BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780191|ref|YP_003064604.1| alanyl-tRNA synthetase
[Candidatus Liberibacter asiaticus str. psy62]
         (898 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|254780191|ref|YP_003064604.1| alanyl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254039868|gb|ACT56664.1| alanyl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 898

 Score =  985 bits (2545), Expect = 0.0,   Method: Composition-based stats.
 Identities = 898/898 (100%), Positives = 898/898 (100%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA
Sbjct: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
           VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL
Sbjct: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
           DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG
Sbjct: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180

Query: 181 ECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEK 240
           ECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEK
Sbjct: 181 ECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEK 240

Query: 241 TNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYV 300
           TNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYV
Sbjct: 241 TNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYV 300

Query: 301 LRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGK 360
           LRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGK
Sbjct: 301 LRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGK 360

Query: 361 TLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQ 420
           TLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQ
Sbjct: 361 TLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQ 420

Query: 421 ALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKP 480
           ALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKP
Sbjct: 421 ALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKP 480

Query: 481 PIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIR 540
           PIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIR
Sbjct: 481 PIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIR 540

Query: 541 LQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTI 600
           LQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTI
Sbjct: 541 LQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTI 600

Query: 601 LGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAI 660
           LGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAI
Sbjct: 601 LGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAI 660

Query: 661 ASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGI 720
           ASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGI
Sbjct: 661 ASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGI 720

Query: 721 RRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQ 780
           RRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQ
Sbjct: 721 RRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQ 780

Query: 781 LNVEDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKKASVLI 840
           LNVEDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKKASVLI
Sbjct: 781 LNVEDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKKASVLI 840

Query: 841 VVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASFLKK 898
           VVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASFLKK
Sbjct: 841 VVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASFLKK 898


>gi|15965551|ref|NP_385904.1| alanyl-tRNA synthetase [Sinorhizobium meliloti 1021]
 gi|307302671|ref|ZP_07582427.1| alanyl-tRNA synthetase [Sinorhizobium meliloti BL225C]
 gi|307318519|ref|ZP_07597953.1| alanyl-tRNA synthetase [Sinorhizobium meliloti AK83]
 gi|7404473|sp|P27866|SYA_RHIME RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|15074732|emb|CAC46377.1| Alanyl-tRNA ligase [Sinorhizobium meliloti 1021]
 gi|306895859|gb|EFN26611.1| alanyl-tRNA synthetase [Sinorhizobium meliloti AK83]
 gi|306903035|gb|EFN33626.1| alanyl-tRNA synthetase [Sinorhizobium meliloti BL225C]
          Length = 887

 Score =  948 bits (2451), Expect = 0.0,   Method: Composition-based stats.
 Identities = 500/909 (55%), Positives = 659/909 (72%), Gaps = 37/909 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+ FL++F+KNGHE++ SS L+P NDPTLMFTN+GMV FKN+FTG E+  Y  
Sbjct: 1   MSGVNEIRSMFLDYFRKNGHEIVSSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEQRPYST 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             T QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKERAI+LAW+L+TKE+ L
Sbjct: 61  AATAQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKERAIELAWNLITKEYGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
           D +RL +TVY  D+EAF LWKKI+GLS D+IIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 121 DAKRLLVTVYHTDDEAFGLWKKIAGLSDDRIIRIATSDNFWAMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS+ E+G+R+IEIWNLVFMQ+EQ  K+ER  LP+ SIDTGMGLER+A VLQ 
Sbjct: 181 DHIWGGPPGSAEEDGDRFIEIWNLVFMQYEQITKEERVDLPRPSIDTGMGLERVAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           + +NYDIDLF+ LI ASE+ TG+K EG+   +HRVI DHLRSS+FLIADG+LP+NEGRGY
Sbjct: 241 QHDNYDIDLFRALIAASEEATGVKAEGDRRASHRVIADHLRSSAFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  +PLM  LLPAL  +MG AYPEL++A+ LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGARDPLMWKLLPALVGQMGRAYPELVRAEALISETLKLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL    + L + +  NG+ AFKLYDT+G PLD+ QD L A+G  G+D  +F 
Sbjct: 361 KTLERGLNLLAEASADLSEGDQFNGETAFKLYDTYGFPLDLTQDALRAKG-IGVDTDAFT 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A++ Q++ ARA+  G G   TE IWF L++K+GAT F+GYD                  
Sbjct: 420 AAMQRQKAEARANWAGSGEAATETIWFELRDKHGATDFLGYD------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     ++ AIV+ G +VE A  G+ V++V +QTPFY E+GGQ+GDTG    +  
Sbjct: 462 -----TESAEGVILAIVKDGAVVESAAKGENVQLVLNQTPFYGESGGQVGDTGVITTETG 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           +L +TD QK+ EG+FVH+  VE G ++T  +  LT+D+  R +L  NHSATHLLH AL  
Sbjct: 517 KLTVTDTQKRGEGLFVHYCTVEEGSVKTGEAAALTVDHARRARLRANHSATHLLHEALRE 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG+HV+Q GS + P+ LRFDV+H KP+T+ ELK +E+  N+II QN PVVTR+M+ +DA
Sbjct: 577 VLGTHVAQKGSLVAPERLRFDVSHPKPMTAEELKIVEEMANEIIVQNTPVVTRLMSVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSV-----EYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+       + G  +S  LCGGTHVS+TG+I L+ +VSES
Sbjct: 637 IAEGAMALFGEKYGDEVRVVSMGQGLRGSKAGKPYSVELCGGTHVSATGDIGLVRVVSES 696

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
           ++ AG+RR+EA+TG+ AR++L  QDE++K+LA+ LKV   +V+GRVE + +E RKL+   
Sbjct: 697 AVGAGVRRVEALTGEAARAYLGEQDERVKTLAAALKVQPADVLGRVEALLDERRKLEREL 756

Query: 775 AKRKLQLNVE-------DLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
            + K +L +          +   I  V F+  ++S V+ K+LKS+ D  +K + SG++  
Sbjct: 757 TEAKKKLALAGDGQNGSGDAARDIGGVRFLGRVVSGVEPKDLKSLADDGKKSLGSGVVAF 816

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQ 887
           VG+S + KAS ++ VT+DL  + +AVDL R+++  LGG GGGGRP MAQ+GGP+G +A +
Sbjct: 817 VGVSGDGKASAVVAVTDDLTSKVSAVDLVRVASAALGGKGGGGRPDMAQAGGPDGGRAAE 876

Query: 888 AIAGVASFL 896
           AI  VA  L
Sbjct: 877 AIEAVAGAL 885


>gi|288940831|ref|YP_003443071.1| alanyl-tRNA synthetase [Allochromatium vinosum DSM 180]
 gi|288896203|gb|ADC62039.1| alanyl-tRNA synthetase [Allochromatium vinosum DSM 180]
          Length = 867

 Score =  946 bits (2444), Expect = 0.0,   Method: Composition-based stats.
 Identities = 389/902 (43%), Positives = 540/902 (59%), Gaps = 46/902 (5%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M+  + +R +FL++F++  HE + SS LIP NDPTL+FTN+GMV FK+ F G+E+     
Sbjct: 1   MTTSAELRASFLDYFEQRQHERVASSPLIPANDPTLLFTNAGMVQFKDAFLGRERRASNR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             + Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AWD LT+   L
Sbjct: 61  AVSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIEYAWDYLTRVLAL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQ- 179
              RL++TV++ED+EA  +W K  G+   +  R    DNFWSM +TGPCGPCSEIF+D  
Sbjct: 121 PPERLWVTVFEEDDEAAGIWLKEIGVDPQRFSRCGAKDNFWSMGDTGPCGPCSEIFYDHG 180

Query: 180 GECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
                G      E+G+RY+EIWNLVFMQF +        LP+ S+DTGMGLER+A V+Q 
Sbjct: 181 PAIPGGPPGSPDEDGDRYVEIWNLVFMQFNRDADGNMTPLPRPSVDTGMGLERLAAVMQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NY+IDLF+HLI+A+ Q TG         + RVI DH+RS++FLI DG+ P NEGRGY
Sbjct: 241 VHSNYEIDLFRHLIEAAAQATGCTDLA--DKSLRVIADHIRSTAFLITDGVTPGNEGRGY 298

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRA+ +   LG + P    L+  L  EMG AYPEL  ++  +E  ++ E+ERF 
Sbjct: 299 VLRRIMRRAIRHGYRLGCSTPFFHTLVEPLAREMGDAYPELRASQSHVERLVKLEEERFA 358

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           +TL+ G+ LLD  ++ L  D+I  G+  FKLYDT+G P+D+  DI   RGL  +D+  F 
Sbjct: 359 ETLEHGMRLLDEAIADLSGDQI-PGETVFKLYDTYGFPVDLTADIARERGLT-LDVAGFE 416

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
           QA+E Q+ RARA S    + T +       +  G T F GYD ++               
Sbjct: 417 QAMERQKERARAASQFGSAQTLD------IQIQGETDFCGYDRVQ--------------- 455

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                     + + A+ + GE  +   +G++  V+ D++PFY E+GGQ+GD G    +  
Sbjct: 456 --------EEATIVALYRGGESCDALEAGEEGLVILDRSPFYGESGGQVGDRGWLNTETA 507

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           R  + D QKK +G+ VH   VE G L     +   +D   RR  ++NHSATHLLH AL  
Sbjct: 508 RFGVQDTQKKGDGVLVHVGRVEEGALTVGDRVDARVDADRRRATALNHSATHLLHAALRE 567

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG HV Q GS + P+ LRFD +H +P++  +L +IE  VN  +  N  V TRIM+ EDA
Sbjct: 568 VLGPHVQQKGSLVGPERLRFDFSHFEPVSREQLLTIERMVNREVRANHLVETRIMSLEDA 627

Query: 660 IASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAG 719
            ASGA AL G KY D+VRV+ +     G  S+ LCGGTHV + G+I L+ IVSE+ I AG
Sbjct: 628 KASGAMALFGEKYADQVRVLRM-----GEFSTELCGGTHVKAVGDIGLIKIVSETGIAAG 682

Query: 720 IRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKL 779
           +RRIEAITG  A   +   +E+L  LA  LK  + +V  RV ++ +  R+L+    + K 
Sbjct: 683 VRRIEAITGASALEWVEADEERLLRLAGLLKGGREDVDERVTQLIDRARRLEKEIEQLKA 742

Query: 780 QLNVE-----DLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEK 834
           +               I  +  ++  +   D K L+  +D L+ K+ S +++L     + 
Sbjct: 743 KAASSAGQDLAAQAIDIQGIKTLAARLDGADPKSLRVTLDQLKDKLGSAVVVLA-TESDG 801

Query: 835 KASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVAS 894
           K S++  VT+DL DR  A DL R  A+ + GG GGGRP MAQ+GG +      A+  V  
Sbjct: 802 KVSLVAGVTKDLTDRLKAGDLIREVAEKV-GGKGGGRPDMAQAGGNDPAGLPAALELVPG 860

Query: 895 FL 896
           ++
Sbjct: 861 WV 862


>gi|94309776|ref|YP_582986.1| alanyl-tRNA synthetase [Cupriavidus metallidurans CH34]
 gi|93353628|gb|ABF07717.1| alanyl-tRNA synthetase [Cupriavidus metallidurans CH34]
          Length = 884

 Score =  945 bits (2443), Expect = 0.0,   Method: Composition-based stats.
 Identities = 389/910 (42%), Positives = 541/910 (59%), Gaps = 55/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
             VS IR+ FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G +K  Y   
Sbjct: 11  MKVSDIRSKFLQFFESKGHTVVRSSSLVPANDPTLLFTNSGMVQFKDVFLGTDKRPYVRA 70

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLTK + L 
Sbjct: 71  TSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIQYAWELLTKVYQLP 130

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY ED+EA+ +W K  G+ AD+I+RI  N       DNFW MA+TGPCGPCSE
Sbjct: 131 ADKLWVTVYAEDDEAYDIWAKEVGVPADRIVRIGDNKGARYASDNFWQMADTGPCGPCSE 190

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 191 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDEQGTMTPLPKPCVDTGMGLERI 250

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+ + + T +     N  + +VI DH+R+ SFLI DG++P 
Sbjct: 251 AAVLQHVHSNYEIDLFQALIKGAGRETHIAD--LNQNSLKVIADHIRACSFLIVDGVIPG 308

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG   P    L+  L  +MG AYPEL +A+  + E L++
Sbjct: 309 NEGRGYVLRRIVRRAIRHGYKLGQKTPFFHKLVGDLVAQMGEAYPELAEAQSRVVEVLKA 368

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +LD  ++ L     ++L+G++AFKL+DT G PLD+ QD+   + + 
Sbjct: 369 EEERFFETIENGMSILDAAVADLKAKGGKVLDGELAFKLHDTFGFPLDLTQDVAREQEIT 428

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GYD L        
Sbjct: 429 -VDEAAFDAAMTRQREQARAAGKFKMAAG-------LEYSGEKTVFHGYDALSMDGV--- 477

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                               V A+   G  V+    GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 478 -------------------RVTALYVDGASVDTMQPGQSGVVVLDNTPFYAESGGQVGDQ 518

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G  +       + D  K    +F H   +  G L+   ++   +D   R +   NHSATH
Sbjct: 519 GTLVSGPAVFAVADTTKIQSDVFGHQGTLANGALKVGDTVAAQVDAVRRARTVRNHSATH 578

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS + PD  RFD +H+ P+T A+++ IE+ VN  I  N P V 
Sbjct: 579 LMHKALREVLGTHVQQKGSLVDPDKTRFDFSHNAPLTDAQIRQIEEIVNAEILSNAPTVA 638

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           ++M  +DA+ SGA AL G KY D VRV+S+        S  LCGGTHV+ TG+I L  IV
Sbjct: 639 QVMPFDDAVKSGAMALFGEKYADDVRVLSIG------TSKELCGGTHVTRTGDIGLFKIV 692

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E+ + AGIRR+EAITG  A  +L   D +L   A+ L+     +V R+ ++ ++ R L+
Sbjct: 693 VEAGVAAGIRRVEAITGDNALHYLQSLDARLNEAAAALRAQPSELVPRIGQVQDQVRALE 752

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               K K +L              +  +  ++  +   D K L+  MD L+ K+QS  I+
Sbjct: 753 KELEKLKSKLASSQGDELAAQAVDVKGLKVLAAQLDGADVKTLRETMDKLKDKLQSAAIV 812

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ + K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG +     
Sbjct: 813 LAAVA-DGKVSLIAGVTADATSKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTDPANLP 870

Query: 887 QAIAGVASFL 896
           +A+AGV  ++
Sbjct: 871 KALAGVTEWV 880


>gi|205830252|sp|Q1LQ59|SYA_RALME RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
          Length = 874

 Score =  945 bits (2443), Expect = 0.0,   Method: Composition-based stats.
 Identities = 389/910 (42%), Positives = 541/910 (59%), Gaps = 55/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
             VS IR+ FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G +K  Y   
Sbjct: 1   MKVSDIRSKFLQFFESKGHTVVRSSSLVPANDPTLLFTNSGMVQFKDVFLGTDKRPYVRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLTK + L 
Sbjct: 61  TSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIQYAWELLTKVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY ED+EA+ +W K  G+ AD+I+RI  N       DNFW MA+TGPCGPCSE
Sbjct: 121 ADKLWVTVYAEDDEAYDIWAKEVGVPADRIVRIGDNKGARYASDNFWQMADTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDEQGTMTPLPKPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+ + + T +     N  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQALIKGAGRETHIAD--LNQNSLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG   P    L+  L  +MG AYPEL +A+  + E L++
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGQKTPFFHKLVGDLVAQMGEAYPELAEAQSRVVEVLKA 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +LD  ++ L     ++L+G++AFKL+DT G PLD+ QD+   + + 
Sbjct: 359 EEERFFETIENGMSILDAAVADLKAKGGKVLDGELAFKLHDTFGFPLDLTQDVAREQEIT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GYD L        
Sbjct: 419 -VDEAAFDAAMTRQREQARAAGKFKMAAG-------LEYSGEKTVFHGYDALSMDGV--- 467

