BLAST/PSIBLAST alignment of GI: 254780183 and GI: 49474367 at iteration 1
>gi|49474367|ref|YP_032409.1| single-strand binding protein (ssb) [Bartonella quintana str. Toulouse] Length = 172
>gi|49239871|emb|CAF26269.1| Single-strand binding protein (ssb) [Bartonella quintana str. Toulouse] Length = 172
 Score =  184 bits (468), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 128/174 (73%), Gaps = 17/174 (9%)

Query: 1   MVASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVF 60
           M  SLNKVILIGNLGADP++R    G ++ N+RIATS+SW+DR TNER+E+TEWH++++F
Sbjct: 1   MAGSLNKVILIGNLGADPEIRRLNSGDQVANLRIATSESWRDRNTNERKERTEWHNIVIF 60

Query: 61  SEELCRIVEQYLRKGSKVYIEGSLQTRKWQDQSGNNRYTTEIIMRS----MVMLDGR--- 113
           +E L ++VEQYL+KGSK+YIEG LQTRKWQDQ+GN+RYTTEI+++     + MLDGR   
Sbjct: 61  NENLVKVVEQYLKKGSKIYIEGQLQTRKWQDQNGNDRYTTEIVLQKYRGELQMLDGRGVT 120

Query: 114 -RDSLQGEEQRSEQHSNNL-------KENVVGNRYSSPREESVFSDELDDEIPF 159
             + +QG  Q S  + N+        + NV G + +S  EES FS +LDD++PF
Sbjct: 121 GGEQMQGANQSSGGYVNSGFGDSGVNQRNVFG-QNNSQSEES-FSHKLDDDVPF 172