Query         gi|254780189|ref|YP_003064602.1| hypothetical protein CLIBASIA_00370 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 54
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 23785
Date          Mon May 23 09:40:07 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780189.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3l49_A ABC sugar (ribose) tran   8.5      61  0.0025   14.5  -0.0   34    7-40      2-35  (291)
  2 2kw6_A Cyclin-dependent kinase   2.4 2.1E+02  0.0086   12.1  -0.9   16   15-30      3-18  (65)
  3 3da0_A Cleaved chimeric recept   2.1 3.5E+02   0.015   11.0   0.0   12    2-13      6-17  (136)
  4 3h4p_A Proteasome subunit alph   2.1 3.5E+02   0.015   11.0   0.0   12   16-27      3-14  (264)
  5 2ovc_A Potassium voltage-gated   2.1   3E+02   0.013   11.3  -0.4   11   25-35      9-19  (33)
  6 3d0j_A Uncharacterized protein   2.0 2.1E+02  0.0088   12.0  -1.3   16   12-27     33-52  (140)
  7 1s1i_Y L35, YP55, 60S ribosoma   2.0 2.9E+02   0.012   11.3  -0.5   23   24-46     45-67  (87)
  8 2zkr_2 60S ribosomal protein L   1.9 3.2E+02   0.013   11.2  -0.5   24   23-46     45-68  (97)
  9 1r4v_A Hypothetical protein AQ   1.6   5E+02   0.021   10.3   0.3   31   17-48     53-83  (171)
 10 2jss_A Chimera of histone H2B.   1.6   5E+02   0.021   10.2   2.5   28   25-52     38-65  (192)

No 1  
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides}
Probab=8.54  E-value=61  Score=14.53  Aligned_cols=34  Identities=29%  Similarity=0.266  Sum_probs=19.7

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             2112332123456666667888777654211104
Q gi|254780189|r    7 SIEGKKIGHSMSMQRHSKYDKLCKAERRATTNQG   40 (54)
Q Consensus         7 siegkkighsmsmqrhskydklckaerrattnqg   40 (54)
                      |.+||+||-.+....+.-|..+.++-..+....|
T Consensus         2 s~~gk~Ig~i~~~~~~~f~~~~~~g~~~~a~~~G   35 (291)
T 3l49_A            2 SLEGKTIGITAIGTDHDWDLKAYQAQIAEIERLG   35 (291)
T ss_dssp             CCTTCEEEEEESCCSSHHHHHHHHHHHHHHHHTT
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHCC
T ss_conf             9889999999589998899999999999999749


No 2  
>2kw6_A Cyclin-dependent kinase 2-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens}
Probab=2.37  E-value=2.1e+02  Score=12.06  Aligned_cols=16  Identities=38%  Similarity=0.546  Sum_probs=9.0

Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             2345666666788877
Q gi|254780189|r   15 HSMSMQRHSKYDKLCK   30 (54)
Q Consensus        15 hsmsmqrhskydklck   30 (54)
                      |...-+-.|||..|-.
T Consensus         3 ~~~~~~sqsKY~~LL~   18 (65)
T 2kw6_A            3 HHHHHHSHSKYAELLA   18 (65)
T ss_dssp             CCCCCCCSCHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHH
T ss_conf             5301002878999999


No 3  
>3da0_A Cleaved chimeric receptor binding protein from bacteriophages TP901-1 and P2; lactococcal phage P2; 1.65A {Lactococcus phage tp901-1}
Probab=2.14  E-value=3.5e+02  Score=11.00  Aligned_cols=12  Identities=50%  Similarity=0.817  Sum_probs=7.5

Q ss_pred             CCCCCCCCHHHH
Q ss_conf             863212112332
Q gi|254780189|r    2 KSSDQSIEGKKI   13 (54)
Q Consensus         2 kssdqsiegkki   13 (54)
                      |+-|.||.|||+
T Consensus         6 ~t~~esi~~~~~   17 (136)
T 3da0_A            6 KTGDETIAGKKT   17 (136)
T ss_dssp             SSSCEEECSCEE
T ss_pred             ECCCCEECCCCE
T ss_conf             124000024621


No 4  
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii}
Probab=2.10  E-value=3.5e+02  Score=10.98  Aligned_cols=12  Identities=42%  Similarity=0.614  Sum_probs=5.9

Q ss_pred             HHHHHHHHHHHH
Q ss_conf             345666666788
Q gi|254780189|r   16 SMSMQRHSKYDK   27 (54)
Q Consensus        16 smsmqrhskydk   27 (54)
                      .|+|...|.||.
T Consensus         3 ~~~~~~~~~yd~   14 (264)
T 3h4p_A            3 HMQMVPPSAYDR   14 (264)
T ss_dssp             ------------
T ss_pred             CCCCCCCCCCCC
T ss_conf             665579877689


No 5  
>2ovc_A Potassium voltage-gated channel subfamily KQT member 4; potassium channel, ION channel assembly, coiled-coil, tetramer, transport protein; 2.07A {Homo sapiens}
Probab=2.07  E-value=3e+02  Score=11.28  Aligned_cols=11  Identities=18%  Similarity=0.474  Sum_probs=5.6

