PSIBLAST alignment of GI: 254780183 and protein with PDB id: 1qvc

>gi|8569289|pdb|1QVC|A Chain A, Crystal Structure Analysis Of Single Stranded Dna Binding Protein (Ssb) From E.Coli Length = 145
>gi|8569290|pdb|1QVC|B Chain B, Crystal Structure Analysis Of Single Stranded Dna Binding Protein (Ssb) From E.Coli Length = 145
 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 62/122 (50%), Positives = 85/122 (69%), Gaps = 4/122 (3%)

Query: 2   VASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVFS 61
              +NKVIL+GNLG DP+VR+  +G  + NI +ATS+SW+D+ T E +E+TEWH V V  
Sbjct: 2   SRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRV-VLF 60

Query: 62  EELCRIVEQYLRKGSKVYIEGSLQTRKWQDQSGNNRYTTEIIMR---SMVMLDGRRDSLQ 118
            +L  +  +YLRKGS+VYIEG L+TRKW DQSG +RYTTE+++    +M ML GR+    
Sbjct: 61  GKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGA 120

Query: 119 GE 120
             
Sbjct: 121 PA 122