HHsearch alignment for GI: 254780183 and conserved domain: KOG1653

>KOG1653 consensus.
Probab=99.76  E-value=7e-19  Score=132.78  Aligned_cols=111  Identities=35%  Similarity=0.608  Sum_probs=97.1

Q ss_pred             CCCCEEEEEEEECCCCEEEECCCCCEEEEEEEEECCCCCC--CCCCCEEECEEEECCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             7783799996425886679869998699999983456420--26884530112430211015898772211047715999
Q gi|254780183|r    3 ASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKD--RVTNERREKTEWHSVIVFSEELCRIVEQYLRKGSKVYI   80 (159)
Q Consensus         3 ~~mN~v~l~G~l~~dPelr~~~~g~~v~~f~va~~~~~~~--~~~~~~~d~t~~~~v~~~g~~~Ae~~~~~l~KG~~V~V   80 (159)
T Consensus        53 ~~vnkv~lvG~VGqdPl~k~~rngrpVtiFsv~T~~~~k~r~~q~g~~~~~tqWHRVsVf~~~L~d~~~k~lkKGsriyv  132 (175)
T KOG1653          53 RGVNKVILVGRVGQDPLQKILRNGRPVTIFSVGTGGMFKQRLYQAGDQPQPTQWHRVSVFNEVLADYALKYLKKGSRIYV  132 (175)
T ss_pred             CCCCEEEEECCCCCCHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCEEEEEEEECCHHHHHHHHHHCCCCEEEE
T ss_conf             34116999713352368885237970899995158520145544677678540579986180688999997447977999


Q ss_pred             EECCCCCC-CCCCCCCE-EEEEEEEEEEEEECCCC
Q ss_conf             84133333-20468837-68899999776984667
Q gi|254780183|r   81 EGSLQTRK-WQDQSGNN-RYTTEIIMRSMVMLDGR  113 (159)
Q Consensus        81 ~Grl~~~~-~~~kdG~~-r~~~~V~a~~i~~l~~~  113 (159)
T Consensus       133 eG~iey~g~~~d~~g~~~r~~t~iIa~~v~Fl~~a  167 (175)
T KOG1653         133 EGKIEYRGENDDIQGNVKRIPTIIIARDVSFLIDA  167 (175)
T ss_pred             EEEEEEEEEECCCCCCEEECCEEEEECHHHHHHHH
T ss_conf             65677620003666735531337772011898887