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                               V A+   G  V+    GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 468 -------------------RVTALYVDGASVDTMQPGQSGVVVLDNTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G  +       + D  K    +F H   +  G L+   ++   +D   R +   NHSATH
Sbjct: 509 GTLVSGPAVFAVADTTKIQSDVFGHQGTLANGALKVGDTVAAQVDAVRRARTVRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS + PD  RFD +H+ P+T A+++ IE+ VN  I  N P V 
Sbjct: 569 LMHKALREVLGTHVQQKGSLVDPDKTRFDFSHNAPLTDAQIRQIEEIVNAEILSNAPTVA 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           ++M  +DA+ SGA AL G KY D VRV+S+        S  LCGGTHV+ TG+I L  IV
Sbjct: 629 QVMPFDDAVKSGAMALFGEKYADDVRVLSIG------TSKELCGGTHVTRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E+ + AGIRR+EAITG  A  +L   D +L   A+ L+     +V R+ ++ ++ R L+
Sbjct: 683 VEAGVAAGIRRVEAITGDNALHYLQSLDARLNEAAAALRAQPSELVPRIGQVQDQVRALE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               K K +L              +  +  ++  +   D K L+  MD L+ K+QS  I+
Sbjct: 743 KELEKLKSKLASSQGDELAAQAVDVKGLKVLAAQLDGADVKTLRETMDKLKDKLQSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ + K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG +     
Sbjct: 803 LAAVA-DGKVSLIAGVTADATSKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTDPANLP 860

Query: 887 QAIAGVASFL 896
           +A+AGV  ++
Sbjct: 861 KALAGVTEWV 870


>gi|293604526|ref|ZP_06686931.1| alanine--tRNA ligase [Achromobacter piechaudii ATCC 43553]
 gi|292817107|gb|EFF76183.1| alanine--tRNA ligase [Achromobacter piechaudii ATCC 43553]
          Length = 874

 Score =  945 bits (2443), Expect = 0.0,   Method: Composition-based stats.
 Identities = 400/911 (43%), Positives = 549/911 (60%), Gaps = 53/911 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              S IR  FL+FF+  GH ++PSSSL+P NDPTL+FTNSGMV FK++FTG+E   Y   
Sbjct: 1   MKSSEIRRQFLQFFKSKGHTIVPSSSLVPGNDPTLLFTNSGMVQFKDVFTGKESRSYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT+ + L 
Sbjct: 61  TSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIQYAWELLTQVYKLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY ED+EA+ +W K  G+ A++IIRI  N       DNFW MA+TGPCGPCSE
Sbjct: 121 AEKLWVTVYQEDDEAYDIWAKEVGVPAERIIRIGDNKGARYASDNFWQMADTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IFFD G  I GG PGS  E+G+RYIEIWNLVFMQFE+  +     LP+  +DTGMGLER+
Sbjct: 181 IFFDHGPEIWGGPPGSPEEDGDRYIEIWNLVFMQFERDAEGNMPRLPRPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI A+ + TG+K   NN  + +VI DH+R+ SFLI DG++P+
Sbjct: 241 AAVLQGVHSNYEIDLFQKLIHAAARETGVKDLENN--SLKVIADHIRACSFLIVDGVIPS 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG T+P    L+P L  EMG AYPEL      + + L+ 
Sbjct: 299 NEGRGYVLRRIVRRALRHGYKLGQTKPFFHRLVPDLVAEMGEAYPELASMADRVAQVLKQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGI 413
           E+ERFG+TL+ G+ +LD  L+++ K  +L+G   F LYDT+G P+D+  DI   R    I
Sbjct: 359 EEERFGETLEHGMRILDTALANVPKGGVLDGTTLFTLYDTYGFPVDLTADICRERD-VEI 417

Query: 414 DIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDR 473
           D+  F  ++E QR +ARA      +         L  +   T+F GY+ L          
Sbjct: 418 DMPGFEVSMERQRDQARAAGKFKMAEG-------LSYEGADTRFEGYEKLELDNV----- 465

Query: 474 KVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGC 533
                             V A+   G  V++  +GQ   VV D TPFYAE+GGQ+GDTG 
Sbjct: 466 -----------------KVTALYVDGTQVQQVQAGQNAVVVLDATPFYAESGGQVGDTGL 508

Query: 534 AIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLL 593
              DG+R  + D  K   G+F HH ++E G L    +L+  +D   R +   NHSATHL+
Sbjct: 509 LQADGVRFAVADTLKIQNGVFGHHGVLESGSLSVGDTLLARVDAVRRARTVRNHSATHLM 568

Query: 594 HHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRI 653
           H AL  +LG+HV Q GS +  +  RFD     P+T+ ++  +E  VN  +  N P V ++
Sbjct: 569 HKALRQVLGAHVQQRGSLVDAEKTRFDFAQDAPMTAEQIARVEAIVNAEVLANQPTVAQV 628

Query: 654 MNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSE 713
           M  +DA+  GA AL G KY D VRV+ +        S  LCGGTHVS TG+I L  IVSE
Sbjct: 629 MAYDDAVKGGAMALFGEKYGDTVRVLDIG------FSRELCGGTHVSRTGDIGLFKIVSE 682

Query: 714 SSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLI 773
             + AG+RRIEAITG  A + +  Q+  L  +A  L+ +  +V  R+ ++ E+ + L+  
Sbjct: 683 GGVAAGVRRIEAITGDNALAWVQNQNALLTQIAGMLRSTPADVPARIAQVQEQIKALEKD 742

Query: 774 HAKRKLQLNVED------LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
             + + +L           +  ++  +  ++  I +VD K L+ ++D L+ +++  +++L
Sbjct: 743 LEQSRNKLAASAGNDLATSAAVEVKGIKVLAASIGDVDPKALRGMVDNLKDRLKPAVVLL 802

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQ 887
              S + K SV+  VT DL DR  A DL    A  + GG GGGRP MA  GG +      
Sbjct: 803 ATGSADGKISVVGGVTADLTDRIKAGDLVGFVASQV-GGKGGGRPDMAMGGGTDLAALPA 861

Query: 888 AIAGVASFLKK 898
           AIAGV  ++ +
Sbjct: 862 AIAGVQKWVDE 872


>gi|187478846|ref|YP_786870.1| alanyl-tRNA synthetase [Bordetella avium 197N]
 gi|123514444|sp|Q2KY72|SYA_BORA1 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|115423432|emb|CAJ49966.1| alanyl-tRNA synthetase [Bordetella avium 197N]
          Length = 873

 Score =  944 bits (2441), Expect = 0.0,   Method: Composition-based stats.
 Identities = 395/911 (43%), Positives = 548/911 (60%), Gaps = 54/911 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              S IR  FL+FFQ  GH ++PSSSL+P NDPTL+FTNSGMV FK++FTG+EK  Y   
Sbjct: 1   MKSSEIRQKFLQFFQSKGHSIVPSSSLVPGNDPTLLFTNSGMVQFKDVFTGKEKRPYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI+ AW+LLT  + L 
Sbjct: 61  TSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAIRFAWELLTTVYKLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW M +TGPCGPC+E
Sbjct: 121 VEKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWQMGDTGPCGPCTE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  I GG PGS  E+G+RYIEIWNLVFMQFE+        LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDIWGGPPGSPEEDGDRYIEIWNLVFMQFERDAAGNMTPLPKPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI A+ + TG++    +  + +VI DH+R+ SFLI DG++P+
Sbjct: 241 AAVLQGVHSNYEIDLFQKLITAAARETGVQD--LHDNSLKVIADHIRACSFLIVDGVIPS 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG T+P    L+P L  +MG AYPEL      + + L+ 
Sbjct: 299 NEGRGYVLRRIVRRALRHGYKLGQTKPFFYRLVPDLVAQMGEAYPELANMAERVGQVLKQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGI 413
           E+ERFG+TL+ G+ +LD  L+ + K  +L+G+  F LYDT+G P+D+  DI   R    I
Sbjct: 359 EEERFGETLEHGMKILDVALAQVPKGGLLDGNTLFTLYDTYGFPVDLTADICRER-EVEI 417

Query: 414 DIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDR 473
           D+  F  A+E QR +ARA      +         L  +   T+F GY+ L  S       
Sbjct: 418 DMAGFEAAMERQRDQARAAGKFKMAEG-------LNYEGAQTRFEGYEQLELSG------ 464

Query: 474 KVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGC 533
                           + V A+   G   ++  +GQ+  VV D TPFYAE+GGQ+GDTG 
Sbjct: 465 ----------------AKVTALYVDGTQTDQVRAGQQAVVVLDATPFYAESGGQVGDTGL 508

Query: 534 AIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLL 593
            + DG+R  + D  K   G+F HH ++E G+L+   +L+  +D   R +   NHSATHL+
Sbjct: 509 LVADGLRFAVADTLKVQAGVFGHHGLLEEGVLKVGDTLLARVDAVRRARTVRNHSATHLM 568

Query: 594 HHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRI 653
           H AL  +LG+HV Q GS + PD  RFD  H  P+T+ ++  +E  VN  +  N     R+
Sbjct: 569 HKALREVLGAHVQQRGSLVDPDKTRFDFAHDAPMTAEQIARVEAIVNAEVLANQAAQARV 628

Query: 654 MNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSE 713
           M  +DA+  GA AL G KY D VRV+ +        S  LCGGTHVS TG+I L  IVSE
Sbjct: 629 MAYDDAVKGGAMALFGEKYGDTVRVLDIG------FSRELCGGTHVSRTGDIGLFKIVSE 682

Query: 714 SSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLI 773
             + AG+RR+EAITG  A   +  Q+  L+  A  L+     +  R+ ++ ++ + L+  
Sbjct: 683 GGVAAGVRRVEAITGDNALVWVQEQNALLQRAAGVLRSPVAELPERIAQVQDQVKALEKD 742

Query: 774 HAKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
             + + +L         D S  +I  V  ++ +I++VD K L+ ++D L+ K++  I++L
Sbjct: 743 LEQARAKLAASAGNDLADKSAVEIKGVKVLAAVINDVDPKALRGMVDNLKDKLKPAIVLL 802

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQ 887
              S + K S++  VT D   +  A DL    A  + GG GGGRP MA  GG +      
Sbjct: 803 AA-SADGKISLVGGVTADQTAKVKAGDLVGFVAAQV-GGKGGGRPDMAMGGGTDVAALPA 860

Query: 888 AIAGVASFLKK 898
           AIA V  ++ +
Sbjct: 861 AIASVQDWVNE 871


>gi|293392770|ref|ZP_06637088.1| alanine-tRNA ligase [Serratia odorifera DSM 4582]
 gi|291424629|gb|EFE97840.1| alanine-tRNA ligase [Serratia odorifera DSM 4582]
          Length = 875

 Score =  944 bits (2440), Expect = 0.0,   Method: Composition-based stats.
 Identities = 390/910 (42%), Positives = 554/910 (60%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRAYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT    F+
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKNDAIAYAWELLTGENWFN 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY+ D+EAF +W+   G+ A++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKEKLWVTVYETDDEAFNIWQNEIGIPAERIIRIGDNKGAPFASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS+ E+G+RYIEIWN+VFMQF +Q+      LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSAEEDGDRYIEIWNIVFMQFNRQSDGTMLPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NY+IDLF+ LI+A  +VTG      +  + RVI DH+RS +FLI+DG++
Sbjct: 243 RIAAVLQHVNSNYEIDLFRTLIEAVAKVTGATD--LDNKSLRVIADHIRSCAFLISDGVI 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  +     L+  L   MG A  EL   + ++E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKDTFFYKLVAPLIGVMGPAADELKSQQAMVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   RGL 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLQ-GDTLDGETAFRLYDTYGFPVDLTADVCRERGLK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+E QR RAR       S      + SL    GA++F GYD          
Sbjct: 420 -VDEAGFEAAMEAQRRRARE------SSGFGADYNSLIRVDGASEFCGYDH--------- 463

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                         +   + + A+ + G+ V+E  +G++  VV D TPFY E+GGQ+GD 
Sbjct: 464 --------------DQQQAKITALFRDGQPVDEIHAGEEAVVVLDATPFYGESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G          + D QK       H   + +G+L+   S+   ID   R ++ +NHSATH
Sbjct: 510 GILKSAAAEFVVGDTQKYG-QAIGHQGKLAQGVLKVGDSVDALIDQVRRNRIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV+Q GS +    LRFD +H + +   +++++ED VN  + +NLPV T
Sbjct: 569 LLHAALRQVLGEHVAQKGSLVNDKYLRFDFSHFEAMKPEQIRAVEDLVNQQVRRNLPVQT 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            +M  +DA   GA AL G KY+D VRV+++     G  S+ LCGGTH S TG+I L  I 
Sbjct: 629 EVMALDDAKEKGAMALFGEKYDDHVRVLTM-----GDFSTELCGGTHASRTGDIGLFRIQ 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AGIRRIEA+TG+ A + L  Q + L+ +A  +K    N+  +V  + +  R L+
Sbjct: 684 SESGTAAGIRRIEAVTGEGAIATLHQQSDLLQEVAHLVKGDGNNLSEKVRAVLDRTRTLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q    +         ++  V  +   +  V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKDQQAALESASLSSKAKQVNGVKLLVSQLDNVEPKMLRTMVDDLKNQLGSAIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L   + E K S++  VT+DL DR  A +L    A+ + GG GGGRP MAQ+GG + N   
Sbjct: 804 LATTA-EGKVSLIAGVTKDLTDRVKAGELIGNVAQQV-GGKGGGRPDMAQAGGSDVNALP 861

Query: 887 QAIAGVASFL 896
            A+  V +++
Sbjct: 862 AALDSVEAWV 871


>gi|222086162|ref|YP_002544694.1| alanyl-tRNA synthetase protein [Agrobacterium radiobacter K84]
 gi|221723610|gb|ACM26766.1| alanyl-tRNA synthetase protein [Agrobacterium radiobacter K84]
          Length = 886

 Score =  944 bits (2439), Expect = 0.0,   Method: Composition-based stats.
 Identities = 508/896 (56%), Positives = 656/896 (73%), Gaps = 36/896 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+TFL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG E+  Y  
Sbjct: 1   MSGVNEIRSTFLDYFKKNGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEQRPYTT 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            +T QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKERAI+LAW+L+TKEF L
Sbjct: 61  ASTAQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKERAIELAWNLITKEFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
           D +RL +TVY  D++AF LWKKI+GLS DKIIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 121 DAKRLLVTVYHTDDDAFNLWKKIAGLSDDKIIRIPTSDNFWAMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R+IEIWNLVFMQFEQ  KQER  LP+ SIDTGMGLER+A VLQ 
Sbjct: 181 DHIWGGPPGSPEEDGDRFIEIWNLVFMQFEQITKQERVDLPRPSIDTGMGLERVAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           K +NYDIDLF+ LI+ASE+ TG+K EG +  +HRVI DHLRSS+FLIADG+LP+NEGRGY
Sbjct: 241 KHDNYDIDLFRALIEASEEATGVKAEGEHRASHRVIADHLRSSAFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  LLPAL  +MG AYPEL++A+ L  ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAKEPLMWRLLPALVQQMGRAYPELVRAEALTSETLKLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL+   S L K + L+G+ AFKLYDT+G PLD+ QD L ARG  G+DI SF 
Sbjct: 361 KTLERGLSLLNDATSTLHKGDSLDGETAFKLYDTYGFPLDLTQDALRARG-IGVDISSFT 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E Q++ AR+H  G G   TE IWF LKEK+GAT+F+GYD                  
Sbjct: 420 DAMERQKAEARSHWTGSGDKATETIWFELKEKHGATEFLGYD------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +++AIV+ G  V+ A +G KV+++ +QTPFY E+GGQ+GDTG    D  
Sbjct: 462 -----TEVAEGVIQAIVKDGVAVDSASAGDKVQIIVNQTPFYGESGGQMGDTGVISSDTG 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           +L ++D QKK EG+FVH A V  G ++T  ++VLT+D+  R +L  NHSATHLLH AL  
Sbjct: 517 KLAVSDTQKKGEGLFVHIATVSDGTIKTGDAVVLTVDHNRRSRLRANHSATHLLHEALRE 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG+HV+Q GS + P+ LRFDV+H KP+++ ELK +ED  N+I+ QN PV TR+M+ +DA
Sbjct: 577 VLGTHVAQKGSLVAPERLRFDVSHPKPMSAEELKIVEDMANEIVLQNSPVTTRLMSVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSVEY-----EDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+       + G  +S  LCGGTH S+TG+I L+ I+ +S
Sbjct: 637 IAEGAMALFGEKYGDEVRVVSMGQGVRGAKAGKPYSIELCGGTHASATGQIGLIRILGDS 696

