BLASTP 2.2.22 [Sep-27-2009]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,
Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005.
Query= gi|254780188|ref|YP_003064601.1| hypothetical protein
CLIBASIA_00355 [Candidatus Liberibacter asiaticus str. psy62]
(36 letters)
Database: nr
13,984,884 sequences; 4,792,584,752 total letters
Searching..................................................done
Results from round 1
>gi|254780188|ref|YP_003064601.1| hypothetical protein CLIBASIA_00355 [Candidatus Liberibacter
asiaticus str. psy62]
gi|254039865|gb|ACT56661.1| hypothetical protein CLIBASIA_00355 [Candidatus Liberibacter
asiaticus str. psy62]
Length = 36
Score = 73.9 bits (180), Expect = 7e-12, Method: Compositional matrix adjust.
Identities = 36/36 (100%), Positives = 36/36 (100%)
Query: 1 MYLYLDWYKTIIVSKGKVESFFIKNAFINGKMIFED 36
MYLYLDWYKTIIVSKGKVESFFIKNAFINGKMIFED
Sbjct: 1 MYLYLDWYKTIIVSKGKVESFFIKNAFINGKMIFED 36
Searching..................................................done
Results from round 2
CONVERGED!
>gi|254780188|ref|YP_003064601.1| hypothetical protein CLIBASIA_00355 [Candidatus Liberibacter
asiaticus str. psy62]
gi|254039865|gb|ACT56661.1| hypothetical protein CLIBASIA_00355 [Candidatus Liberibacter
asiaticus str. psy62]
Length = 36
Score = 58.4 bits (140), Expect = 3e-07, Method: Composition-based stats.
Identities = 36/36 (100%), Positives = 36/36 (100%)
Query: 1 MYLYLDWYKTIIVSKGKVESFFIKNAFINGKMIFED 36
MYLYLDWYKTIIVSKGKVESFFIKNAFINGKMIFED
Sbjct: 1 MYLYLDWYKTIIVSKGKVESFFIKNAFINGKMIFED 36
Database: nr
Posted date: May 13, 2011 4:10 AM
Number of letters in database: 999,999,932
Number of sequences in database: 2,987,209
Database: /data/usr2/db/fasta/nr.01
Posted date: May 13, 2011 4:17 AM
Number of letters in database: 999,998,956
Number of sequences in database: 2,896,973
Database: /data/usr2/db/fasta/nr.02
Posted date: May 13, 2011 4:23 AM
Number of letters in database: 999,999,979
Number of sequences in database: 2,907,862
Database: /data/usr2/db/fasta/nr.03
Posted date: May 13, 2011 4:29 AM
Number of letters in database: 999,999,513
Number of sequences in database: 2,932,190
Database: /data/usr2/db/fasta/nr.04
Posted date: May 13, 2011 4:33 AM
Number of letters in database: 792,586,372
Number of sequences in database: 2,260,650
Lambda K H
0.329 0.145 0.446
Lambda K H
0.267 0.0475 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 768,850,435
Number of Sequences: 13984884
Number of extensions: 19290483
Number of successful extensions: 52406
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 52404
Number of HSP's gapped (non-prelim): 2
length of query: 36
length of database: 4,792,584,752
effective HSP length: 10
effective length of query: 26
effective length of database: 4,652,735,912
effective search space: 120971133712
effective search space used: 120971133712
T: 11
A: 40
X1: 16 ( 7.6 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 76 (33.7 bits)