HHsearch results for GI: 254780191 and protein with PDBid: 2zze_A

>2zze_A Alanyl-tRNA synthetase; ligase, hydrolase; HET: MLY; 2.16A {Pyrococcus horikoshii} PDB: 2zzf_A 2zzg_A*
Probab=100.00  E-value=0  Score=1699.79  Aligned_cols=626  Identities=27%  Similarity=0.464  Sum_probs=571.3

Q ss_pred             CCHHHHHHHHHHHHHHC---CCEECCCCCCCCCCCCCHHEEECCCCCCCCC-CCCCCCCCCCCCCCCCCCEECCCCCCCH
Q ss_conf             78789999999999978---9889116675667787100230143475540-0588799999851115432248987863
Q gi|254780191|r    2 SNVSSIRTTFLEFFQKN---GHELLPSSSLIPCNDPTLMFTNSGMVPFKNI-FTGQEKPVYQAVTTVQKCVRAGGKHNDL   77 (898)
Q Consensus         2 ~s~~eiR~~fl~fF~~~---~H~~~~s~slvp~~d~~llft~Agm~~fk~~-f~G~~~p~~~r~~~~QkCiR~ggkhnDl   77 (898)
                      +|++|||++||+||++|   ||++||||||||+||||||||||||+||||| |+|.++||++|+|+||||||+    |||
T Consensus        57 ~~~~eiR~~fl~fF~~~~~~gH~~i~~~pvvp~~~~~llft~Agm~~Fkp~v~~G~~~pp~~~l~~sQ~CiR~----nDl  132 (752)
T 2zze_A           57 YTLDEMREXFLRFFEXHEIYPHGRVXRYPVLPRWRDDVLLVGASIMDFQPWVISGEADPPANPLVISQPSIRF----TDI  132 (752)
T ss_dssp             CCHHHHHHHHHHHHHTCSSSCCEECCCCCSSCTTCSSCSSCCSGGGGGTTHHHHTSSCCSSSSEEEEEEEECC----TTG
T ss_pred             CCHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCEEEEC----CCH
T ss_conf             8999999999998386888997387147837799998246603664355721578768999972455200003----747


Q ss_pred             HHCCCCCCCHHHHHHHHHHHHCC-----CCHHHHHHHHHHHHHHHCCCCHHHEEEEECCCHHHHHHHHHHHCCCCHHHEE
Q ss_conf             43464885001788854223147-----5378899989986133418981237999718828999975663499989975
Q gi|254780191|r   78 DNVGRTNRHHTFFEMLGNFSFGG-----YFKERAIQLAWDLLTKEFDLDQRRLYITVYDEDEEAFKLWKKISGLSADKII  152 (898)
Q Consensus        78 d~VG~t~rH~TfFEMlGn~Sfgd-----YfK~eai~~awe~lt~~~~l~~~~l~vtv~~~D~e~~~iW~~~~gi~~~~i~  152 (898)
                      ||||+|+||||||||||||||||     |||+|||+|||||||++||+||++|+                          
T Consensus       133 dnVG~t~rH~T~FEMlGn~sFg~~~~~~Y~k~e~i~~~~e~lt~~lgi~~~~i~--------------------------  186 (752)
T 2zze_A          133 DNVGITGRHFTIFEMMAHHAFNYPGXPIYWMDETVELAFEFFTKELXMXPEDIT--------------------------  186 (752)
T ss_dssp             GGTTTSSSCCSEEEEEEEEEEECTTCCCCCHHHHHHHHHHHHHHTSCCCGGGEE--------------------------
T ss_pred             HHCCCCCCCHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCEEEECHHHCC--------------------------
T ss_conf             655788764055760412512899701769999999999975212342576615--------------------------


Q ss_pred             ECCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCEEEEEEHHHHHHHCCCCCC------------CCCCC
Q ss_conf             357866654579999987704678853855689888777889826896001123443047887------------56576
Q gi|254780191|r  153 RITTNDNFWSMAETGPCGPCSEIFFDQGECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQE------------RFILP  220 (898)
Q Consensus       153 ~~~~~dNfW~~g~~GpcGPcsEi~~d~g~~~~~~~~~~~~~~~r~lEiwNlVFmq~~~~~~g~------------~~~Lp  220 (898)
                         .+||||+||  |||||||||||                  |+|||||||||||+++.+|.            |.|||
T Consensus       187 ---~~en~W~~G--G~~GPc~Ei~~------------------~glEi~nlVFmq~~~~~~g~~~~~~~~~~~~~~~~Lp  243 (752)
T 2zze_A          187 ---FKENPWAGG--GNAGPAFEVLY------------------RGLEVATLVFMQYXXAPENAPQDQVVVIXGEKYIPME  243 (752)
T ss_dssp             ---EEECCEEET--TEEECEEEEEE------------------TTEEEEEEEEEEEEECCTTCCSCCEEETTTEEEEEEE
T ss_pred             ---CCCCCCCCC--CCCCCCEEEEE------------------CCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             ---545766589--89988756887------------------1444210001002558888756542334530146688