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
           ++ AG+RRIEA+TG+ AR +L  QD+++K+LA+ LKV   +VV RVE + +E RKL+   
Sbjct: 697 AVGAGVRRIEAVTGESARDYLAEQDDRVKALATALKVQPTDVVSRVEALMDERRKLEREL 756

Query: 775 AKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
           A  K +L +         +   I  V F+   IS VD K+LK + D  +  + SG++ L+
Sbjct: 757 ADAKRKLAMGGGQGGSADAVRDINGVKFLGKAISGVDPKDLKGLADEGKTSLGSGVVALI 816

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNK 884
           G+S++ KAS ++ VT+DL+ RF+AVDL R+++  LGG GGGGRP MAQ+GGP+G K
Sbjct: 817 GVSEDGKASAVVAVTDDLIGRFSAVDLVRIASAALGGKGGGGRPDMAQAGGPDGAK 872


>gi|222148884|ref|YP_002549841.1| alanyl-tRNA synthetase [Agrobacterium vitis S4]
 gi|221735870|gb|ACM36833.1| alanyl-tRNA synthetase [Agrobacterium vitis S4]
          Length = 887

 Score =  943 bits (2438), Expect = 0.0,   Method: Composition-based stats.
 Identities = 487/909 (53%), Positives = 645/909 (70%), Gaps = 36/909 (3%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+TFL++F+ NGHE++ SS L+P NDPTLMFTN+GMV FKN+FTG E   Y  
Sbjct: 1   MSGVNDIRSTFLDYFKTNGHEVVASSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE AI+LAW+L+T+EF +
Sbjct: 61  ATTAQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKENAIELAWNLITREFGI 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
           D+ +L +TVY  D+EAF LWKKI+GL  +KIIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 121 DRDKLCVTVYHTDDEAFGLWKKIAGLPEEKIIRIGTSDNFWAMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGS-SEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R+IEIWNLVFMQ+EQ  K++R  LP+ SIDTGMGLER+A +LQ 
Sbjct: 181 DHIWGGPPGSADEDGDRFIEIWNLVFMQYEQVTKEQRVDLPRPSIDTGMGLERVAALLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           K +NYDIDLF+ LI AS  +TG+  EG    +HRVI DHLRSS+FLIADG+LP+NEGRGY
Sbjct: 241 KHDNYDIDLFRALIDASVDLTGVPAEGERRASHRVIADHLRSSAFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A LLG  +P++  LLP L  +MG AYPEL++A+ LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAELLGSRDPMIYKLLPVLVQQMGRAYPELVRAEALISETLKLEENRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL    + L K + ++G+ AFKLYDT+G PLD+ QD L ARG  G+DI  FN
Sbjct: 361 KTLERGLSLLSDATATLNKGDSIDGETAFKLYDTYGFPLDLTQDALRARG-IGVDITGFN 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A++ Q++ ARA   G G    E +WF LK+K+GAT+F+GY                   
Sbjct: 420 DAMQRQKAEARASWSGSGDKAMETVWFELKDKHGATEFLGY------------------- 460

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                       ++A+V+ G ++E+A +G+ V+VV +QTPFY E+GGQ+GDTG  +GDG 
Sbjct: 461 ----SAESAEGEIQALVRDGAVIEQATAGENVQVVVNQTPFYGESGGQVGDTGEIVGDGF 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
            L++ D  KK EG+FVH A V  G +R    + L +D+  R +L  NHSATHLLH AL  
Sbjct: 517 VLEVRDTLKKGEGLFVHVATVREGTVRAGTVVALNVDHARRSRLRANHSATHLLHEALRD 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LGSHV+Q GS + P+ LRFD++H KP+T+ ELK +ED  N+II QN  V TR+M  +DA
Sbjct: 577 VLGSHVAQKGSLVAPERLRFDISHPKPVTAEELKIVEDMANEIIVQNAAVTTRLMAVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSV-----EYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+       + G  +S  LCGGTHVS+TG+I L+ +V+ES
Sbjct: 637 IAEGAMALFGEKYGDEVRVVSMGTVVRGPKAGRPYSIELCGGTHVSATGDIGLVRLVAES 696

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
           ++ AG+RRIEA+TG+ AR++L  QDE++K+LAS LKV   +VV RVE + +E RKL+   
Sbjct: 697 AVGAGVRRIEALTGESARAYLAEQDERVKALASALKVQPVDVVSRVEALVDERRKLEREL 756

Query: 775 AKRKLQLNVEDLSC------HKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
           A  K +L +   S        ++  + F+   ++ +D K+LK + D  +  + SG+++L+
Sbjct: 757 ADAKRKLAMGGGSTGAADVPRELGGIKFIGKQLAGIDPKDLKGMADEAKSVLGSGVVLLI 816

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQA 888
            ++++ KAS +  VT DL  + +AVDL R+++  LGG GGGGRP MAQ+GGP+G KAD A
Sbjct: 817 AVAEDGKASAVASVTGDLTSKVSAVDLVRIASSALGGKGGGGRPDMAQAGGPDGAKADDA 876

Query: 889 IAGVASFLK 897
           I  VA  ++
Sbjct: 877 IEAVAKAIE 885


>gi|150396732|ref|YP_001327199.1| alanyl-tRNA synthetase [Sinorhizobium medicae WSM419]
 gi|205830211|sp|A6U9N4|SYA_SINMW RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|150028247|gb|ABR60364.1| alanyl-tRNA synthetase [Sinorhizobium medicae WSM419]
          Length = 887

 Score =  943 bits (2437), Expect = 0.0,   Method: Composition-based stats.
 Identities = 495/894 (55%), Positives = 653/894 (73%), Gaps = 37/894 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+ FL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG E+  Y  
Sbjct: 1   MSGVNEIRSMFLDYFRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEQRPYST 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             T QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKERAI+LAW+L+TKE+ L
Sbjct: 61  AATAQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKERAIELAWNLITKEYGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
           D +RL +TVY  D+EAF LWKKI+GLS D+IIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 121 DAKRLLVTVYHTDDEAFGLWKKIAGLSDDRIIRIATSDNFWAMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGS-SEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R+IEIWNLVFMQ+EQ  K+ER  LP+ SIDTGMGLER+A VLQ 
Sbjct: 181 DHIWGGPPGSADEDGDRFIEIWNLVFMQYEQITKEERVDLPRPSIDTGMGLERLAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           + +NYDIDLF+ LI ASE+ TG+K EG+   +HRVI DHLRSS+FLIADG+LP+NEGRGY
Sbjct: 241 QHDNYDIDLFRALIAASEEATGVKAEGDRRASHRVIADHLRSSAFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  +PLM  LLPAL  +MG AYPEL++A+ LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAQDPLMWKLLPALVGQMGRAYPELVRAEALISETLKLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL+   + L + +  NG+ AFKLYDT+G PLD+ QD L A+G  G+D  +F 
Sbjct: 361 KTLERGLNLLEEASADLSEGDQFNGETAFKLYDTYGFPLDLTQDALRAKG-IGVDTDAFT 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A++ Q++ ARA+  G G   TE IWF L++K+GAT F+GYD                  
Sbjct: 420 AAMQRQKAEARANWTGSGDAATETIWFELRDKHGATDFLGYD------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +++AIV+ G +VE A  G+ V++V +QTPFY E+GGQ+GDTG    +  
Sbjct: 462 -----TESAEGVIQAIVRDGTVVESASKGETVQLVLNQTPFYGESGGQVGDTGVVTTESG 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           +L +TD QK+ EG+FVH+ +VE G ++T  +  L +D+  R +L  NHSATHLLH AL  
Sbjct: 517 KLTVTDTQKRGEGLFVHYCVVEEGSVKTGEAAALAVDHARRTRLRANHSATHLLHEALRE 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG+HVSQ GS + P+ LRFDV+H KP+TS ELK +E+  N+II QN PVVTR+M+ +DA
Sbjct: 577 VLGTHVSQKGSLVAPERLRFDVSHPKPMTSEELKVVEEMANEIIVQNTPVVTRLMSVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSV-----EYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+       + G  +S  LCGGTHVS+TG+I L+ IVSES
Sbjct: 637 IAEGAMALFGEKYGDEVRVVSMGQGLHGSKAGKAYSVELCGGTHVSATGDIGLVRIVSES 696

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
           ++ +G+RR+EA+TG+ AR++L  QDE++K+LA+ LKV   +V+GRVE + +E RKL+   
Sbjct: 697 AVGSGVRRVEALTGEAARAYLGEQDERVKALAAALKVQPSDVLGRVESLLDERRKLEREL 756

Query: 775 AKRKLQLNVEDL-------SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
            + K +L +          +  +I  V F+  ++S V+ K+LKS+ D  +K + SG++  
Sbjct: 757 TEAKKKLALAGDGQNGSGEAAREIGGVRFLGRVVSGVEPKDLKSLADDGKKTLGSGVVAF 816

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPN 881
           VG+S + KAS ++ VT+DL  + +AVDL R+++  LGG GGGGRP MAQ+GGP+
Sbjct: 817 VGVSGDGKASAVVAVTDDLTSKVSAVDLVRVASAALGGKGGGGRPDMAQAGGPD 870


>gi|317403428|gb|EFV83940.1| alanyl-tRNA synthetase [Achromobacter xylosoxidans C54]
          Length = 874

 Score =  943 bits (2437), Expect = 0.0,   Method: Composition-based stats.
 Identities = 395/911 (43%), Positives = 544/911 (59%), Gaps = 53/911 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              S IR  FL+FF+  GH ++PSSSL+P NDPTL+FTNSGMV FK++FTG+E   Y   
Sbjct: 1   MKSSEIRQQFLQFFKSKGHTIVPSSSLVPGNDPTLLFTNSGMVQFKDVFTGKESRSYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT+ + L 
Sbjct: 61  TSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIQYAWELLTQVYKLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW MA+TGPCGPCSE
Sbjct: 121 AEKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWQMADTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  I GG PGS  E+G+RYIEIWNLVFMQFE+        LP+  +DTGMGLER+
Sbjct: 181 IFYDHGPEIWGGPPGSPEEDGDRYIEIWNLVFMQFERDAAGNMPRLPRPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI A+ + TG+K   NN  + +VI DH+R+ SFLI DG++P+
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIAAAARETGVKDLENN--SLKVIADHIRACSFLIVDGVIPS 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG T P    L+P L  EMG AYPEL      + + L+ 
Sbjct: 299 NEGRGYVLRRIVRRALRHGYKLGQTRPFFHRLVPDLVAEMGEAYPELAATAERVAQVLKQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGI 413
           E+ERFG+TL+ G+ +LDG L+++ K   L+G   F LYDT+G P+D+  DI   R    +
Sbjct: 359 EEERFGETLEHGMRILDGALANVPKGGQLDGTTLFTLYDTYGFPVDLTADICRER-EVDV 417

Query: 414 DIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDR 473
           D+  F  A+E QR +ARA      +         L  +   T+F GY+ L          
Sbjct: 418 DMAGFEVAMERQRDQARAAGKFKMAEG-------LSYEGAETRFEGYEKLELDNV----- 465

Query: 474 KVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGC 533
                             V A+   G  V++  +GQ   VV D TPFYAE+GGQ+GDTG 
Sbjct: 466 -----------------KVTALYVDGTQVQQVQAGQSAVVVLDATPFYAESGGQVGDTGL 508

Query: 534 AIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLL 593
               G+R  + D  K   G+F HH  +E G L    +++  +D   R +   NHSATHL+
Sbjct: 509 LEAAGVRFAVGDTLKIQSGVFGHHGTLEEGKLAVGDTVLARVDAVRRARTVRNHSATHLM 568

Query: 594 HHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRI 653
           H AL  +LG+HV Q GS + PD  RFD     P+T+ ++  +E  VN  I  N P V ++
Sbjct: 569 HKALRQVLGAHVQQRGSLVDPDKTRFDFAQDAPLTAEQIARVEAIVNAEILANQPTVAQV 628

Query: 654 MNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSE 713
           M  +DA+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IVSE
Sbjct: 629 MAYDDAVKGGAMALFGEKYGDTVRVLDIG------FSRELCGGTHVGRTGDIGLFKIVSE 682

Query: 714 SSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLI 773
             + AG+RRIEAITG  A + +  Q   L  +A  L+ +  ++  R+ ++ ++ ++L+  
Sbjct: 683 GGVAAGVRRIEAITGDNALAWVQNQSALLAQVAGMLRSTPADLPARISQVQDQVKQLEKD 742

Query: 774 HAKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
             + + +L           +  ++  +  ++  I +VD K L+ ++D L+ +++  +++L
Sbjct: 743 LEQSRSKLAASAGNDLASSAAVEVKGIKLLAASIGDVDPKALRGMVDNLKDRLKPAVVLL 802

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQ 887
              S + K SV+  VT DL +R  A DL    A  + GG GGGRP MA  GG +      
Sbjct: 803 ATGSADGKISVVGGVTADLTNRIKAGDLVGFVASQV-GGKGGGRPDMAMGGGTDIAALPA 861

Query: 888 AIAGVASFLKK 898
           AIA V  ++ +
Sbjct: 862 AIASVQKWVDE 872


>gi|311105349|ref|YP_003978202.1| alanyl-tRNA synthetase [Achromobacter xylosoxidans A8]
 gi|310760038|gb|ADP15487.1| alanyl-tRNA synthetase [Achromobacter xylosoxidans A8]
          Length = 874

 Score =  943 bits (2436), Expect = 0.0,   Method: Composition-based stats.
 Identities = 399/911 (43%), Positives = 546/911 (59%), Gaps = 53/911 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              S IR  FL+FF+  GH ++PSSSL+P NDPTL+FTNSGMV FK++FTG+E   Y   
Sbjct: 1   MKSSEIRQQFLQFFKSKGHTIVPSSSLVPGNDPTLLFTNSGMVQFKDVFTGKESRSYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT+ + L 
Sbjct: 61  TSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIQYAWELLTQVYKLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY ED+EA+ +W K  G+ A++IIRI  N       DNFW MA+TGPCGPCSE
Sbjct: 121 AEKLWVTVYQEDDEAYDIWAKEVGVPAERIIRIGDNKGARYASDNFWQMADTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  I GG PGS  E+G+RYIEIWNLVFMQFE+        LP+  +DTGMGLER+
Sbjct: 181 IFYDHGPEIWGGPPGSPEEDGDRYIEIWNLVFMQFERDAAGNMPRLPRPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ+  +NY+IDLF+HLI A+ + TG+K       + +VI DH+R+ SFLI DG++P+
Sbjct: 241 AAVLQDVHSNYEIDLFQHLIAAAARETGIK--NLEDNSLKVIADHIRACSFLIVDGVIPS 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG T+P    L+P L  EMG AYPEL      + + L+ 
Sbjct: 299 NEGRGYVLRRIVRRALRHGYKLGQTKPFFHRLVPDLVAEMGDAYPELAATADRVAQVLKQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGI 413
           E+ERFG+TL+ G+ +LD  L+++ K   L+G   F LYDT+G P+D+  DI   R L  +
Sbjct: 359 EEERFGETLEHGMRILDSALANVPKGGQLDGMTLFTLYDTYGFPVDLTADICREREL-DV 417

Query: 414 DIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDR 473
           D+  F  A+E QR +ARA      +         L  +   T+F GY+ L          
Sbjct: 418 DMAGFEVAMERQRDQARAAGKFKMAEG-------LSYEGADTRFEGYEKLELDGV----- 465

Query: 474 KVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGC 533
                             V A+   G  V++  +GQ   VV D TPFYAE+GGQ+GDTG 
Sbjct: 466 -----------------KVTALYVDGTQVQQVKAGQSAVVVLDATPFYAESGGQVGDTGL 508

Query: 534 AIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLL 593
              DG+R  + D  K   G+F HH  +E G L    +L+  +D   R +   NHSATHL+
Sbjct: 509 LEADGVRFAVADTLKIQAGVFGHHGELESGTLSVGDTLLARVDAVRRARTVRNHSATHLM 568

Query: 594 HHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRI 653
           H AL  +LG+HV Q GS + PD  RFD     P+T+ ++  +E  VN  I  N P V ++
Sbjct: 569 HKALRQVLGAHVQQRGSLVDPDKTRFDFAQDAPLTAEQIARVEAIVNAEILANQPTVAQV 628

