BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780187|ref|YP_003064600.1| 30S ribosomal protein S4 [Candidatus Liberibacter asiaticus str. psy62] (206 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780187|ref|YP_003064600.1| 30S ribosomal protein S4 [Candidatus Liberibacter asiaticus str. psy62] Length = 206 Score = 424 bits (1091), Expect = e-121, Method: Compositional matrix adjust. Identities = 206/206 (100%), Positives = 206/206 (100%) Query: 1 MSKRESSKHKIDRRIGENLWGRPKSPVNTRSYGPGLHGQRRKSKPSYFGLQLRAKQKMKK 60 MSKRESSKHKIDRRIGENLWGRPKSPVNTRSYGPGLHGQRRKSKPSYFGLQLRAKQKMKK Sbjct: 1 MSKRESSKHKIDRRIGENLWGRPKSPVNTRSYGPGLHGQRRKSKPSYFGLQLRAKQKMKK 60 Query: 61 YYGDISEKKFRSIFKEADRSRGDTSHNLISFLESRLDTIVYRAKFVPTIFAARQFVNHRH 120 YYGDISEKKFRSIFKEADRSRGDTSHNLISFLESRLDTIVYRAKFVPTIFAARQFVNHRH Sbjct: 61 YYGDISEKKFRSIFKEADRSRGDTSHNLISFLESRLDTIVYRAKFVPTIFAARQFVNHRH 120 Query: 121 VLVNGRSVNIGSYRCKEGDVIEVKQKSKQLASVLEASQLAERDVPEYISVNHDNMVATFV 180 VLVNGRSVNIGSYRCKEGDVIEVKQKSKQLASVLEASQLAERDVPEYISVNHDNMVATFV Sbjct: 121 VLVNGRSVNIGSYRCKEGDVIEVKQKSKQLASVLEASQLAERDVPEYISVNHDNMVATFV 180 Query: 181 RIPSSLKDVPYPVIMQPNLVVEFYSR 206 RIPSSLKDVPYPVIMQPNLVVEFYSR Sbjct: 181 RIPSSLKDVPYPVIMQPNLVVEFYSR 206 >gi|254780579|ref|YP_003064992.1| hypothetical protein CLIBASIA_02330 [Candidatus Liberibacter asiaticus str. psy62] Length = 207 Score = 26.9 bits (58), Expect = 0.25, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 5/45 (11%) Query: 155 EASQLAERD-VPEYISVNHD-NMVATFV---RIPSSLKDVPYPVI 194 EAS AE++ + V HD +M TF+ RI S+++ +PYP+I Sbjct: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153 >gi|254780386|ref|YP_003064799.1| Type I secretion membrane fusion protein, HlyD [Candidatus Liberibacter asiaticus str. psy62] Length = 440 Score = 25.4 bits (54), Expect = 0.73, Method: Compositional matrix adjust. Identities = 11/28 (39%), Positives = 17/28 (60%) Query: 61 YYGDISEKKFRSIFKEADRSRGDTSHNL 88 +Y DI EKKF++I ++ D +NL Sbjct: 354 HYADIREKKFKAIIEKIDPIISQQDNNL 381 >gi|254781096|ref|YP_003065509.1| UDP-N-acetylmuramate--L-alanine ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 474 Score = 23.1 bits (48), Expect = 3.9, Method: Compositional matrix adjust. Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 166 EYISVNHDNMVATFVRIPSSL 186 E+I V D TF+R+PS + Sbjct: 157 EWIVVEADESDGTFIRLPSDI 177 >gi|254780462|ref|YP_003064875.1| enoyl-(acyl carrier protein) reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 267 Score = 22.7 bits (47), Expect = 4.5, Method: Compositional matrix adjust. Identities = 12/44 (27%), Positives = 21/44 (47%) Query: 143 VKQKSKQLASVLEASQLAERDVPEYISVNHDNMVATFVRIPSSL 186 + QLA + + +R P ++V+ D M+ V PSS+ Sbjct: 29 LHSAGAQLAFSYQGESIGKRLKPLALTVDSDFMIPCNVEDPSSM 72 >gi|254780704|ref|YP_003065117.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Score = 22.7 bits (47), Expect = 5.5, Method: Compositional matrix adjust. Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 23 PKSPVNTRSYGPGLHG 38 PKS + +YGP +HG Sbjct: 100 PKSIYDNVAYGPRIHG 115 >gi|254780502|ref|YP_003064915.1| ribonucleotide-diphosphate reductase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 954 Score = 21.9 bits (45), Expect = 7.2, Method: Compositional matrix adjust. Identities = 14/55 (25%), Positives = 26/55 (47%), Gaps = 5/55 (9%) Query: 157 SQLAERDVPEYISVN----HDNMVATFVRIPSSLKDVPYPVI-MQPNLVVEFYSR 206 ++L +RD+ + ++ HD + RIP LK + + P ++E SR Sbjct: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862 >gi|254781205|ref|YP_003065618.1| hypothetical protein CLIBASIA_05560 [Candidatus Liberibacter asiaticus str. psy62] Length = 171 Score = 21.9 bits (45), Expect = 7.7, Method: Compositional matrix adjust. Identities = 17/66 (25%), Positives = 28/66 (42%), Gaps = 13/66 (19%) Query: 49 GLQLRAKQKMKKYYGDISEKKFRSIFKEADRSRGDTSHNLISFL--------ESRLDTIV 100 G LR + + I + ++RS+ E + R D + +L E +DT V Sbjct: 20 GAGLRISSTLASHRSSIRDHEYRSLLAEENALRAD-----VLYLDREDQARREGIMDTGV 74 Query: 101 YRAKFV 106 +R K V Sbjct: 75 FRMKAV 80 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.134 0.384 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 124,914 Number of Sequences: 1233 Number of extensions: 4661 Number of successful extensions: 16 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 11 length of query: 206 length of database: 328,796 effective HSP length: 70 effective length of query: 136 effective length of database: 242,486 effective search space: 32978096 effective search space used: 32978096 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 36 (18.5 bits)