 (6%) Query: 2 MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAI----GCNSVKTKGFLSIQERSELIK 57 M++ G+FD I GH+ + +A + L++ + +K + L ++R+E+++ Sbjct: 1 MKRVYAAGTFDIIHPGHIRFLEEAKKLGDYLIVGVARDETVAKIKRRPILPEEQRAEVVE 60 >gnl|CDD|30932 COG0587, DnaE, DNA polymerase III, alpha subunit [DNA replication, recombination, and repair]. Length = 1139 Score = 26.0 bits (57), Expect = 6.4 Identities = 9/67 (13%), Positives = 27/67 (40%), Gaps = 2/67 (2%) Query: 49 IQERSELIKQSIFHFIPDSSNRV--SVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEM 106 I+ I +S + F + + + + +G+ + ++I + + + DF + Sbjct: 799 IEVLPPDINRSGWDFTVEEKKAIRLGLGAIKGVGEDAIEEIVEARKEKPFKSLEDFCDRI 858 Query: 107 RMTSVNR 113 +N+ Sbjct: 859 DRKGLNK 865 >gnl|CDD|146864 pfam04433, SWIRM, SWIRM domain. This SWIRM domain is a small alpha-helical domain of about 85 amino acid residues found in chromosomal proteins. It contains a helix-turn helix motif and binds to DNA. Length = 84 Score = 26.0 bits (58), Expect = 6.8 Identities = 13/65 (20%), Positives = 23/65 (35%), Gaps = 14/65 (21%) Query: 101 DFDYEMRMTSVNRCLCPEI-------------ATIALFAKESSRYVTSTLIRHLISIDAD 147 FD + + + + L PE + + +Y+T T R L+ D + Sbjct: 9 WFDLD-LLHEIEKRLLPEFFLGTPEVYLKIRNFILNEWRLNPGKYLTKTDARRLLKGDVN 67 Query: 148 ITSFV 152 S V Sbjct: 68 KVSRV 72 >gnl|CDD|133011 cd02518, GT2_SpsF, SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat. Spore coat polysaccharide biosynthesis protein F (spsF) is a glycosyltransferase implicated in the synthesis of the spore coat in a variety of bacteria challenged by stress as starvation. The spsF gene is expressed in the late stage of coat development responsible for a terminal step in coat formation that involves the glycosylation of the coat. SpsF gene mutation resulted in spores that appeared normal. But, the spores tended to aggregate and had abnormal adsorption properties, indicating a surface alteration. Length = 233 Score = 25.6 bits (57), Expect = 8.0 Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 9/55 (16%) Query: 103 DYEMRMTSVNRCLCPEI--ATIALFAKESSRYVT----STLIRHLISIDADITSF 151 D +R+T + PEI A I LF K + Y + T L D ++ + Sbjct: 89 DVVVRITGDCPLIDPEIIDAVIRLFLKSGADYTSNTLPRTYPDGL---DVEVFTR 140 >gnl|CDD|173922 cd02171, G3P_Cytidylyltransferase, glycerol-3-phosphate cytidylyltransferase. Glycerol-3-phosphate cytidylyltransferase,(CDP-glycerol pyrophosphorylase). Glycerol-3-phosphate cytidyltransferase acts in pathways of teichoic acid biosynthesis. Teichoic acids are substituted polymers, linked by phosphodiester bonds, of glycerol, ribitol, etc. An example is poly(glycerol phosphate), the major teichoic acid of the Bacillus subtilis cell wall. Most, but not all, species encoding proteins in this family are Gram-positive bacteria. A closely related protein assigned a different function experimentally is a human ethanolamine-phosphate cytidylyltransferase. Length = 129 Score = 25.5 bits (56), Expect = 8.9 Identities = 14/60 (23%), Positives = 36/60 (60%), Gaps = 4/60 (6%) Query: 2 MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGC---NSVK-TKGFLSIQERSELIK 57 M+ + G+FD + GH++++ +A + + L++A+ N+ K K + ++R+E+++ Sbjct: 1 MKVVITYGTFDLLHIGHLNLLERAKALGDKLIVAVSTDEFNAGKGKKAVIPYEQRAEILE 60 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.326 0.139 0.392 Gapped Lambda K H 0.267 0.0657 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,063,989 Number of extensions: 99578 Number of successful extensions: 314 Number of sequences better than 10.0: 1 Number of HSP's gapped: 309 Number of HSP's successfully gapped: 32 Length of query: 182 Length of database: 6,263,737 Length adjustment: 88 Effective length of query: 94 Effective length of database: 4,362,145 Effective search space: 410041630 Effective search space used: 410041630 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 54 (24.7 bits)