Query: 654 MNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSE 713
           M  +DA+  GA AL G KY D VRV+ +        S  LCGGTHVS TG+I L  IVSE
Sbjct: 629 MAYDDAVKGGAMALFGEKYGDTVRVLDIG------FSRELCGGTHVSRTGDIGLFKIVSE 682

Query: 714 SSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLI 773
             + AG+RRIEAITG  A + +  Q+  L  +A  L+ +  ++  R+ ++ E+ + L+  
Sbjct: 683 GGVAAGVRRIEAITGDNALAWVQNQNALLTQVAGMLRSTPADLPARIAQVQEQVKSLEKD 742

Query: 774 HAKRKLQLNVED------LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
             + + +L           +  ++  +  ++  I +VD K L+ ++D L+ +++  +++L
Sbjct: 743 LEQSRNKLAASAGNDLATSAAVEVKGIKVLAASIGDVDPKALRGMVDNLKDRLKPAVVLL 802

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQ 887
              S + K SV+  VT DL  R  A DL    A  + GG GGGRP MA  GG +      
Sbjct: 803 ATGSADGKISVVGGVTADLTGRVKAGDLVGFVAAQV-GGKGGGRPDMAMGGGTDLAALPA 861

Query: 888 AIAGVASFLKK 898
           AIA V  ++ +
Sbjct: 862 AIASVQKWVDE 872


>gi|157369088|ref|YP_001477077.1| alanyl-tRNA synthetase [Serratia proteamaculans 568]
 gi|157320852|gb|ABV39949.1| alanyl-tRNA synthetase [Serratia proteamaculans 568]
          Length = 892

 Score =  942 bits (2434), Expect = 0.0,   Method: Composition-based stats.
 Identities = 393/910 (43%), Positives = 555/910 (60%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 20  KSTAEIRQAFLDFFHSKGHQVVASSSLVPDNDPTLLFTNAGMNQFKDVFLGLDKRAYSRA 79

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT    F+
Sbjct: 80  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAISYAWELLTGENWFN 139

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EAF +W++  G+ A++IIRI  N       DNFW M +TGPCGPC
Sbjct: 140 LPKERLWVTVYETDDEAFDIWQQQIGVPAERIIRIGDNKGGAFASDNFWQMGDTGPCGPC 199

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWNLVFMQF +Q+      LPK S+DTGMGLE
Sbjct: 200 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNLVFMQFNRQSDGTMLPLPKPSVDTGMGLE 259

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NY+IDLF  LI A  +VTG      +  + RVI DH+RS +FL++DG+ 
Sbjct: 260 RIAAVLQHVNSNYEIDLFSKLIAAVAKVTGATD--LDNKSLRVIADHIRSCAFLVSDGVT 317

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NEGRGYVLRRI+RRA+ +  +LG  +     L+  L   MG A  EL + + L+E+ L
Sbjct: 318 PSNEGRGYVLRRIIRRAVRHGNMLGAKDTFFYKLVAPLIEVMGPAADELKRQQSLVEQVL 377

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+++F +TL+RGL LLD  L++L   + L+G+ AF+LYDT+G P+D+  D+   RGL 
Sbjct: 378 KTEEDQFARTLERGLTLLDEELANLQ-GDTLDGETAFRLYDTYGFPVDLTADVCRERGLK 436

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F QA+E QR RAR       S      + S+    GA+QF GYD          
Sbjct: 437 -VDEAGFEQAMEAQRRRARE------SSGFGADYNSMIRVDGASQFSGYDH--------- 480

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             S V A+ + G+ V E  +G++  VV D+TPFY E+GGQ+GD 
Sbjct: 481 --------------EQQQSTVTALFRDGQPVNEIHAGEEAVVVLDETPFYGESGGQVGDK 526

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G         +++D QK  +    H   +  G L+    +   ID   R ++ +NHSATH
Sbjct: 527 GVLKAANADFEVSDTQKYGQ-AIGHQGKLSHGSLKVNDRVDAKIDTVRRNRIRLNHSATH 585

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL   LG HV+Q GS +    LRFD +H + +   +++++ED VN  I +NLPV T
Sbjct: 586 LLHAALRQTLGEHVAQKGSLVNDKYLRFDFSHFEAMKPEQIRTVEDLVNQQIRRNLPVQT 645

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            +M  +DA   GA AL G KY+D VRV+++     G  S+ LCGGTH S TG+I L  I+
Sbjct: 646 EVMALDDAKGKGAMALFGEKYDDNVRVLTM-----GDFSTELCGGTHASRTGDIGLFRIL 700

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AGIRRIEA+TG  A + L  Q++ L+ +A  +K    N+  +V  + +  R L+
Sbjct: 701 SESGTAAGIRRIEAVTGDGAIATLHQQNDLLQDVAHLVKGDSNNLTDKVRAVLDRTRALE 760

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +  V++K L++++D L+ ++ S II+
Sbjct: 761 KELQQLKDQQAAQESASLSSKAKMVNGVQLLVSQLDNVEAKMLRTMVDDLKNQLGSAIIV 820

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L   + + K S++  VT+DL DR  A +L    A+ + GG GGGRP MAQ+GG + +   
Sbjct: 821 LATTA-DDKVSLIAGVTKDLTDRVKAGELIGNVAQQV-GGKGGGRPDMAQAGGTDVSALP 878

Query: 887 QAIAGVASFL 896
            A+  V +++
Sbjct: 879 AALDSVEAWV 888


>gi|327394965|dbj|BAK12387.1| alanyl-tRNA synthetase AlaS [Pantoea ananatis AJ13355]
          Length = 875

 Score =  942 bits (2434), Expect = 0.0,   Method: Composition-based stats.
 Identities = 395/910 (43%), Positives = 550/910 (60%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F GQEK  Y   
Sbjct: 3   KSTAEIRQAFLDFFNSKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGQEKRDYTRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  AW+LLT  + F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKKEAIAFAWELLTGEQWFK 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+ +W    G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYETDDEAYDIWANDIGVPRERIIRIGDNKGSAYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           SEIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 SEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMLPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+  VLQ   +NY+IDLF+ LI+A  +VTG      N  + RVI DH+RS +FLIADG++
Sbjct: 243 RITAVLQHVNSNYEIDLFQTLIEAVAKVTGATD--LNNKSLRVIADHIRSCAFLIADGVI 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  +     L+  L   MG+A  EL + +  +E  L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKDAFFYKLVAPLIQVMGAAGEELQRQQAQVENVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           +SE+E+F KTL+RGL LLD  L+ L   + L+G+  F+LYDT G P D+  D+   R L 
Sbjct: 361 KSEEEQFAKTLERGLALLDEELAKLQ-SDTLDGETVFRLYDTFGFPADLTADVCRERNLK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            ID   F +A+E+QR RAR              + ++     A+ F GY+ L        
Sbjct: 420 -IDEAGFEKAMEQQRQRAREA------SGFGADYSNVIRIDAASSFKGYEQLD------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           +++ VKA+   GE V+   +GQ   +V D+TPFY E+GGQ+GDT
Sbjct: 466 ----------------LTATVKALFVNGEAVDALSAGQDAVIVLDETPFYGESGGQVGDT 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G+     + D QK  +    H   +  G LR    L   +D   R ++ +NHSATH
Sbjct: 510 GELKGNNALFSVQDTQKYGQ-AIGHIGKLSSGQLRVGDRLEAVVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV+Q GS +    LRFD +H + +   E++ +ED VN  I +NLPV T
Sbjct: 569 LLHAALRQVLGEHVAQKGSLVNDKYLRFDFSHFEAMKPQEIRQVEDIVNAQIRRNLPVET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M+ E A A GA AL G KY+ +VRV+++     G  S  LCGGTH + TG+I L  I 
Sbjct: 629 RVMDLEAAKAKGAMALFGEKYDQQVRVLTM-----GDFSVELCGGTHAARTGDIGLFRIQ 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           +ES   AGIRRIEAITG+ A + +  Q  +L+ +A  +K +  N+  +V  + +  R L+
Sbjct: 684 AESGTAAGIRRIEAITGEAALAQVYAQSSQLQDIAQLVKANSSNLNEKVRGLVDHLRSLE 743

Query: 772 LIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + + Q   ++ +        +  V  +   +S  D K L++++D L+ ++ S II+
Sbjct: 744 KELQQLRDQQAAQESAQLGNHAVDVKGVKLLVTELSNTDPKMLRTMVDDLKNQLGSAIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ + K S++  VT+DL DR  A +L    A  + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-DGKVSLIAGVTKDLTDRVKAGELIAELAPKV-GGKGGGRPDMAQAGGSDATALK 861

Query: 887 QAIAGVASFL 896
            A+AGV  ++
Sbjct: 862 GALAGVEGWV 871


>gi|325293275|ref|YP_004279139.1| Alanyl-tRNA synthetase [Agrobacterium sp. H13-3]
 gi|325061128|gb|ADY64819.1| Alanyl-tRNA synthetase [Agrobacterium sp. H13-3]
          Length = 897

 Score =  940 bits (2430), Expect = 0.0,   Method: Composition-based stats.
 Identities = 488/897 (54%), Positives = 642/897 (71%), Gaps = 37/897 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+TFL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG E   Y  
Sbjct: 11  MSGVNEIRSTFLDYFKKNGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLESRPYST 70

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             + QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE AI  AW+L+TKEF +
Sbjct: 71  AASAQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEEAITHAWNLITKEFGI 130

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
           D+ RL +TVY  D+EAF LWKKI+G S D+IIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 131 DRNRLLVTVYHTDDEAFNLWKKIAGFSDDRIIRIPTSDNFWAMGDTGPCGPCSEIFYDHG 190

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R+IEIWNLVFMQ+EQ  K+ER  LP+ SIDTGMGLER++ +LQ 
Sbjct: 191 DHIWGGPPGSPEEDGDRFIEIWNLVFMQYEQLTKEERIDLPRPSIDTGMGLERISALLQG 250

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           K +NYD DLF+ LI AS + TG+  EG    +HRVI DHLRSS+FLIADG+LP+NEGRGY
Sbjct: 251 KHDNYDTDLFRALISASVEATGVPAEGEKRASHRVIADHLRSSAFLIADGVLPSNEGRGY 310

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A LLG  EPL+  LLPAL  +MG AYPEL++A+ LI ETL+ E+ RF 
Sbjct: 311 VLRRIMRRAMRHAELLGSREPLIYKLLPALIQQMGRAYPELVRAEALISETLKLEETRFR 370

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL    S L K ++L+G+ AFKLYDT+G PLD+ QD L AR   G+DI  F 
Sbjct: 371 KTLERGLSLLSDATSTLHKGDMLDGETAFKLYDTYGFPLDLTQDALRAR-EIGVDISGFT 429

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A++ Q++ AR+H  G G   TE +WF LKEK GAT+F+GYD                  
Sbjct: 430 DAMQRQKAEARSHWAGSGDKATETVWFELKEKLGATEFLGYD------------------ 471

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +++AIV+ G+ V+ A  G+ V++V +QTPFY E+GGQ+GDTG   GD  
Sbjct: 472 -----TETAEGVIQAIVKDGKSVDSAAEGETVQIVVNQTPFYGESGGQMGDTGVISGDNG 526

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
              +++ QKK EG+FVH   V +G L+ + ++ LT+D+  R +L  NHSATHLLH AL  
Sbjct: 527 TFTVSETQKKGEGLFVHSGTVSKGGLKLDDAVQLTVDHDRRSRLRANHSATHLLHEALRE 586

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG+HV+Q GS + P+ LRFDV+H KP+++ ELK +E+  N+I+ QN PVVTR+M+ +DA
Sbjct: 587 VLGTHVAQKGSLVAPERLRFDVSHPKPMSAEELKVVEEMANEIVLQNSPVVTRLMSVDDA 646

Query: 660 IASGAAALLGTKYNDRVRVVSVEYEDGG-----VHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+     G      +S  LCGGTHV++TG+I L+ I+ ES
Sbjct: 647 IAEGAMALFGEKYGDEVRVVSMGTGVHGAKANRPYSVELCGGTHVAATGQIGLIRILGES 706

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
           ++ AG+RR+EA+TGQ A ++L  QDE++K+LAS LKV  G+V+ RVE + +E +KL+   
Sbjct: 707 AVGAGVRRLEAVTGQGALAYLSEQDERVKALASSLKVQPGDVLSRVEGLLDERKKLEREL 766

Query: 775 AKRKLQLN-------VEDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
           A  + +L               ++A VNF++  +S +D+K+LK + D  +  I SG+++L
Sbjct: 767 ADARKKLAMGGGSSDAGANDVQQVAGVNFLAKSLSGIDAKDLKGLADEAKANIGSGVVLL 826

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNK 884
           + +S++ KAS +  VTEDL  RF+AVD+ R ++  LGG GGGGRP MAQ+GGP+G K
Sbjct: 827 IAVSEDGKASAVAAVTEDLTGRFSAVDIVRTASAALGGKGGGGRPDMAQAGGPDGAK 883


>gi|167587422|ref|ZP_02379810.1| alanyl-tRNA synthetase [Burkholderia ubonensis Bu]
          Length = 874

 Score =  940 bits (2430), Expect = 0.0,   Method: Composition-based stats.
 Identities = 381/912 (41%), Positives = 536/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTLMFTNSGMV FK++F G E   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTESRPYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + L 
Sbjct: 61  TTSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIRFAWELLTTVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW+M +TGPCGPC+E
Sbjct: 121 KEKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWTMGDTGPCGPCTE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKPCVDTGMGLERL 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ +VT +     N  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIKAAARVTEISD--LNNNSLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGSFFHKLVADLVAEMGVAYPELKEAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ +     ++L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALAEVEAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGMT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKAAQG-------LEYSGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVDGSSVNEVKTGQDAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    L   ID   R +   NHSATH
Sbjct: 509 GVLANASTRFAVGDTLKVQADVIGHHGTLEQGTLKVGDVLRAEIDAHRRARTQRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD  H+ P+T  E++ +E  VND I  N P + 
Sbjct: 569 LMHKALREVLGSHVQQKGSLVDADKTRFDFAHNAPMTDDEIRRVEQIVNDEILANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHVS TG+I    IV
Sbjct: 629 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVSRTGDIGFFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   D ++   A+ LK     +  R+ ++ ++ + L+
Sbjct: 683 VEGGVAAGIRRVEAITGDNAVRYVQELDARVNEAAAALKAQPSELTQRIAQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L         L   ++  V+ ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSKLASSQGDELALQAVEVGGVHVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT +   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LAAV-EGGKVSLIAGVTPEASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLKK 898
            A+AGV  ++++
Sbjct: 861 AALAGVKGWVEE 872


>gi|159184958|ref|NP_354854.2| alanyl-tRNA synthetase [Agrobacterium tumefaciens str. C58]
 gi|22096194|sp|Q8UE87|SYA_AGRT5 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|159140236|gb|AAK87639.2| alanyl-tRNA synthetase [Agrobacterium tumefaciens str. C58]
          Length = 887

