HHsearch alignment of GI: 254780183 and MMDB domain: 3lgj_A_

>3lgj_A (A:) Single-stranded DNA-binding protein; niaid, CAT scratch fever, rochalimaea, LYME disease, ALS collaborative crystallography, DNA replication; 2.50A {Bartonella henselae}
Probab=100.00  E-value=3.4e-36  Score=235.45  Aligned_cols=151  Identities=42%  Similarity=0.684  Sum_probs=123.7

Q ss_pred             CCCCCCEEEEEEEECCCCEEEECCCCCEEEEEEEEECCCCCCCCCCCEEECEEEECCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             98778379999642588667986999869999998345642026884530112430211015898772211047715999
Q gi|254780183|r    1 MVASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVFSEELCRIVEQYLRKGSKVYI   80 (159)
Q Consensus         1 mm~~mN~v~l~G~l~~dPelr~~~~g~~v~~f~va~~~~~~~~~~~~~~d~t~~~~v~~~g~~~Ae~~~~~l~KG~~V~V   80 (159)
                      |...||+|+|+|||++|||+|++++|+++++|+||++++|+++.++++++.+.||.|++|+.++|+++++||+||++|+|
T Consensus        19 m~~~mN~v~l~G~l~~dpe~r~t~~G~~~~~f~la~~~~~~~~~g~~~~~~~~~~~~~~~~~~~a~~~~~~l~KG~~V~v   98 (169)
T 3lgj_A           19 PGSMLNKVMLIGYLGDDPESKTMTSGAEVVNFRMATFESYMNKNTHQKVEKTEWHSVVVFNPHFAKIALQYLHKGSKVYI   98 (169)
T ss_dssp             -CCCEEEEEEEEEESSCCEEEECTTSCEEEEEEEEEEC------------CEEEEEEEECCHHHHHHHHHHCCTTCEEEE
T ss_pred             CCCEEEEEEEEEEECCCCEEEECCCCCEEEEEEEEEECCEECCCCCEECCCCCEEEEEEECCHHHHHHHHHCCCCCEEEE
T ss_conf             65601589999991689779987999879999999833331367763524321899986350689999986689998999


Q ss_pred             EECCCCCCCCCCCCCEEEEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             8413333320468837688999997769846677766667777777766777655666666765445677877455798
Q gi|254780183|r   81 EGSLQTRKWQDQSGNNRYTTEIIMRSMVMLDGRRDSLQGEEQRSEQHSNNLKENVVGNRYSSPREESVFSDELDDEIPF  159 (159)
Q Consensus        81 ~Grl~~~~~~~kdG~~r~~~~V~a~~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dDdiPF  159 (159)
                      +|+|+.++|+++||++++.++|+|++|.+|..+...............        ....+.+.......+..||||||
T Consensus        99 ~G~l~~~~~~~kdG~~~~~~~i~a~~i~~l~~~~~~~~~~~~~~~~~~--------~~~~~~~~~~~~~~~~~dddiPF  169 (169)
T 3lgj_A           99 EGKLQTRKWQDKNGHDRYTTEIVLPQYKGELHLLDAKKEQSASSSSVT--------SQSYAIASGADDYGISAHDSMPF  169 (169)
T ss_dssp             EEEEEEECC--------CEEEEEECTTCCEEEEECC-------------------------------------------
T ss_pred             EEEEECCEEECCCCCEEEEEEEEEEECCCCEEECCCCCCCCCCCCCCC--------CCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             999853417999997899999999823571788767776666788878--------88877677887788887789998