Q ss_pred             HHHHHHHHHHH
Q ss_conf             78887776542
Q gi|254780189|r   25 YDKLCKAERRA   35 (54)
Q Consensus        25 ydklckaerra   35 (54)
                      ....||.|+..
T Consensus         9 ~grvvkvekqv   19 (33)
T 2ovc_A            9 MGRVVKVEKQV   19 (33)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHHH
T ss_conf             98899999999


No 6  
>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824}
Probab=2.03  E-value=2.1e+02  Score=12.03  Aligned_cols=16  Identities=19%  Similarity=0.358  Sum_probs=10.6

Q ss_pred             HHHHHHH----HHHHHHHHH
Q ss_conf             3212345----666666788
Q gi|254780189|r   12 KIGHSMS----MQRHSKYDK   27 (54)
Q Consensus        12 kighsms----mqrhskydk   27 (54)
                      +-|+++|    ||||.+-|-
T Consensus        33 ~p~~~ls~~~~lQ~H~~rdE   52 (140)
T 3d0j_A           33 KPDNDIEGIAHLEIHHSTDE   52 (140)
T ss_dssp             CGGGBTTTCCEEEEESSCCE
T ss_pred             CCCCCCCCCCCCEECCCCCC
T ss_conf             88997788835235788367


No 7  
>1s1i_Y L35, YP55, 60S ribosomal protein L37-A; 80S ribosome, 60S ribosomal subunit, EEF2, tRNA translocation, sordarin, cryo-EM; 11.70A {Saccharomyces cerevisiae} SCOP: i.1.1.1
Probab=2.01  E-value=2.9e+02  Score=11.34  Aligned_cols=23  Identities=43%  Similarity=0.476  Sum_probs=15.8

Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             67888777654211104110016
Q gi|254780189|r   24 KYDKLCKAERRATTNQGRNTISK   46 (54)
Q Consensus        24 kydklckaerrattnqgrntisk   46 (54)
                      +|.---||.||-||..||----|
T Consensus        45 ~YnWs~KA~rR~ttgTGrmr~lk   67 (87)
T 1s1i_Y           45 SYNWGAKAKRRHTTGTGRMRYLK   67 (87)
T ss_dssp             CCSSSSCC---------------
T ss_pred             CCCCCHHHCCCCCCCCCHHHHHH
T ss_conf             55600121335456732416899


No 8  
>2zkr_2 60S ribosomal protein L37E; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} SCOP: i.1.1.1
Probab=1.86  E-value=3.2e+02  Score=11.16  Aligned_cols=24  Identities=46%  Similarity=0.515  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             667888777654211104110016
Q gi|254780189|r   23 SKYDKLCKAERRATTNQGRNTISK   46 (54)
Q Consensus        23 skydklckaerrattnqgrntisk   46 (54)
                      -+|+---||.||-||.-||----|
T Consensus        45 R~YnWs~Kakrr~ttGtGrmr~lk   68 (97)
T 2zkr_2           45 RKYNWSAKAKRRNTTGTGRMRHLK   68 (97)
T ss_dssp             CCCSSSSCC---------------
T ss_pred             CCCCHHHHHCCCCCCCCCHHHHHH
T ss_conf             465503332036777743117899


No 9  
>1r4v_A Hypothetical protein AQ_328; structural genomics, all-alpha, histon fold, PSI, protein structure initiative; HET: MSE; 1.90A {Aquifex aeolicus VF5} SCOP: a.22.1.4
Probab=1.63  E-value=5e+02  Score=10.26  Aligned_cols=31  Identities=26%  Similarity=0.298  Sum_probs=19.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             45666666788877765421110411001677
Q gi|254780189|r   17 MSMQRHSKYDKLCKAERRATTNQGRNTISKTE   48 (54)
Q Consensus        17 msmqrhskydklckaerrattnqgrntiskte   48 (54)
                      |..-..--||-|-.|+..|..| ||..|....
T Consensus        53 ~d~V~~Kl~DLl~va~~~AkaN-gRDvI~~~D   83 (171)
T 1r4v_A           53 LNSVKAAFGKLFYGAEQRARWN-GRDFIALAD   83 (171)
T ss_dssp             HHHHHHHHHHTTTTHHHHHHHT-TCSEECGGG
T ss_pred             HHHHHHHHHHHHHHHHHHHHHC-CCCEECCCC
T ss_conf             9999999999999999988762-787533046


No 10 
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1
Probab=1.61  E-value=5e+02  Score=10.23  Aligned_cols=28  Identities=21%  Similarity=0.449  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             7888777654211104110016777663
Q gi|254780189|r   25 YDKLCKAERRATTNQGRNTISKTEIQES   52 (54)
Q Consensus        25 ydklckaerrattnqgrntiskteiqes   52 (54)
                      ++++|..-.|-...-.|.||+.-|||..
T Consensus        38 ~erIa~eA~~L~~~~k~~Tit~reIq~A   65 (192)
T 2jss_A           38 FERIATEASKLAAYNKKSTISAREIQTA   65 (192)
T ss_dssp             HHHHHHHHHHHHHTTCCCSCCHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCCCCHHHHHHH
T ss_conf             9999999999998548877737988756


Done!