 Score =  940 bits (2429), Expect = 0.0,   Method: Composition-based stats.
 Identities = 485/897 (54%), Positives = 641/897 (71%), Gaps = 37/897 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+TFL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG E   Y  
Sbjct: 1   MSGVNEIRSTFLDYFKKNGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLESRPYST 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             + QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE AI  AW+L+TKEF +
Sbjct: 61  AASAQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEEAITHAWNLITKEFGI 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
           D+ RL +TVY  D+EAF LWKKI+G S D+IIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 121 DRNRLLVTVYHTDDEAFNLWKKIAGFSDDRIIRIPTSDNFWAMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R+IEIWNLVFMQ+EQ  K+ER  LP+ SIDTGMGLER++ +LQ 
Sbjct: 181 DHIWGGPPGSPEEDGDRFIEIWNLVFMQYEQLTKEERIDLPRPSIDTGMGLERISALLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           K +NYD DLF+ LI AS + TG+  EG +  +HRVI DHLRSS+FLIADG+LP++EGRGY
Sbjct: 241 KHDNYDTDLFRALIAASVEATGVPAEGEHRASHRVIADHLRSSAFLIADGVLPSSEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A LLG  +PL+  LLPAL  +MG AYPEL++A+ LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAELLGSRDPLIYRLLPALIQQMGRAYPELVRAEALISETLKLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL    S L K ++L+G+ AFKLYDT+G PLD+ QD L AR   G+DI  F 
Sbjct: 361 KTLERGLSLLSDATSTLHKGDMLDGETAFKLYDTYGFPLDLTQDALRAR-EIGVDISGFT 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A++ Q++ AR+H  G G   TE +WF LKEK+GAT+F+GYD                  
Sbjct: 420 DAMQRQKAEARSHWAGSGDKATETVWFELKEKFGATEFLGYD------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +++AIV+ G+ V+ A  G+ V +V +QTPFY E+GGQ+GDTG  +GD  
Sbjct: 462 -----TESAEGVIQAIVRDGKEVDSAAEGETVHIVVNQTPFYGESGGQMGDTGVIVGDAG 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
              ++  QKK EG+FVH   V +G L+   ++ LT+D+  R +L  NHSATHLLH AL  
Sbjct: 517 TFDVSGTQKKGEGLFVHSGTVSKGGLKVNEAVQLTVDHDRRSRLRANHSATHLLHEALRE 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG+HV+Q GS + P+ LRFDV+H KP+++ ELK +ED  N+I+ QN PVVTR+M+ +DA
Sbjct: 577 VLGTHVAQKGSLVAPERLRFDVSHPKPMSAEELKVVEDMANEIVLQNSPVVTRLMSVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSVEYEDGG-----VHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+     G      +S  LCGGTHV++TG+I L+ I+ ES
Sbjct: 637 IAEGAMALFGEKYGDEVRVVSMGTGLHGAKANRPYSVELCGGTHVAATGQIGLIRILGES 696

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
           ++ +G+RR+EA+TGQ A ++L  QDE++K+LAS LKV  G+V+ RVE + +E +KL+   
Sbjct: 697 AVGSGVRRLEAVTGQGALAYLAEQDERVKALASSLKVQPGDVLSRVEGLLDERKKLEREL 756

Query: 775 AKRKLQLN-------VEDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
           A  + +L               ++A VNF++  +S +D+K+LK + D  +  + SG+++L
Sbjct: 757 ADARKKLAMGGGSSDAGANDVQQVAGVNFLAKSLSGIDAKDLKGLADEAKANLGSGVVLL 816

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNK 884
           + +S + KAS +  VTEDL  RF+AVD+ R ++  LGG GGGGRP MAQ+GGP+G K
Sbjct: 817 IAVSDDGKASAVAAVTEDLTGRFSAVDIVRTASAALGGKGGGGRPDMAQAGGPDGTK 873


>gi|291618585|ref|YP_003521327.1| AlaS [Pantoea ananatis LMG 20103]
 gi|291153615|gb|ADD78199.1| AlaS [Pantoea ananatis LMG 20103]
          Length = 875

 Score =  940 bits (2429), Expect = 0.0,   Method: Composition-based stats.
 Identities = 394/910 (43%), Positives = 549/910 (60%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F GQEK  Y   
Sbjct: 3   KSTAEIRQAFLDFFNSKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGQEKRDYTRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  AW+LLT  + F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKKEAIAFAWELLTGEQWFK 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+ +W    G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYETDDEAYDIWANDIGVPRERIIRIGDNKGSAYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           SEIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 SEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMLPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+  VLQ   +NY+IDLF+ LI+A  +VTG      N  + RVI DH+RS +FLIADG++
Sbjct: 243 RITAVLQHVNSNYEIDLFQTLIEAVAKVTGATD--LNNKSLRVIADHIRSCAFLIADGVI 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  +     L+  L   MG+A  EL + +  +E  L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKDAFFYKLVAPLIQVMGAAGEELQRQQAQVENVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           +SE+E+F KTL+RGL LLD  L+ L   + L+G+  F+LYDT G P D+  D+   R L 
Sbjct: 361 KSEEEQFAKTLERGLALLDEELAKLQ-GDTLDGETVFRLYDTFGFPADLTADVCRERNLK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            ID   F +A+E+QR RAR              + ++     A+ F GY+ L        
Sbjct: 420 -IDEAGFEKAMEQQRQRAREA------SGFGADYSNVIRIDAASSFKGYEQLD------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           +++ VK +   GE V+   +GQ   +V D+TPFY E+GGQ+GDT
Sbjct: 466 ----------------LTATVKGLFVNGEAVDALSAGQDAVIVLDETPFYGESGGQVGDT 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G+     + D QK  +    H   +  G LR    L   +D   R ++ +NHSATH
Sbjct: 510 GELKGNNALFSVQDTQKYGQ-AIGHIGKLSSGQLRVGDCLEAVVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV+Q GS +    LRFD +H + +   E++ +ED VN  I +NLPV T
Sbjct: 569 LLHAALRQVLGEHVAQKGSLVNDKYLRFDFSHFEAMKPQEIRQVEDIVNAQIRRNLPVET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M+ E A A GA AL G KY+ +VRV+++     G  S  LCGGTH + TG+I L  I 
Sbjct: 629 RVMDLEAAKAKGAMALFGEKYDQQVRVLTM-----GDFSVELCGGTHAARTGDIGLFRIQ 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           +ES   AGIRRIEAITG+ A + +  Q  +L+ +A  +K +  N+  +V  + +  R L+
Sbjct: 684 AESGTAAGIRRIEAITGEAALAQVYAQSSQLQDIAQLVKANSSNLNEKVRGLVDHLRSLE 743

Query: 772 LIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + + Q   ++ +        +  V  +   +S  D K L++++D L+ ++ S II+
Sbjct: 744 KELQQLRDQHAAQESAQLGNHAVDVKGVKLLVTELSNTDPKMLRTMVDDLKNQLGSAIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ + K S++  VT+DL DR  A +L    A  + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-DGKVSLIAGVTKDLTDRVKAGELIAELAPKV-GGKGGGRPDMAQAGGSDATALK 861

Query: 887 QAIAGVASFL 896
            A+AGV  ++
Sbjct: 862 GALAGVEGWV 871


>gi|205830246|sp|A8GA09|SYA_SERP5 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
          Length = 875

 Score =  940 bits (2429), Expect = 0.0,   Method: Composition-based stats.
 Identities = 393/910 (43%), Positives = 555/910 (60%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPDNDPTLLFTNAGMNQFKDVFLGLDKRAYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT    F+
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAISYAWELLTGENWFN 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EAF +W++  G+ A++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYETDDEAFDIWQQQIGVPAERIIRIGDNKGGAFASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWNLVFMQF +Q+      LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNLVFMQFNRQSDGTMLPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NY+IDLF  LI A  +VTG      +  + RVI DH+RS +FL++DG+ 
Sbjct: 243 RIAAVLQHVNSNYEIDLFSKLIAAVAKVTGATD--LDNKSLRVIADHIRSCAFLVSDGVT 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NEGRGYVLRRI+RRA+ +  +LG  +     L+  L   MG A  EL + + L+E+ L
Sbjct: 301 PSNEGRGYVLRRIIRRAVRHGNMLGAKDTFFYKLVAPLIEVMGPAADELKRQQSLVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+++F +TL+RGL LLD  L++L   + L+G+ AF+LYDT+G P+D+  D+   RGL 
Sbjct: 361 KTEEDQFARTLERGLTLLDEELANLQ-GDTLDGETAFRLYDTYGFPVDLTADVCRERGLK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F QA+E QR RAR       S      + S+    GA+QF GYD          
Sbjct: 420 -VDEAGFEQAMEAQRRRARE------SSGFGADYNSMIRVDGASQFSGYDH--------- 463

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             S V A+ + G+ V E  +G++  VV D+TPFY E+GGQ+GD 
Sbjct: 464 --------------EQQQSTVTALFRDGQPVNEIHAGEEAVVVLDETPFYGESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G         +++D QK  +    H   +  G L+    +   ID   R ++ +NHSATH
Sbjct: 510 GVLKAANADFEVSDTQKYGQ-AIGHQGKLSHGSLKVNDRVDAKIDTVRRNRIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL   LG HV+Q GS +    LRFD +H + +   +++++ED VN  I +NLPV T
Sbjct: 569 LLHAALRQTLGEHVAQKGSLVNDKYLRFDFSHFEAMKPEQIRTVEDLVNQQIRRNLPVQT 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            +M  +DA   GA AL G KY+D VRV+++     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 EVMALDDAKGKGAMALFGEKYDDNVRVLTM-----GDFSTELCGGTHASRTGDIGLFRIL 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AGIRRIEA+TG  A + L  Q++ L+ +A  +K    N+  +V  + +  R L+
Sbjct: 684 SESGTAAGIRRIEAVTGDGAIATLHQQNDLLQDVAHLVKGDSNNLTDKVRAVLDRTRALE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +  V++K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKDQQAAQESASLSSKAKMVNGVQLLVSQLDNVEAKMLRTMVDDLKNQLGSAIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L   + + K S++  VT+DL DR  A +L    A+ + GG GGGRP MAQ+GG + +   
Sbjct: 804 LATTA-DDKVSLIAGVTKDLTDRVKAGELIGNVAQQV-GGKGGGRPDMAQAGGTDVSALP 861

Query: 887 QAIAGVASFL 896
            A+  V +++
Sbjct: 862 AALDSVEAWV 871


>gi|148256734|ref|YP_001241319.1| alanyl-tRNA synthetase [Bradyrhizobium sp. BTAi1]
 gi|205829994|sp|A5EML9|SYA_BRASB RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|146408907|gb|ABQ37413.1| alanyl-tRNA synthetase [Bradyrhizobium sp. BTAi1]
          Length = 896

 Score =  939 bits (2428), Expect = 0.0,   Method: Composition-based stats.
 Identities = 473/916 (51%), Positives = 618/916 (67%), Gaps = 44/916 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+TFL FF  NGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG EK  Y  
Sbjct: 1   MSGVNEIRSTFLNFFAANGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRPYHR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE AI+LAW L+TKEF L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKENAIELAWKLVTKEFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + +L  TVY +D+EAF LWKKI+GL   +IIRI  +DNFW M +TGPCGPCSEIF+D G
Sbjct: 121 PKDKLTATVYIDDDEAFGLWKKIAGLPESRIIRIAGSDNFWQMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSSE-EGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + + GG PGS E +G+R+IEIWNLVFMQ+EQ     R  LPK SIDTG GLER+A VLQ 
Sbjct: 181 DKVWGGPPGSPEADGDRFIEIWNLVFMQYEQLEGGVRNPLPKPSIDTGAGLERVAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           K +NYDIDLF  LI+A   +T    +G    + RVI DHLR+SSFLI+DG+LP+NEGRGY
Sbjct: 241 KHDNYDIDLFVALIRAIADLTNADPQGPQKASLRVIADHLRASSFLISDGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  L+ AL  EMG AYPELI+A+ LI+ETLR E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAREPLMHKLVGALTREMGQAYPELIRAEALIKETLRLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL +LD   S L K ++ +GDVAF LYDT+G PLD+ QD L +RG   +D  SF 
Sbjct: 361 KTLERGLAILDEKSSTLKKGDMFDGDVAFTLYDTYGFPLDLTQDALKSRG-ISVDQASFT 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E QR++ARA   G G   TE +WF L+EK GAT+F+GY+                  
Sbjct: 420 DAMERQRAKARAAWAGSGEAATENVWFPLREKLGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T      V A+V+ G  VE   +G+   +V +QTPFY E+GGQ+GDTG   GDG+
Sbjct: 462 -----TETAEGAVTALVKDGAEVEGLKAGESGAIVLNQTPFYGESGGQVGDTGVMSGDGV 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           R++ITD QKKA  +FVH   VE+G L+   +L L +D+  R  +  NHSATH+LH AL  
Sbjct: 517 RVRITDTQKKAGDLFVHIGTVEQGTLKLGAALQLEVDHGRRSAIRANHSATHILHEALRQ 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG H++Q GS ++PD LRFD  H KPI++ EL  +ED  ND++ +N  V TR+M  +DA
Sbjct: 577 VLGDHIAQRGSLVSPDRLRFDFAHPKPISAEELARVEDIANDVVLENAEVTTRLMALDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSVEY-----------EDGGVHSSALCGGTHVSSTGEIMLL 708
             +GA AL G KY D VRVVS+              +    S  LCGGTHV  TG+I L+
Sbjct: 637 REAGARALFGEKYGDEVRVVSMGNAARDQASNAQASNAMGWSVELCGGTHVKRTGDIGLI 696

Query: 709 YIVSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYR 768
            + SES++ +G+RRIEA+T + AR+H        K+ A+ L+ +   V  R+  + EE +
Sbjct: 697 AVTSESAVSSGVRRIEALTARGARAHANHNLSLAKAAAAELRTTVDEVPARIAALMEERK 756

Query: 769 KLQLIHAKRKLQLNV--------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKI 820
           KL+   +  + +L +              ++A V  M+  +  V+ K+LKS++D  +K++
Sbjct: 757 KLERELSDARKKLAMGGGAAAGGSASGIREVAGVKLMARAVEGVEMKDLKSLVDEAKKQL 816

Query: 821 QSGIIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGP 880
            SG++ +VG +++ KA V++ VT DL  RFNAV+L R +++ LGG GGGGRP MAQ+GGP
Sbjct: 817 GSGVVAIVGRAEDGKAGVVVGVTADLTARFNAVELVRAASEALGGKGGGGRPDMAQAGGP 876

Query: 881 NGNKADQAIAGVASFL 896
           +G+KA+ A+A + S +
Sbjct: 877 DGSKAEAALAAIESAI 892


>gi|73540553|ref|YP_295073.1| alanyl-tRNA synthetase [Ralstonia eutropha JMP134]
 gi|83305858|sp|Q474F4|SYA_RALEJ RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|72117966|gb|AAZ60229.1| alanyl-tRNA synthetase [Ralstonia eutropha JMP134]
          Length = 874

 Score =  938 bits (2424), Expect = 0.0,   Method: Composition-based stats.
 Identities = 388/910 (42%), Positives = 532/910 (58%), Gaps = 55/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
             VS IR+ FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G +K  Y   
Sbjct: 1   MKVSDIRSKFLQFFESKGHTVVRSSSLVPANDPTLLFTNSGMVQFKDVFLGTDKRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLTK + L 
Sbjct: 61  TSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIQYAWELLTKVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY ED+EA+ +W K  G+  ++I+RI  N       DNFW MA+TGPCGPCSE
Sbjct: 121 AEKLWVTVYAEDDEAYDIWAKEVGVPTERIVRIGDNKGSRYASDNFWQMADTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IFFD G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFFDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDEQGNMTPLPKPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+A+ + T +     N  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQALIKAAARETHID--NLNQNSLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG   P    L+  L  +MG AYPEL  A+  + E L++
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGQKTPFFHKLVADLVAQMGEAYPELADAQGRVTEVLKA 358

Query: 354 EDERFGKTLDRGLVLLDGVLS--HLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +LD  L+   L   + L+G++AFKL+DT G PLD+ QD+   +   
Sbjct: 359 EEERFFETIENGMSILDAALADLKLKGGKTLDGELAFKLHDTFGFPLDLTQDVCREQ-EI 417

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ L        
Sbjct: 418 AVDEAAFDAAMNRQREQARAAGKFKMAAG-------LEYSGDKTVFHGYEKLELP----- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + + A+   G  V+    GQ   +V D TPFYAE+GGQ GD 
Sbjct: 466 -----------------QAKIIALYVDGAAVDAMQPGQTGVIVLDNTPFYAESGGQAGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G          + D  K    +F H   +E G L+   ++   +D   R +   NHSATH
Sbjct: 509 GVLKAGNAVFAVADTTKIQADVFGHQGTLEGGALKVGDTVQPQVDALRRARTVRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS +  D  RFD +H+ P+T  +++ +ED VN  I +N     
Sbjct: 569 LMHKALREVLGTHVQQKGSLVDADKTRFDFSHNAPMTDEQIRRVEDIVNAEILRNEDTHA 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM  +DA+ SGA AL G KY D VRV+S+        S  LCGGTHV  TG+I L  IV
Sbjct: 629 EIMPFDDAVKSGAMALFGEKYADDVRVLSIG------TSKELCGGTHVHRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  +L   D KL   A+ LK     +V R+ ++ E+ R L+
Sbjct: 683 VEGGVAAGIRRVEAITGDNALHYLQKLDAKLNEAAAALKAQPSELVPRIGQVQEQVRALE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K +L              +  +  ++  +   D K L+  MD L+ K+QS  I+
Sbjct: 743 KELERLKSKLASSQGDELAEQAVDVKGLKVLAAQLEGADVKTLRETMDKLKDKLQSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ + K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG    K  
Sbjct: 803 LAAVA-DGKVSLIAGVTADATGKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPGKLP 860

