RPSBLAST alignment for GI: 254780184 and conserved domain: cd03226

>gnl|CDD|72985 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.. Length = 205
 Score = 47.2 bits (112), Expect = 2e-05
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 504 LSNGESQRIRLASQIGSALTGVLYILDEPSIGLHQRDNTKLINTLKHLRDTGNTVIVVEH 563
           LS G+ QR+ +A+ + S     L I DEP+ GL  ++  ++   ++ L   G  VIV+ H
Sbjct: 127 LSGGQKQRLAIAAALLSGKD--LLIFDEPTSGLDYKNMERVGELIRELAAQGKAVIVITH 184

Query: 564 DEETMLAADHIV 575
           D E +      V
Sbjct: 185 DYEFLAKVCDRV 196