PSIBLAST alignment of GI: 254780191 and protein with PDB id: 2e1b

gi|134104183|pdb|2E1B|A Chain A, Crystal Structure Of The Alax-M Trans-Editing Enzyme From Pyrococcus Horikoshii Length = 216
 Score = 53.6 bits (127), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 50/214 (23%), Positives = 77/214 (35%), Gaps = 31/214 (14%)

Query: 513 VVFDQTPFYAEAGGQLGDTGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLV 572
           ++ DQT FY   GGQ  D G   G  +     D +       V H + E    +    + 
Sbjct: 30  ILLDQTIFYPTGGGQPHDRGTINGVEVLDVYKDEEG-----NVWHVVKEPEKFKVGDEVE 84

Query: 573 LTIDYQNRRQLSINHSATHLLHHALSTILGSHVSQ-NGSCITPDGLRFDVTHSKPITSAE 631
           L ID+  R +L   H+  HLL H L+ +LG    Q  GS ++ +  R+D+ + + +    
Sbjct: 85  LKIDWDYRYKLMRIHTGLHLLEHVLNEVLGEGNWQLVGSGMSVEKGRYDIAYPENLNK-Y 143

Query: 632 LKSIEDNVNDIIAQNLPVVTRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSS 691
            + I    N  + +   V                                          
Sbjct: 144 KEQIISLFNKYVDEGGEVKIWWEGDRRYTQIR------------------------DFEV 179

Query: 692 ALCGGTHVSSTGEIMLLYIVSESSIRAGIRRIEA 725
             CGGTHV    EI  +  +  SSI  G +R+E 
Sbjct: 180 IPCGGTHVKDIKEIGHIKKLKRSSIGRGKQRLEM 213