Query: 887 QAIAGVASFL 896
           QA++GV  ++
Sbjct: 861 QALSGVVEWV 870


>gi|227822193|ref|YP_002826164.1| alanyl-tRNA synthetase [Sinorhizobium fredii NGR234]
 gi|227341193|gb|ACP25411.1| alanyl-tRNA synthetase [Sinorhizobium fredii NGR234]
          Length = 887

 Score =  938 bits (2423), Expect = 0.0,   Method: Composition-based stats.
 Identities = 489/894 (54%), Positives = 650/894 (72%), Gaps = 37/894 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+ FL++F+KNGH+++PSS L+P NDPTLMFTN+GMV FKN+FTG E+  Y  
Sbjct: 1   MSGVNEIRSMFLDYFRKNGHDIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEQRPYST 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             T QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKERAI+LAW+L+TKE+ L
Sbjct: 61  AATAQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKERAIELAWNLITKEYGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
           D +RL +TVY  D+EAF LWKKI+G S D+IIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 121 DAKRLLVTVYHTDDEAFGLWKKIAGFSDDRIIRIPTSDNFWAMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGS-SEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           E I GG PGS  E+G+R+IEIWNLVFMQ+EQ  K+ER  LP+ SIDTGMGLER+A VLQ 
Sbjct: 181 EQIWGGPPGSADEDGDRFIEIWNLVFMQYEQITKEERVNLPRPSIDTGMGLERLAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           + +NYDIDLF+ LI ASE+ TG+K EG+   +HRVI DHLRSS+FLIADG+LP+NEGRGY
Sbjct: 241 QHDNYDIDLFRALIAASEEATGVKAEGDRRASHRVIADHLRSSAFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  LLPAL  +MG AYPEL++A+ LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAQEPLMWKLLPALVGQMGRAYPELVRAEALISETLKLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL    + L + +  +G+ AFKLYDT+G PLD+ QD L  +G+  +D  +F+
Sbjct: 361 KTLERGLSLLADASAGLSEGDQFDGETAFKLYDTYGFPLDLTQDALRTKGIT-VDTDAFS 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A++ Q++ ARA+  G G   TE IWF LKEK+GAT F+GYD                  
Sbjct: 420 TAMQRQKAEARANWAGSGEAATETIWFELKEKHGATDFLGYD------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +++AIV+ G +VE A  G+ V+++ +QTPFY E+GGQ+GDTG    +  
Sbjct: 462 -----TESAEGVIQAIVRDGAVVESASKGESVQLILNQTPFYGESGGQMGDTGVIATETG 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           ++ +TD QK+ EG+FVH+  V  GI++T  +  LT+D+  R +L  NHSATHLLH AL  
Sbjct: 517 KVAVTDTQKRGEGLFVHYGTVTEGIVKTGEAAALTVDHARRLRLRANHSATHLLHEALRE 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG+HV+Q GS + P+ LRFDV+H KP+++ EL+ +E+  N++I QN PV TR+M+ +DA
Sbjct: 577 VLGTHVAQKGSLVAPERLRFDVSHPKPMSAEELRIVEEMANEVIVQNTPVTTRLMSVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSV-----EYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+       + G  +S  LCGGTHVS+TG+I L+ +VSES
Sbjct: 637 IAEGAMALFGEKYGDEVRVVSMGQGIRGSKAGRPYSVELCGGTHVSATGDIGLVRVVSES 696

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
           ++ AG+RR+EA+TG+ AR++L  QDE++KSLAS LKV   +V+GRVE + +E RKL+   
Sbjct: 697 AVGAGVRRLEALTGEAARAYLNEQDERVKSLASALKVQPADVLGRVEALLDERRKLEREL 756

Query: 775 AKRKLQLNV-------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
            + K +L +          +  +I  V F+  ++S V+ K+LKS+ D  +K + SG++  
Sbjct: 757 TEAKKKLALVGDGENGSGDAAREIGGVRFLGKVVSGVEPKDLKSLADDGKKTLGSGVVAF 816

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPN 881
           VG+S + KAS ++ VT+DL  + +AVDL R+++  LGG GGGGRP MAQ+GGP+
Sbjct: 817 VGVSGDGKASAVVAVTDDLTSKVSAVDLVRVASAALGGKGGGGRPDMAQAGGPD 870


>gi|116252382|ref|YP_768220.1| alanyl-tRNA synthetase [Rhizobium leguminosarum bv. viciae 3841]
 gi|205830192|sp|Q1MFZ9|SYA_RHIL3 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|115257030|emb|CAK08124.1| putative alanyl-tRNA synthetase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 884

 Score =  938 bits (2423), Expect = 0.0,   Method: Composition-based stats.
 Identities = 493/904 (54%), Positives = 639/904 (70%), Gaps = 38/904 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+TFL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG EK  Y  
Sbjct: 1   MSGVNDIRSTFLDYFKKNGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEKRPYST 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RH TFFEMLGNFSFG YFKE AI+LAW L+T+ FDL
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHLTFFEMLGNFSFGDYFKENAIELAWKLVTEGFDL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + RL +TVY EDEEA  LWKKI+G S DKIIRI+T+DNFW M +TGPCGPCSEIF DQG
Sbjct: 121 PKNRLLVTVYSEDEEAATLWKKIAGFSDDKIIRISTSDNFWQMGDTGPCGPCSEIFIDQG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           E + GG PGS  E+G+R++E WNLVFMQFEQ     R  LP+ SIDTGMGLERMA +LQ 
Sbjct: 181 ENVWGGPPGSPEEDGDRFLEFWNLVFMQFEQTEPGVRNPLPRPSIDTGMGLERMACILQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             + +D DLF+ LI   E   G+K       +HRVI DHLRSS+FLIADG+LP+NEGRGY
Sbjct: 241 VQSVFDTDLFRTLIGTIEDTMGVK--AEGSASHRVIADHLRSSAFLIADGVLPSNEGRGY 298

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPL+  LLP L  +MG AYPEL++A+ LI ETL+ E+ RF 
Sbjct: 299 VLRRIMRRAMRHAQLLGAKEPLVYKLLPTLVQQMGRAYPELVRAEALISETLKLEENRFR 358

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL    + L K ++L+G+ AFKLYDT+G PLD+ QD L AR   G+DI  F 
Sbjct: 359 KTLERGLSLLSDATTDLAKGDMLDGETAFKLYDTYGFPLDLTQDALRAR-EIGVDISGFT 417

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A++ Q++ AR+H  G G   TE +WF LKEK+GAT+F+GYD                  
Sbjct: 418 DAMQRQKAEARSHWAGSGEKATETVWFELKEKHGATEFLGYD------------------ 459

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +V+AIV+ G +  EA +G KV++V  QTPFY E+GGQ+GDTG    D  
Sbjct: 460 -----TETAEGVVQAIVKDGAVAAEASAGDKVQIVVSQTPFYGESGGQMGDTGVISSDHG 514

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           +++I+D QK+ EG+FVH   V  G+ +   ++VLT+D+  R +L  NHSATHLLH AL  
Sbjct: 515 KIEISDTQKRGEGLFVHQGTVVDGVFKDGDAVVLTVDHARRSRLRANHSATHLLHEALRE 574

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG+HV+Q GS + P+ LRFDV+H KP+++ ELK +ED  N+I+ QN PV TR+M+ +DA
Sbjct: 575 VLGTHVAQKGSLVAPERLRFDVSHPKPMSAEELKIVEDMANEIVLQNSPVTTRLMSVDDA 634

Query: 660 IASGAAALLGTKYNDRVRVVSVEY-----EDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVV++       + G  +S  LCGGTHV +TG+I L+ ++ ES
Sbjct: 635 IAEGAMALFGEKYGDEVRVVAMGEGVRGAKAGKPYSIELCGGTHVGATGQIGLIRVLGES 694

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
           ++ AG+RRIEA+TG+ AR +L  QDE++K+LA+ LKV  G V+ RVE + +E RKL+   
Sbjct: 695 AVGAGVRRIEAVTGESAREYLAEQDERVKTLAASLKVQPGEVLSRVEALMDERRKLEKEL 754

Query: 775 AKRKLQLNVED------LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
           A  K +L +         +  ++A V F+   IS VD K+LK + D  +  I SG++ LV
Sbjct: 755 ADAKRKLAMGGGQGGSVDAVREVAGVKFLGKAISGVDPKDLKGLADDGKTSIGSGVVALV 814

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQA 888
           G+S + KAS ++ VT DL+ R++AVDL R+++  LGG GGGGRP MAQ+GGP+G+KAD+A
Sbjct: 815 GVSDDGKASAVVAVTPDLVQRYSAVDLVRIASAALGGKGGGGRPDMAQAGGPDGSKADEA 874

Query: 889 IAGV 892
           I  V
Sbjct: 875 IEAV 878


>gi|254245667|ref|ZP_04938988.1| Alanyl-tRNA synthetase, class IIc [Burkholderia cenocepacia PC184]
 gi|124870443|gb|EAY62159.1| Alanyl-tRNA synthetase, class IIc [Burkholderia cenocepacia PC184]
          Length = 897

 Score =  937 bits (2421), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/912 (42%), Positives = 537/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTLMFTNSGMV FK++F G +   Y   
Sbjct: 24  MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRA 83

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + L 
Sbjct: 84  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIKFAWELLTTVYQLP 143

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW+M +TGPCGPC+E
Sbjct: 144 KDKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWTMGDTGPCGPCTE 203

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK S+DTGMGLER+
Sbjct: 204 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKQSVDTGMGLERL 263

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ +VT +    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 264 AAVLQHVHSNYEIDLFQNLIKAAARVTEISDLTNN--SLKVIADHIRACSFLIVDGVIPG 321

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 322 NEGRGYVLRRIVRRAIRHGYKLGRKGAFFHKLVADLVAEMGTAYPELKEAEQRVTDVLRQ 381

Query: 354 EDERFGKTLDRGLVLLDGVLS--HLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+       ++L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 382 EEERFFETIEHGMSILEAALADVEAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGMT 441

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 442 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYSGAKTTFHGYEEIAFDD---- 489

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 490 ------------------AKVVALYVDGSAVNEVKAGQDAVVVLDHTPFYAESGGQVGDQ 531

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    L   ID Q R +   NHSATH
Sbjct: 532 GVLANAATRFAVADTLKVQADVIGHHGTLEQGTLKVGDVLRAEIDAQRRARTQRNHSATH 591

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS +  D  RFD  H+ P+T  E++ +E  VND I  N P + 
Sbjct: 592 LMHKALREVLGAHVQQKGSLVDADKTRFDFAHNAPMTDDEIRRVEQIVNDEILANAPGIV 651

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 652 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 705

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   D ++   A+ LK     +  R+ ++ E+ + L+
Sbjct: 706 VEGGVAAGIRRVEAITGDNAVRYVQELDARVNEAAAALKAQPSELTQRIAQVQEQVKSLE 765

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             +I  V  ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 766 KELGALKSKLASSQGDELAQQAVEIGGVYVLAATLDGADAKTLRETVDKLKDKLKSAAIV 825

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 826 LAAV-EGGKVSLIAGVTPDASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 883

Query: 887 QAIAGVASFLKK 898
            A+AGV  ++++
Sbjct: 884 GALAGVKGWVEE 895


>gi|170732737|ref|YP_001764684.1| alanyl-tRNA synthetase [Burkholderia cenocepacia MC0-3]
 gi|205830047|sp|B1K026|SYA_BURCC RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|169815979|gb|ACA90562.1| alanyl-tRNA synthetase [Burkholderia cenocepacia MC0-3]
          Length = 874

 Score =  937 bits (2421), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/912 (42%), Positives = 537/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTLMFTNSGMV FK++F G +   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIKFAWELLTTVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW+M +TGPCGPC+E
Sbjct: 121 KDKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWTMGDTGPCGPCTE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK S+DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKQSVDTGMGLERL 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ +VT +    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIKAAARVTEISDLTNN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGAFFHKLVADLVAEMGTAYPELKEAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLS--HLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+       ++L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALADVEAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGMT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYSGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVDGSAVNEVKAGQDAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    L   ID Q R +   NHSATH
Sbjct: 509 GVLANAATRFAVADTLKVQADVIGHHGTLEQGTLKVGDVLRAEIDAQRRARTQRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS +  D  RFD  H+ P+T  E++ +E  VND I  N P + 
Sbjct: 569 LMHKALREVLGAHVQQKGSLVDADKTRFDFAHNAPMTDDEIRRVEQIVNDEILANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 629 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   D ++   A+ LK     +  R+ ++ E+ + L+
Sbjct: 683 VEGGVAAGIRRVEAITGDNAVRYVQELDARVNEAAAALKAQPSELTQRIAQVQEQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             +I  V  ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSKLASSQGDELAQQAVEIGGVYVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LAAV-EGGKVSLIAGVTPDASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLKK 898
            A+AGV  ++++
Sbjct: 861 GALAGVKGWVEE 872


>gi|191171366|ref|ZP_03032915.1| alanyl-tRNA synthetase [Escherichia coli F11]
 gi|190908300|gb|EDV67890.1| alanyl-tRNA synthetase [Escherichia coli F11]
          Length = 876

 Score =  937 bits (2421), Expect = 0.0,   Method: Composition-based stats.
 Identities = 397/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    E+L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSERLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDATALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|256822655|ref|YP_003146618.1| alanyl-tRNA synthetase [Kangiella koreensis DSM 16069]
 gi|256796194|gb|ACV26850.1| alanyl-tRNA synthetase [Kangiella koreensis DSM 16069]
          Length = 875

 Score =  936 bits (2420), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/912 (42%), Positives = 540/912 (59%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL FF+  GH ++ SS LIP NDPTL+FTN+GMV FK+ F G +K  Y   
Sbjct: 1   MTTNQIRNAFLTFFENKGHHIVDSSPLIPANDPTLLFTNAGMVQFKDCFLGIDKRSYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI   W+LLT+EF L 
Sbjct: 61  TSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKKEAIAYCWELLTEEFKLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY+ED+EAF +W    G  AD+I RI  N       DNFW+M +TGPCGPCSE
Sbjct: 121 KEKLWVTVYEEDDEAFDIWVNDIGFPADRISRIGDNKGERYASDNFWAMGDTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           +F+D GE I GG P    E+G+R+IEIWNLVFMQF +Q       LPK S+DTGMGLER+
Sbjct: 181 VFYDHGEEIWGGPPGTPEEDGDRFIEIWNLVFMQFNRQKDGTMERLPKPSVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A +LQ   +NY+IDLF+HLI+++  +  +K    +  + RVI DH+RS +FLI DGI+P+
Sbjct: 241 AAILQGVHSNYEIDLFQHLIKSTADLLKVKD--LDNKSLRVIADHIRSCAFLILDGIVPS 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L   MG AYP L++ K LIE+ L  
Sbjct: 299 NEGRGYVLRRIVRRAVRHGHQLGAKGIFFAKLVQPLIEVMGEAYPALVEQKELIEKVLAK 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHL--GKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+E F +TLD+G+++LD  ++ L     + ++GD  FKLYDT+G P D+  DI   +GL 
Sbjct: 359 EEEAFARTLDKGMLILDQDIADLVETNGKTISGDTVFKLYDTYGFPQDLTADIAREKGLE 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F +A+ +QR RARA S           +         ++F GY   + +     
Sbjct: 419 -VDWDGFEKAMNQQRERARAASNFG------TDYNDNFSIDERSEFTGYHYTQQNV---- 467

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                              +V  +++  + V+E   G+K  V+  +TPFYAEAGGQ+GDT
Sbjct: 468 -------------------VVTRLLKGEDEVKELDQGEKGVVILAKTPFYAEAGGQVGDT 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G G    + D QK  +    H   V+RG    +  L   +D + R+    NHSATH
Sbjct: 509 GRLFGCGATFIVEDTQKLGD-AIAHIGYVQRGSFSNDAELTAEVDAERRQHTMRNHSATH 567

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  ILG+HV+Q GS + P+ LRFD ++ +P+T  +L+ IE  VN  I +N  V  
Sbjct: 568 LLHAALRDILGTHVTQKGSLVGPERLRFDFSNPEPVTQEQLRQIEALVNQKIYENHAVEA 627

