RPSBLAST alignment for GI: 254780184 and conserved domain: cd03216

>gnl|CDD|72975 cd03216, ABC_Carb_Monos_I, This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos). The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. Pentoses include xylose, arabinose, and ribose. Important hexoses include glucose, galactose, and fructose. In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter.. Length = 163
 Score = 60.0 bits (146), Expect = 3e-09
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 4/71 (5%)

Query: 846 LSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRGNSIIVIE 905
           LS GE Q V++A+ L++ A    L ILDEPT  L   ++ +L  ++  L  +G ++I I 
Sbjct: 83  LSVGERQMVEIARALARNAR---LLILDEPTAALTPAEVERLFKVIRRLRAQGVAVIFIS 139

Query: 906 HNL-EVIKTAD 915
           H L EV + AD
Sbjct: 140 HRLDEVFEIAD 150