Q ss_pred             CCCCCCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCC---------------------------------
Q ss_conf             65310175799999998879853005769999999997306785433---------------------------------
Q gi|254780191|r  221 KMSIDTGMGLERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGN---------------------------------  267 (898)
Q Consensus       221 ~~~IDTGmGLERl~~vlqg~~s~ydtD~f~pii~~i~~~~g~~y~~~---------------------------------  267 (898)
                      +|+||||||||||||++||+||||||| |.++|+.+.+.+|+.+.++                                 
T Consensus       244 ~k~VDTGmGLERl~~vlQg~~t~Ydtd-~~~~i~~l~~~~gi~~~~~~~~~~~~~~~g~~di~~~~~~~~~~~~va~~~~  322 (752)
T 2zze_A          244 TXVVDTGYGLERLVWMSQGTPTAYDAV-LGYVVEPLXXMAGIEKIDEKILMENSRLAGMFDIEDLGDLRYLREQVAKRVG  322 (752)
T ss_dssp             EEEEEEEEEHHHHHHHHHCCSSHHHHH-SHHHHHHHHHHHTCCCCCHHHHHHHHHHHHTCCSSSSSCHHHHHHHHHHHHT
T ss_pred             CCCCCCCCCHHHHHHHHCCCCCCHHCC-CHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCHHCCHHHHHHHHHHHHHC
T ss_conf             786588878999999982899702213-4123455665315442104677655554276560110017789999988738


Q ss_pred             -----------CCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             -----------502489999989899998740333344464125778899999999984874331045689999986455
Q gi|254780191|r  268 -----------NIVNHRVIVDHLRSSSFLIADGILPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSA  336 (898)
Q Consensus       268 -----------~~~~~rvIaDH~Ra~~f~I~DGv~PsN~GrGYvlRrilRRa~r~~~~lg~~~~fl~~lv~~v~~~m~~~  336 (898)
                                 ...++||||||+||++|||+|||+|||+|||||||||||||+||+++||++.| |++||+.+++.|++.
T Consensus       323 ~~~~~~~~~~~~~~~~~vIaDH~Ral~f~I~DGv~PSN~grGYvlRrilRRA~r~~~~lg~~~~-l~~lv~~~i~~m~~~  401 (752)
T 2zze_A          323 ITVEELEKAIRPYELIYAIADHTKALTFMLADGVVPSNVXAGYLARLLIRKSIRHLRELGLEVP-LSEIVALHIXELHKT  401 (752)
T ss_dssp             SCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCSSSHHHHHHHHHHHHHHHHHHHTTCCCC-HHHHHHHHHHHHTTT
T ss_pred             CCHHHHCCCCCCCCCCEEECCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC-HHHHHHHHHHHHHHH
T ss_conf             8803210112554441374308999999986578534455327899999999999986288676-899999999998545


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CCCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             555576467889999874898999999899999999861154--642457437998524588889999876650774435
Q gi|254780191|r  337 YPELIQAKLLIEETLRSEDERFGKTLDRGLVLLDGVLSHLGK--DEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGID  414 (898)
Q Consensus       337 ypeL~~~~~~I~~ii~~EE~~F~~TL~~G~~~l~~~i~~~~~--~~~lsg~~af~LyDTyGfP~dlt~eia~e~gi~~vD  414 (898)
                      ||||.++++.|.++|+.||++|.+||++|+++|++.+++.++  .+.|||++||+||||||||+|||++||+|+|+. ||
T Consensus       402 ypeL~~~~~~I~~ii~~EEe~F~~TL~~G~~~l~~~i~~~~~~~~~~i~ge~aF~LYDTyGfP~Dlt~eiA~E~g~~-VD  480 (752)
T 2zze_A          402 FPEFXEMEDIILEMIELEEKXYAETLRRGSDLVRREIAKLKKKGIKEIPVEXLVTFYESHGLTPEIVXEIAEKEGVK-VN  480 (752)
T ss_dssp             CTHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCSCCCHHHHHHHHHHHCCCHHHHHHHHTTSSCC-CC
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHCCE-EC
T ss_conf             86878648999999999999999999987999999997631001356668899999871599889999999872646-30


Q ss_pred             H-HHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEE
Q ss_conf             8-889999999997644433110012013567888730488626434444432111222111344454455565534899
Q gi|254780191|r  415 I-ISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKPPIDLTNGVSSIVK  493 (898)
Q Consensus       415 ~-~~f~~~m~~qk~~sr~~~~~~~~~~~~~~~~~~~~~~~~t~F~GYe~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~v~  493 (898)
                      + ..|++.|++|++++|+.+.....      ........++|++++|+....                    ...+++|+
T Consensus       481 ~~~~f~~~~~~~~~~~k~~~~~~~~------~~~~~~~l~~t~~l~y~~~~~--------------------~e~~a~V~  534 (752)
T 2zze_A          481 IPDNFYSMVAKEAERTKEEKGEELV------DFELLKDLPDTRRLYYEDPFM--------------------XEFDAXVL  534 (752)
T ss_dssp             CCTTHHHHHHGGGGCC-------CC------CSSSSSSSCCCEEHHHHCTTC--------------------CEEEEEEE
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCC------CHHHHHHCCCCCEEEECCCEE--------------------EEEEEEEE
T ss_conf             1457889999999999863455421------212233146641221011124--------------------56788899