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
             M+ ++A   GA AL G KY D VRV+++        S  LCGGTHV  TG+I    I+
Sbjct: 628 ATMSMDEAKEHGAMALFGEKYGDEVRVLTMSP-----FSVELCGGTHVQRTGDIGAFKIL 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES I AGIRRIEA TG  A + +   +  L+S+   LK     V  +V ++ ++ R+L+
Sbjct: 683 SESGIAAGIRRIEATTGAGAVNWMQSTEASLQSIGKLLKSEPSQVAEKVNQLMDKSRQLE 742

Query: 772 LIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 + +L     S        +  +  +   +  V++K L+ + D L+ K+ S I++
Sbjct: 743 KTIEALQSKLASSQGSDLASQAEDLNGIKLLVAKLEGVEAKALRDIQDQLKNKLGSSIVV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L GI++E K S+++ V++DL  +  A +L  + A  + GG GGGRP MAQ+GG +     
Sbjct: 803 L-GIAEEDKVSIIVGVSKDLTGKVKAGELVNMVASQV-GGKGGGRPDMAQAGGKDPAALP 860

Query: 887 QAIAGVASFLKK 898
            A+  V  ++ +
Sbjct: 861 AALDSVKPWVAE 872


>gi|172060378|ref|YP_001808030.1| alanyl-tRNA synthetase [Burkholderia ambifaria MC40-6]
 gi|205829999|sp|B1YNJ6|SYA_BURA4 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|171992895|gb|ACB63814.1| alanyl-tRNA synthetase [Burkholderia ambifaria MC40-6]
          Length = 874

 Score =  936 bits (2420), Expect = 0.0,   Method: Composition-based stats.
 Identities = 378/912 (41%), Positives = 536/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTLMFTNSGMV FK++F G +   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIRFAWELLTTVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW+M +TGPCGPC+E
Sbjct: 121 KEKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWTMGDTGPCGPCTE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK S+DTGMGLER+
Sbjct: 181 IFYDHGPEVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKQSVDTGMGLERL 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ +VT +    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIKAAARVTEISDLTNN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGSFFHKLVADLVAEMGAAYPELKEAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLS--HLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+       ++L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALADVEAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGMT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYTGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVDGSAVNEVKAGQDAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    L   ID   R +   NHSATH
Sbjct: 509 GVLANAATRFAVADTLKVQADVVGHHGTLEQGTLKLGDVLRAEIDAHRRARTQRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS +  +  RFD  H+ P+T  E++ +E  VN+ I  N P + 
Sbjct: 569 LMHKALREVLGAHVQQKGSLVDAEKTRFDFAHNAPMTDDEIRRVEQIVNNEILANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I    IV
Sbjct: 629 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGFFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   D ++   A+ LK     +  R+ ++ ++ + L+
Sbjct: 683 VEGGVAAGIRRVEAITGDNAVRYVQELDARVNEAAAALKAQPSELTQRIAQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             ++  V  ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSKLASSQGDELAQQATEVGGVYVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG +     
Sbjct: 803 LAAV-EGGKVSLIAGVTPDASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTDPANLP 860

Query: 887 QAIAGVASFLKK 898
            A+AGV  ++++
Sbjct: 861 GALAGVKGWVEE 872


>gi|205830048|sp|A0K6N4|SYA_BURCH RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
          Length = 874

 Score =  936 bits (2419), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/912 (41%), Positives = 539/912 (59%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTLMFTNSGMV FK++F G +   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIKFAWELLTTVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW+M +TGPCGPC+E
Sbjct: 121 KDKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWTMGDTGPCGPCTE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK S+DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKQSVDTGMGLERL 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ +VT +    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIKAAARVTEISDLTNN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGAFFHKLVADLVAEMGTAYPELKEAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ +     ++L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALAEVEAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGMT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYSGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVDGSAVNEVKAGQDAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    L   ID Q R +   NHSATH
Sbjct: 509 GVLANAATRFAVADTLKVQADVIGHHGTLEQGTLKVGDVLRAEIDAQRRARTQRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS +  D  RFD  H+ P+T  E++ +E  VN+ I  N P + 
Sbjct: 569 LMHKALREVLGAHVQQKGSLVDADKTRFDFAHNAPMTDDEIRRVEQIVNNEILANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 629 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   D ++   A+ LK     +  R+ ++ E+ + L+
Sbjct: 683 VEGGVAAGIRRVEAITGDNAVRYVQELDARVNEAAAALKAQPSELTQRIAQVQEQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             ++A V  ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSKLASSQGDELAQQAVEVAGVYVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LAAV-EGGKVSLIAGVTPDASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLKK 898
            A+AGV  ++++
Sbjct: 861 GALAGVKGWVEE 872


>gi|116689431|ref|YP_835054.1| alanyl-tRNA synthetase [Burkholderia cenocepacia HI2424]
 gi|116647520|gb|ABK08161.1| alanyl-tRNA synthetase [Burkholderia cenocepacia HI2424]
          Length = 897

 Score =  936 bits (2419), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/912 (41%), Positives = 539/912 (59%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTLMFTNSGMV FK++F G +   Y   
Sbjct: 24  MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRA 83

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + L 
Sbjct: 84  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIKFAWELLTTVYQLP 143

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW+M +TGPCGPC+E
Sbjct: 144 KDKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWTMGDTGPCGPCTE 203

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK S+DTGMGLER+
Sbjct: 204 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKQSVDTGMGLERL 263

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ +VT +    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 264 AAVLQHVHSNYEIDLFQNLIKAAARVTEISDLTNN--SLKVIADHIRACSFLIVDGVIPG 321

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 322 NEGRGYVLRRIVRRAIRHGYKLGRKGAFFHKLVADLVAEMGTAYPELKEAEQRVTDVLRQ 381

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ +     ++L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 382 EEERFFETIEHGMSILEAALAEVEAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGMT 441

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 442 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYSGAKTTFHGYEEIAFDD---- 489

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 490 ------------------AKVVALYVDGSAVNEVKAGQDAVVVLDHTPFYAESGGQVGDQ 531

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    L   ID Q R +   NHSATH
Sbjct: 532 GVLANAATRFAVADTLKVQADVIGHHGTLEQGTLKVGDVLRAEIDAQRRARTQRNHSATH 591

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS +  D  RFD  H+ P+T  E++ +E  VN+ I  N P + 
Sbjct: 592 LMHKALREVLGAHVQQKGSLVDADKTRFDFAHNAPMTDDEIRRVEQIVNNEILANAPGIV 651

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 652 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 705

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   D ++   A+ LK     +  R+ ++ E+ + L+
Sbjct: 706 VEGGVAAGIRRVEAITGDNAVRYVQELDARVNEAAAALKAQPSELTQRIAQVQEQVKSLE 765

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             ++A V  ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 766 KELGALKSKLASSQGDELAQQAVEVAGVYVLAATLDGADAKTLRETVDKLKDKLKSAAIV 825

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 826 LAAV-EGGKVSLIAGVTPDASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 883

Query: 887 QAIAGVASFLKK 898
            A+AGV  ++++
Sbjct: 884 GALAGVKGWVEE 895


>gi|52424403|ref|YP_087540.1| alanyl-tRNA synthetase [Mannheimia succiniciproducens MBEL55E]
 gi|59798509|sp|Q65VQ5|SYA_MANSM RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|52306455|gb|AAU36955.1| AlaS protein [Mannheimia succiniciproducens MBEL55E]
          Length = 875

 Score =  936 bits (2419), Expect = 0.0,   Method: Composition-based stats.
 Identities = 391/912 (42%), Positives = 551/912 (60%), Gaps = 55/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR ++L+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAQIRQSYLDFFHSKGHQVVESSSLVPHNDPTLLFTNAGMNQFKDVFLGMDKRPYTR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI   W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIAYGWEFLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +LY+TVY+ D+EA+ +W K  G+ AD IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLYVTVYETDDEAYDIWNKEVGVPADHIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D GE I GGLP    E+G+RYIEIWN+VFMQF +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGEHIWGGLPGTPEEDGDRYIEIWNIVFMQFNRHADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER+A VLQ   +NYDID+F+ LI+   Q+TG K       + RVI DH+RS ++LIADG+
Sbjct: 241 ERIAAVLQHVNSNYDIDIFQTLIKKVAQLTGEKD--LTNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A   + Q + LIE+T
Sbjct: 299 MPSNEGRGYVLRRIIRRAVRHGHLLGAKETFFYKLVPTLADVMEHAGEIVNQKRALIEKT 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           L++E+E+F +TL+RGL+LLD  LS +  D +L+GDVAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LKAEEEQFARTLERGLLLLDDALSQVK-DNVLSGDVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F + ++ QR+RA+A S           + ++ +  G T+F GY+    S    
Sbjct: 418 T-IDEKGFEREMQAQRARAQASSNFG------VDYNNVIKVDGQTEFKGYETTSLS---- 466

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                             S+ V A+   G+ VE   SG+   V+ D+TPFY E+GGQ+GD
Sbjct: 467 ------------------SAKVVALFTDGKSVERVQSGENAVVILDRTPFYGESGGQIGD 508

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           TG    D    +I D QK    +  H   +E G L    ++   +D + R  ++ NHSAT
Sbjct: 509 TGYIATDLAAFRINDTQKYG-QVTGHIGQLESGSLSVGDTVSAQVDTERRLAVAANHSAT 567

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++   LRFD    + I+  ++  IE  VN  I +N+ V 
Sbjct: 568 HLLHAALRKVLGDHVAQKGSLVSESALRFDFIQPEAISKEQIIEIEAIVNRQIRENISVT 627

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T +M+ E A   GA AL G KY D VRVV +        S  LCGGTHV  TG+I L  +
Sbjct: 628 TEVMDIEAAKQKGAMALFGEKYGDLVRVVGMTG-----FSIELCGGTHVKRTGDIGLFKV 682

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           VSES+I AGIRRIEA+T + A + L  Q   L   A  LK    ++V +++++ ++ +K 
Sbjct: 683 VSESAIAAGIRRIEAVTAENAINWLNNQQNILNQSADLLKSDTASLVEKIQQLQDKAKKA 742

Query: 771 QLIHAKRKLQLNVE-----DLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +    + K +  ++       S  KI D++ +   +  +++K L+ ++D L+ ++ SG+I
Sbjct: 743 EKELQQLKEKAAMQAGSDLAKSAVKINDISVIVQQLDGIETKSLRVMVDDLKNQLGSGVI 802

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +   +  E K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 803 VFASVV-EDKVNLIVGVTADLTGKVKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQPENV 860

Query: 886 DQAIAGVASFLK 897
             A++  + +L+
Sbjct: 861 GAALSACSDWLE 872


>gi|299131739|ref|ZP_07024934.1| alanyl-tRNA synthetase [Afipia sp. 1NLS2]
 gi|298591876|gb|EFI52076.1| alanyl-tRNA synthetase [Afipia sp. 1NLS2]
          Length = 888

 Score =  936 bits (2418), Expect = 0.0,   Method: Composition-based stats.
 Identities = 480/908 (52%), Positives = 617/908 (67%), Gaps = 38/908 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+ FL FF KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG EK  YQ 
Sbjct: 1   MSGVNEIRSGFLNFFAKNGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEKRPYQR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK+RAI+LAW L+TK+F L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGNYFKDRAIELAWTLITKDFAL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + RL +TVY ED+EAF LWKKI+GL   +I+RI T+DNFW M +TGPCGPCSEIFFD G
Sbjct: 121 PKDRLLVTVYAEDDEAFGLWKKIAGLPESRIVRIGTSDNFWQMGDTGPCGPCSEIFFDHG 180

Query: 181 ECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + +PGG P    E+G+R+IEIWNLVFMQF+Q     R  LP  SIDTGMGLER+A VLQ 
Sbjct: 181 DKVPGGPPGSPDEDGDRFIEIWNLVFMQFDQIAPGNRNPLPHPSIDTGMGLERIAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           K +NYDIDLF  LI+A   +TG    G    + RVI DHLR+SSFLIADG+LP+NEGRGY
Sbjct: 241 KHDNYDIDLFVALIRAISDLTGADPHGAQKASLRVIADHLRASSFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  +PLM  L+ AL  EMG AYPEL++A+ LIEETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAKDPLMHRLVWALVREMGQAYPELVRAEALIEETLKLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTLDRGL +LD   + L K ++ +G+ AF LYDT+G PLD+ QD L  RG  G+D+ SF 
Sbjct: 361 KTLDRGLAILDEKSAALHKGDMFDGETAFTLYDTYGFPLDLTQDALRNRG-IGVDLASFT 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E Q+++ARA   G G    EKIWF L+E+ GAT+F+GYD                  
Sbjct: 420 DAMERQKAKARASWAGSGDTAAEKIWFPLREELGATEFLGYD------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +V A+V+ G  VE   +G    VV +QTPFY E+GGQ+GDTG   GDG 
Sbjct: 462 -----TEIAEGVVTALVKDGASVESLKAGDAASVVLNQTPFYGESGGQVGDTGVLTGDGG 516

Query: 540 -RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALS 598
            R ++TD QKKA  +FVH   +E+G L+    L L +D+  R  +  NHSATHLLH AL 
Sbjct: 517 VRFRVTDTQKKAGDLFVHIGQLEQGTLKKGAPLQLEVDHARRGAIRANHSATHLLHEALR 576

Query: 599 TILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNRED 658
            +LG H++Q GS ++P+ LRFD  H+KPIT  EL  IED  NDI+ +N  V TR+M  ED
Sbjct: 577 QVLGDHIAQRGSLVSPERLRFDFAHTKPITPDELSRIEDIANDIVLENGEVTTRLMGIED 636

Query: 659 AIASGAAALLGTKYNDRVRVVSVEYEDGGV--HSSALCGGTHVSSTGEIMLLYIVSESSI 716
           A +SGA AL G KY D VRVVS+    G     S  LCGGTHV  TG+I L+ I  ES++
Sbjct: 637 ARSSGARALFGEKYGDEVRVVSMGQGSGNALGWSVELCGGTHVRRTGDIGLVSITGESAV 696

Query: 717 RAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAK 776
            +G+RRIEA+TG+ AR       +  K+ A+ LK +  ++  R+  + EE +KL+   ++
Sbjct: 697 ASGVRRIEALTGRAARQAANHSIQTAKTAAAELKTTLEDMPVRIAALIEERKKLERDLSE 756

Query: 777 RKLQLNVEDLS----------CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
            + +L +                 + DV  ++  +  V+ K+LKS+ D  +K+I SG++ 
Sbjct: 757 ARKKLAMGGGGSAGGAAAASDVRSVGDVKLLARAVQGVEVKDLKSLADQGKKQIGSGVVA 816

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           LV  S++ KASV++ VT DL  RF+AVDL R +++VLGG GGGG+P MAQ+GGP+G+KAD
Sbjct: 817 LVATSEDGKASVVVGVTPDLTSRFSAVDLVRKASEVLGGKGGGGKPDMAQAGGPDGSKAD 876

Query: 887 QAIAGVAS 894
            A+  + +
Sbjct: 877 AALKAIEA 884


>gi|325529341|gb|EGD06275.1| alanyl-tRNA synthetase [Burkholderia sp. TJI49]
          Length = 874

 Score =  936 bits (2418), Expect = 0.0,   Method: Composition-based stats.
 Identities = 380/912 (41%), Positives = 537/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTLMFTNSGMV FK++F G ++  Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDQRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIKFAWELLTTVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW+M +TGPCGPC+E
Sbjct: 121 KEKLWVTVYQEDDEAYDIWAKDVGVPTERIIRIGDNKGARYASDNFWTMGDTGPCGPCTE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK S+DTGMGLER+
Sbjct: 181 IFYDHGPEVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKQSVDTGMGLERL 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ +VT       N  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIKAAARVTETSD--LNNNSLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGAFFHQLVADLVAEMGVAYPELKEAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLS--HLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+       ++L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALADVEAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGMT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYTGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVDGSAVNEVKTGQDAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    L   ID   R +   NHSATH
Sbjct: 509 GVLANAATRFAVADTLKVQADVIGHHGTLEQGTLKVGDVLRAEIDAHRRARTQRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS +  D  RFD  H+ P++  E++ +E  VND I  N P + 
Sbjct: 569 LMHKALREVLGAHVQQKGSLVDADKTRFDFAHNAPLSDDEIRRVEQIVNDEILANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHVS TG+I L  IV
Sbjct: 629 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVSRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   D ++   A+ LK     +  R+ ++ ++ + L+
Sbjct: 683 MEGGVAAGIRRVEAITGDNAVRYVQELDARVNEAAAALKAQPSELTQRIAQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
              +  K +L             ++  V+ ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELSALKSKLASSQGDELAQQAVEVGGVHVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LAAV-EGGKVSLIAGVTADASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLKK 898
            A+AGV  ++++
Sbjct: 861 AALAGVKGWVEE 872


