HHsearch alignment for GI: 254780183 and conserved domain: cd03524

>cd03524 RPA2_OBF_family RPA2_OBF_family: A family of oligonucleotide binding (OB) folds with similarity to the OB fold of the single strand (ss) DNA-binding domain (DBD)-D of human RPA2 (also called RPA32). RPA2 is a subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). RPA contains six OB folds, which are involved in ssDNA binding and in trimerization. The ssDNA binding mechanism is believed to be multistep and to involve conformational change. This family also includes OB folds similar to those found in Escherichia coli SSB, the wedge domain of E. coli RecG (a branched-DNA-specific helicase), E. coli ssDNA specific exodeoxyribonuclease VII large subunit, Pyroco
Probab=92.40  E-value=0.64  Score=25.82  Aligned_cols=61  Identities=26%  Similarity=0.468  Sum_probs=43.8

Q ss_pred             EEEEECCCCEEEECCCCCEEEEEEEEECCCCCCCCCCCEEECE-EEECCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCC
Q ss_conf             9964258866798699986999999834564202688453011-243021101589877221104771599984133333
Q gi|254780183|r   10 LIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKT-EWHSVIVFSEELCRIVEQYLRKGSKVYIEGSLQTRK   88 (159)
Q Consensus        10 l~G~l~~dPelr~~~~g~~v~~f~va~~~~~~~~~~~~~~d~t-~~~~v~~~g~~~Ae~~~~~l~KG~~V~V~Grl~~~~   88 (159)
T Consensus         2 i~g~V~~~~~~~~---~~~~~~~~l~--------------D~t~~~i~v~~~~~-~~~~~~~~~~~g~~v~i~g~v~~~~   63 (75)
T cd03524           2 IVGIVVAVEEIRT---EGKVLIFTLT--------------DGTGGTIRVTLFGE-LAEELENLLKEGQVVYIKGKVKKFR   63 (75)
T ss_pred             EEEEEEEEEEEEC---CCEEEEEEEE--------------CCCCCEEEEEEEEE-HHHHHHHHHHCCCEEEEEEEEEECC
T ss_conf             7899999842003---8649999997--------------69997999999988-2576877874782999980365236