HHSEARCH alignment of GI: 254780191 and SCOP domain: d1nnha_

Alignment
>d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Archaeon Pyrococcus furiosus [TaxId: 2261]}
Probab=91.34  E-value=0.13  Score=27.78  Aligned_cols=214  Identities=15%  Similarity=0.160  Sum_probs=96.3

Q ss_pred             HHHHHHHHHHHHHCCCEECCCCCCC-CC---CCCCHHEEECCCCCC------CCCCCCCCCC---------CCCCCCCCC
Q ss_conf             8999999999997898891166756-67---787100230143475------5400588799---------999851115
Q gi|254780191|r    5 SSIRTTFLEFFQKNGHELLPSSSLI-PC---NDPTLMFTNSGMVPF------KNIFTGQEKP---------VYQAVTTVQ   65 (898)
Q Consensus         5 ~eiR~~fl~fF~~~~H~~~~s~slv-p~---~d~~llft~Agm~~f------k~~f~G~~~p---------~~~r~~~~Q   65 (898)
                      +.|-+.+-+||.++|-.-|. -|++ |.   .++.  ....+..+|      +++||-+.+-         ...|+-..=
T Consensus        18 s~i~~~iR~ff~~~gf~EV~-tPil~~~~~~~~~~--~~~~~~~~~~~~~~~~~~yL~~SPel~lk~lla~g~~~Vf~I~   94 (293)
T d1nnha_          18 TKILEYMTDFFVKEGFKWLL-PVIISPITDPLWPD--PAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLKKIFVLS   94 (293)
T ss_dssp             HHHHHHHHHHHHHTTCEEEC-CCCEESCCCCCCSC--TTCCCCCCCEEEETTEEEEECSCSHHHHHHHHHTTCCEEEEEE
T ss_pred             HHHHHHHHHHHHHCCCEEEC-CCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCEEECCCCHHHHHHHHHHHCCCCCEEEC
T ss_conf             99999999999988999975-87345667777776--5567664653567896564466863647999972233210310


Q ss_pred             CCEECCCCCCCHHHCC-CCCCCHHHHHHHH-HHHHCCC-----CHHHHHHHHHHHHHHHCC--CCH--HHEEEEECCCHH
Q ss_conf             4322489878634346-4885001788854-2231475-----378899989986133418--981--237999718828
Q gi|254780191|r   66 KCVRAGGKHNDLDNVG-RTNRHHTFFEMLG-NFSFGGY-----FKERAIQLAWDLLTKEFD--LDQ--RRLYITVYDEDE  134 (898)
Q Consensus        66 kCiR~ggkhnDld~VG-~t~rH~TfFEMlG-n~SfgdY-----fK~eai~~awe~lt~~~~--l~~--~~l~vtv~~~D~  134 (898)
                      ||.|.       |+.. .|.||+.=|-||= =.+|.||     .-++.|...++-+.+..+  +|.  .--.+|+    .
T Consensus        95 ~~FR~-------E~~~s~t~RH~~EFtmLE~e~~~~d~~d~m~~~e~li~~~~~~~~~~~~~~~~~~~~~~~~~~----~  163 (293)
T d1nnha_          95 PNIRL-------ESRQKDDGRHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEWTGREFPKTKRFEVFEY----S  163 (293)
T ss_dssp             EEECC-------CCGGGCSSSCCSEEEEEEEEEETCCHHHHHHHHHHHHHHHHHHHHHHHSSCCCCCSSCEEEEH----H
T ss_pred             HHHHC-------CCCCCCCCCCCHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCH----H
T ss_conf             23304-------755677775615665111123323078899999999999999999871745666784332338----7


Q ss_pred             HHHHHHHHHCCCCHH---H----EEECCCCCCCCCCCCCC-CCCCCEEEEEECCCCCCCCCCCCCCCCCCEEEEEEHHHH
Q ss_conf             999975663499989---9----75357866654579999-987704678853855689888777889826896001123
Q gi|254780191|r  135 EAFKLWKKISGLSAD---K----IIRITTNDNFWSMAETG-PCGPCSEIFFDQGECIPGGLPGSSEEGERYIEIWNLVFM  206 (898)
Q Consensus       135 e~~~iW~~~~gi~~~---~----i~~~~~~dNfW~~g~~G-pcGPcsEi~~d~g~~~~~~~~~~~~~~~r~lEiwNlVFm  206 (898)
                      |+.+.|.    ....   .    +.......-|+.+.+.| +..+..|+++ .|.+..+|          |.|+++-. .
T Consensus       164 eal~~~g----~d~~~~~~~~~p~~~~~~p~~f~~~~~~~~~~~~~~~l~~-~g~Elang----------~~el~d~~-~  227 (293)
T d1nnha_         164 EVLEEFG----SDEKASQEMEEPFWIINIPREFYDREVDGFWRNYDLILPY-GYGEVASG----------GEREWEYE-K  227 (293)
T ss_dssp             HHHHHTS----SHHHHHHHCSSCEEEECCCCCTTBCEETTEECEEEEEETT-TTEEEEEE----------EEBCCCHH-H
T ss_pred             HHHCCCC----CCCCCCCCCCCCEECCCCCHHHCCCCCCCCCCCCEEEECC-CCCCCCCC----------CCCCCCHH-H
T ss_conf             6532367----6520011222113203421021024666434541357404-57420552----------10106799-9


Q ss_pred             HHHCC-CCCC-CC------------CCCCCCCCCCCCHHHHHHHHCCCCCCCHHHHH
Q ss_conf             44304-7887-56------------57665310175799999998879853005769
Q gi|254780191|r  207 QFEQQ-NKQE-RF------------ILPKMSIDTGMGLERMATVLQEKTNNYDIDLF  249 (898)
Q Consensus       207 q~~~~-~~g~-~~------------~Lp~~~IDTGmGLERl~~vlqg~~s~ydtD~f  249 (898)
                      |-.|- ..|. -.            .|| ++=--|+|+|||++++.|.++.=|+=.|
T Consensus       228 ~~~r~~~~gl~~e~~~~yl~a~~~G~mP-P~~G~glGiDRL~m~l~g~~~Irdv~~F  283 (293)
T d1nnha_         228 IVAKIRKAGLNEDSFRPYLEIAKAGKLK-PSAGAGIGVERLVRFIVGAKHIAEVQPF  283 (293)
T ss_dssp             HHHHHHHTTCCGGGGHHHHHHHHTTCCC-CEEEEEEEHHHHHHHHHTCSSGGGGCSS
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHCCCC-CCCEEEEHHHHHHHHHHCCCCHHHEECC
T ss_conf             9999998599989999999999809999-9886766599999999389828851147


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain
domain: Hypothetical protein PF1951
species: Archaeon Pyrococcus furiosus [TaxId: 2261]