Q ss_pred             EEEECCCEEEECCCCCEEEEEECCCCEEECCCCCCCCCCEEEECCEEEEEECCCCCCCEEEEEEECCCCCCCCCCCEEEE
Q ss_conf             99747813200047976999973752000368765665145404248985224565533899851046787556733888
Q gi|254780191|r  494 AIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVL  573 (898)
Q Consensus       494 ~i~~~~~~v~~~~~g~~~~ivLd~T~FY~E~GGQ~~D~G~i~~~~~~~~V~dv~k~~~g~i~H~~~~~~g~l~~g~~V~~  573 (898)
                      .+..+             +||||+||||||||||++|+|+|..++..+.|.++++. +++++|.+ ...+.+.+|++|.+
T Consensus       535 ~i~~~-------------~vvLD~T~FYpegGGQ~~D~G~i~~~~~~~~v~~~~~~-~~~i~h~~-~~~~~l~~G~~V~~  599 (752)
T 2zze_A          535 RVIXD-------------WVILDATAFYPEGGGQPYDTGVLIVNGREVXVTNVQXV-GXVIIHXV-EDPGAFXEGMIVHG  599 (752)
T ss_dssp             EEETT-------------EEEESEECSCCSBTTBCCCCEEEEETTEEEEEEEEEEE-TTEEEEEE-SCGGGCCTTCEEEE
T ss_pred             EEECC-------------EEECCCCEECCCCCCCCCCEEEEECCCCEEEEEEEECC-CCCEEECC-CCCCCCCCCCEEEE
T ss_conf             86505-------------26436740233358988850368404633653222105-74023112-22686588998999


Q ss_pred             EEHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCCCCCEECCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             42125567775201368899999752125444445530024300000247678999999999999989887304530466
Q gi|254780191|r  574 TIDYQNRRQLSINHSATHLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRI  653 (898)
Q Consensus       574 ~VD~~rR~~~~~~HTatHlL~~alr~vLG~hv~Q~GS~v~~~~lrfDfsh~~~lt~eel~~IE~~vN~~I~~n~~V~~~~  653 (898)
                      +|||+||..+|+|||||||||+|||++||+||+|+||+|+++++||||+|++++|+|||.+||++||++|++|+||++.+
T Consensus       600 ~ID~~rR~~~mr~HTAtHLL~~alr~vlG~hv~Q~Gs~v~~d~~R~Df~~~~~lt~eel~~IE~~vN~~I~~~~~V~~~~  679 (752)
T 2zze_A          600 XIDWXRRIQHMRHHTGTHVLMGALVRVLGRHVWQAGSQLTTDWARLDISHYXRISEEELXEIEMLANRIVMEDRXVTWEW  679 (752)
T ss_dssp             EECHHHHHHHHHHHHHHHHHHHHHHHHHCTTCEEEEEEECSSCEEEEEECSSCCCHHHHHHHHHHHHHHHHHTCBEEEEE
T ss_pred             EECHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             71587899999855799999999999868873014675069827998518999999999999999999998589168997


Q ss_pred             ECCCCCCCCHHHHHH--HHCCCCCEEEEEECCCCCCCCCEECCCCCCCCCHHHHHHHHEECCCCCCCCCEEEEEEECH
Q ss_conf             123222100035544--3155562489984476778553101562225886460110011012126882899997168
Q gi|254780191|r  654 MNREDAIASGAAALL--GTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGIRRIEAITGQ  729 (898)
Q Consensus       654 ~~~~eA~~~ga~alf--gekygd~VRVV~I~~~d~~~~S~ElCGGTHV~nTgeIG~fkIise~si~sGvRRIeavtG~  729 (898)
                      +++++|++.+++++|  |++|+++||||+|+     ++|+|+||||||.||||||.|+|++++++++|+|||+|+||+
T Consensus       680 ~~~~ea~~~~~~~l~~~g~~~~~~vRvV~I~-----~~d~e~CGGTHV~nT~eIg~~kI~~~~~i~~Gv~RI~~v~Ge  752 (752)
T 2zze_A          680 LPRTTAEQXYGFRLYQGGVVPGREIRVVXIE-----DWDVQACGGTHLPSTGLVGPIXILRTERIQDGVERIIFACGE  752 (752)
T ss_dssp             EEHHHHHHHHCGGGCSSCCCCSSEEEEEEET-----TTEEEECCSCCCSBGGGGCCEEEEEEEEEETTEEEEEEEECC
T ss_pred             CCHHHHHHCCCCCCCCCCCCCCCEEEEEEEC-----CEEECCCCCCCCCCHHHCCCEEEEEEEEECCCCEEEEEEECC
T ss_conf             5799998669820024888889827999989-----935465787030149768856999887686995899998187