>gi|206559783|ref|YP_002230547.1| alanyl-tRNA synthetase [Burkholderia cenocepacia J2315]
 gi|198035824|emb|CAR51715.1| alanyl-tRNA synthetase [Burkholderia cenocepacia J2315]
          Length = 874

 Score =  936 bits (2418), Expect = 0.0,   Method: Composition-based stats.
 Identities = 381/912 (41%), Positives = 538/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTLMFTNSGMV FK++F G +   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIKFAWELLTAVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW+M +TGPCGPC+E
Sbjct: 121 KEKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWTMGDTGPCGPCTE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK S+DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKQSVDTGMGLERL 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ +VT +    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIKAAARVTEISDLTNN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGAFFHKLVADLVAEMGTAYPELKEAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ +     ++L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALADVDAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGMT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYSGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVDGSAVNEVKAGQDAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    L   ID Q R +   NHSATH
Sbjct: 509 GVLANAATRFAVADTLKVQADVIGHHGTLEQGTLKVGDVLRAEIDAQRRARTQRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS +  +  RFD  H+ P+T  E++ +E  VN+ I  N P + 
Sbjct: 569 LMHKALREVLGAHVQQKGSLVDAEKTRFDFAHNAPMTDDEIRRVEQIVNNEILANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 629 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   D ++   A+ LK     +  R+ ++ ++ + L+
Sbjct: 683 VEGGVAAGIRRVEAITGDNAVRYVQELDARVNEAAAALKAQPSELTQRIAQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             +I  V  ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSKLASSQGDELAQQAVEIGGVYVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LAAV-EGGKVSLIAGVTPDASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLKK 898
            A+AGV  ++++
Sbjct: 861 GALAGVKGWVEE 872


>gi|86357937|ref|YP_469829.1| alanyl-tRNA synthetase [Rhizobium etli CFN 42]
 gi|86282039|gb|ABC91102.1| alanyl-tRNA synthetase protein [Rhizobium etli CFN 42]
          Length = 899

 Score =  936 bits (2418), Expect = 0.0,   Method: Composition-based stats.
 Identities = 490/904 (54%), Positives = 635/904 (70%), Gaps = 38/904 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+TFL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG EK  Y  
Sbjct: 16  MSGVNDIRSTFLDYFKKNGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEKRPYAT 75

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RH TFFEMLGNFSFG YFKE AI+LAW L+T+ F L
Sbjct: 76  ATTSQKCVRAGGKHNDLDNVGYTARHLTFFEMLGNFSFGDYFKENAIELAWKLVTEGFGL 135

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + RL +TVY EDEEA  LWKKI+G S DKIIRI T+DNFW M +TGPCGPCSEIF DQG
Sbjct: 136 PKHRLLVTVYSEDEEAAALWKKIAGFSDDKIIRIPTSDNFWQMGDTGPCGPCSEIFIDQG 195

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           E + GG PGS  E+G+R++E WNLVFMQFEQ     R  LP+ SIDTGMGLERMA +LQ 
Sbjct: 196 ENVWGGPPGSPEEDGDRFLEFWNLVFMQFEQTEPGVRNPLPRPSIDTGMGLERMACILQG 255

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             + +D DLF+ L    E   G+K       +HRVI DHLRSS+FLIADG+LP+NEGRGY
Sbjct: 256 VQSVFDTDLFRTLTGTIEDTIGVK--AEGSASHRVIADHLRSSAFLIADGVLPSNEGRGY 313

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  LLP L  EMG AYPEL +A+ LI ETL+ E+ RF 
Sbjct: 314 VLRRIMRRAMRHAQLLGAKEPLMYKLLPTLVQEMGRAYPELARAEALISETLKLEEGRFR 373

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL    + L K ++L+G+ AFKLYDT+G PLD+ QD L AR   G+DI  F 
Sbjct: 374 KTLERGLSLLSDATADLDKGDMLDGETAFKLYDTYGFPLDLTQDALRAR-EIGVDIAGFT 432

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A++ Q++ AR+H  G G   TE IWF L+EK+GAT+F+GYD                  
Sbjct: 433 DAMQRQKAEARSHWAGSGEKATETIWFELREKHGATEFLGYD------------------ 474

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +V+AIV+ G +  EA +G KV++V +QTPFY E+GGQ+GD G    D  
Sbjct: 475 -----TEAAEGVVQAIVRDGAVAAEAKAGDKVQIVVNQTPFYGESGGQMGDAGVISSDHG 529

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           +++I+D QK+ EG+FVH   V  G++R   ++ +T+D+  R +L  NHSATHLLH AL  
Sbjct: 530 KIEISDTQKRGEGLFVHLGTVIEGVVRDGDAVAMTVDHARRSRLRANHSATHLLHEALRE 589

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG+HV+Q GS + P+ LRFDV+H KP+T  ELK +ED  N+I+ QN PV TR+M+ +DA
Sbjct: 590 VLGTHVAQKGSLVAPERLRFDVSHPKPMTPEELKIVEDMANEIVLQNSPVTTRLMSVDDA 649

Query: 660 IASGAAALLGTKYNDRVRVVSVEY-----EDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+       +    +S  LCGGTHVS+TG+I L+ I+ ES
Sbjct: 650 IAEGAMALFGEKYGDEVRVVSMGTGLHGAKSNKPYSVELCGGTHVSATGQIGLVRILGES 709

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
           ++ AG+RR+EA+TG+ AR +L  QD+++K+LA+ LKV    V+ RVE + +E RKL+   
Sbjct: 710 AVGAGVRRLEAVTGESAREYLAEQDDRVKTLAASLKVQPSEVLSRVEALIDERRKLEKEL 769

Query: 775 AKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
           A  K +L +         +  ++A V F+   IS VD K+LK + D  +  I SG++ L+
Sbjct: 770 ADAKRKLAMGGGQGGSGDAVREVAGVKFLGKSISGVDPKDLKGLADEGKTSIGSGVVALI 829

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQA 888
           G+S++ KAS ++ VT DL++R++AVDL R+++  LGG GGGGRP MAQ+GGP+G+KAD+A
Sbjct: 830 GVSEDGKASAVVAVTPDLVERYSAVDLVRIASVALGGKGGGGRPDMAQAGGPDGSKADEA 889

Query: 889 IAGV 892
           I  V
Sbjct: 890 IEAV 893


>gi|205830239|sp|Q2K7T4|SYA_RHIEC RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
          Length = 884

 Score =  935 bits (2417), Expect = 0.0,   Method: Composition-based stats.
 Identities = 490/904 (54%), Positives = 635/904 (70%), Gaps = 38/904 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+TFL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG EK  Y  
Sbjct: 1   MSGVNDIRSTFLDYFKKNGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEKRPYAT 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RH TFFEMLGNFSFG YFKE AI+LAW L+T+ F L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHLTFFEMLGNFSFGDYFKENAIELAWKLVTEGFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + RL +TVY EDEEA  LWKKI+G S DKIIRI T+DNFW M +TGPCGPCSEIF DQG
Sbjct: 121 PKHRLLVTVYSEDEEAAALWKKIAGFSDDKIIRIPTSDNFWQMGDTGPCGPCSEIFIDQG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           E + GG PGS  E+G+R++E WNLVFMQFEQ     R  LP+ SIDTGMGLERMA +LQ 
Sbjct: 181 ENVWGGPPGSPEEDGDRFLEFWNLVFMQFEQTEPGVRNPLPRPSIDTGMGLERMACILQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             + +D DLF+ L    E   G+K       +HRVI DHLRSS+FLIADG+LP+NEGRGY
Sbjct: 241 VQSVFDTDLFRTLTGTIEDTIGVK--AEGSASHRVIADHLRSSAFLIADGVLPSNEGRGY 298

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  LLP L  EMG AYPEL +A+ LI ETL+ E+ RF 
Sbjct: 299 VLRRIMRRAMRHAQLLGAKEPLMYKLLPTLVQEMGRAYPELARAEALISETLKLEEGRFR 358

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL    + L K ++L+G+ AFKLYDT+G PLD+ QD L AR   G+DI  F 
Sbjct: 359 KTLERGLSLLSDATADLDKGDMLDGETAFKLYDTYGFPLDLTQDALRAR-EIGVDIAGFT 417

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A++ Q++ AR+H  G G   TE IWF L+EK+GAT+F+GYD                  
Sbjct: 418 DAMQRQKAEARSHWAGSGEKATETIWFELREKHGATEFLGYD------------------ 459

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +V+AIV+ G +  EA +G KV++V +QTPFY E+GGQ+GD G    D  
Sbjct: 460 -----TEAAEGVVQAIVRDGAVAAEAKAGDKVQIVVNQTPFYGESGGQMGDAGVISSDHG 514

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           +++I+D QK+ EG+FVH   V  G++R   ++ +T+D+  R +L  NHSATHLLH AL  
Sbjct: 515 KIEISDTQKRGEGLFVHLGTVIEGVVRDGDAVAMTVDHARRSRLRANHSATHLLHEALRE 574

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG+HV+Q GS + P+ LRFDV+H KP+T  ELK +ED  N+I+ QN PV TR+M+ +DA
Sbjct: 575 VLGTHVAQKGSLVAPERLRFDVSHPKPMTPEELKIVEDMANEIVLQNSPVTTRLMSVDDA 634

Query: 660 IASGAAALLGTKYNDRVRVVSVEY-----EDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+       +    +S  LCGGTHVS+TG+I L+ I+ ES
Sbjct: 635 IAEGAMALFGEKYGDEVRVVSMGTGLHGAKSNKPYSVELCGGTHVSATGQIGLVRILGES 694

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
           ++ AG+RR+EA+TG+ AR +L  QD+++K+LA+ LKV    V+ RVE + +E RKL+   
Sbjct: 695 AVGAGVRRLEAVTGESAREYLAEQDDRVKTLAASLKVQPSEVLSRVEALIDERRKLEKEL 754

Query: 775 AKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
           A  K +L +         +  ++A V F+   IS VD K+LK + D  +  I SG++ L+
Sbjct: 755 ADAKRKLAMGGGQGGSGDAVREVAGVKFLGKSISGVDPKDLKGLADEGKTSIGSGVVALI 814

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQA 888
           G+S++ KAS ++ VT DL++R++AVDL R+++  LGG GGGGRP MAQ+GGP+G+KAD+A
Sbjct: 815 GVSEDGKASAVVAVTPDLVERYSAVDLVRIASVALGGKGGGGRPDMAQAGGPDGSKADEA 874

Query: 889 IAGV 892
           I  V
Sbjct: 875 IEAV 878


>gi|115351339|ref|YP_773178.1| alanyl-tRNA synthetase [Burkholderia ambifaria AMMD]
 gi|122323447|sp|Q0BG79|SYA_BURCM RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|115281327|gb|ABI86844.1| alanyl-tRNA synthetase [Burkholderia ambifaria AMMD]
          Length = 874

 Score =  935 bits (2417), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/912 (41%), Positives = 535/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTLMFTNSGMV FK++F G +   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIRFAWELLTTVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW+M +TGPCGPC+E
Sbjct: 121 KEKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWTMGDTGPCGPCTE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK S+DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKQSVDTGMGLERL 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ +VT +    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIKAAARVTEISDLTNN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGSFFHKLVADLVAEMGAAYPELKEAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLS--HLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+       ++L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALADVEAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGMT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYSGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVDGSAVNEVKAGQDAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    L   ID   R +   NHSATH
Sbjct: 509 GVLANAATRFAVADTLKVQADVVGHHGTLEQGTLKIGDVLRAEIDAHRRARTQRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS +  +  RFD  H+ P+T  E++ +E  VN+ I  N P + 
Sbjct: 569 LMHKALREVLGAHVQQKGSLVDAEKTRFDFAHNAPMTDDEIRRVEQIVNNEILANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I    IV
Sbjct: 629 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGFFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   D ++   A+ LK     +  R+ ++ ++ + L+
Sbjct: 683 VEGGVAAGIRRVEAITGDNAVRYVQELDARVNEAAAALKAQPSELTQRIAQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             +I  V  ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSKLASSQGDELAQQATEIGGVYVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LAAV-EGGKVSLIAGVTPDASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLKK 898
            A+AGV  ++++
Sbjct: 861 GALAGVKGWVEE 872


>gi|300722254|ref|YP_003711538.1| alanyl-tRNA synthetase [Xenorhabdus nematophila ATCC 19061]
 gi|297628755|emb|CBJ89333.1| alanyl-tRNA synthetase [Xenorhabdus nematophila ATCC 19061]
          Length = 875

 Score =  935 bits (2416), Expect = 0.0,   Method: Composition-based stats.
 Identities = 388/910 (42%), Positives = 553/910 (60%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++PSSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHTKGHQVVPSSSLVPTNDPTLLFTNAGMNQFKDVFLGLDKRPYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI+ AW+LLT  K F+
Sbjct: 63  TTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAIKYAWELLTSEKWFN 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY+ D+EA+ +W K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKEKLWVTVYETDDEAYDIWHKEVGVPTERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D GE I GG PGS  E+G+RYIEIWN+VFMQF +        LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGEHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRHVDGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+  VLQ   +NY+IDLF+ LI +   VTG         + RV+ DH+R+ +FLI DG++
Sbjct: 243 RITAVLQHVNSNYEIDLFQSLIASVADVTGATD--LTNKSLRVVADHIRACAFLICDGVV 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MG+A  EL Q + L+E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKEAFFYKLVAPLIKIMGAAGEELKQQQALVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLQLLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+E QR RAR       S      +  L +  G++ F GY+          
Sbjct: 420 -VDEAGFEMAMENQRRRARE------SSGFGTDYNELIKVDGSSDFCGYEH--------- 463

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                         N   +IV AI + GE VE+  +G++  V+ D+T FYAE+GGQ GD 
Sbjct: 464 --------------NSQQAIVTAIFRNGESVEQIHAGEEAVVILDKTAFYAESGGQAGDM 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G  +      ++ D QK A  +  H   +  GIL    ++   ID   R  + +NHSATH
Sbjct: 510 GHLLNSDGVFEVLDTQKYA-QVIGHIGKLTSGILAVNHTVNAEIDVVRRDAIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  ILG HV+Q GS +    LRFD +H + + S +++ +E+ VN+ I +N PVVT
Sbjct: 569 LLHAALRQILGEHVAQKGSLVNDKYLRFDFSHFEAMKSEQIRQVENLVNEEIRKNSPVVT 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            +M  EDA + GA AL G KY+++VRV+S+        S+ LCGGTH S TG+I +  I 
Sbjct: 629 ELMALEDAKSKGAMALFGEKYDEKVRVLSMGG-----FSTELCGGTHASRTGDIGVFRIS 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AGIRRIEAITGQ A   +  Q + L+ +A  +K    ++  +V+   +  ++L+
Sbjct: 684 SESGTAAGIRRIEAITGQTALDAIYQQTDLLQDIAHLVKGDISSLNEKVKTTLDRMKQLE 743

Query: 772 LIHAKRKLQLNVEDLSC-----HKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++ S       +I  V  +   + +V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKSQQAAQESSSLANQTKEIQGVRLLVTQLGDVEPKMLRTMVDDLKNQLGSAIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L       K S+++ +T+DL  +  A DL    A+ + GG GGGRP +AQ+GG +     
Sbjct: 804 L-STVAGDKVSLIVGITKDLTAKIKAGDLISFVAQQV-GGKGGGRPDLAQAGGTDVTALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 TALASVEEWV 871


>gi|323526792|ref|YP_004228945.1| alanyl-tRNA synthetase [Burkholderia sp. CCGE1001]
 gi|323383794|gb|ADX55885.1| alanyl-tRNA synthetase [Burkholderia sp. CCGE1001]
          Length = 890

 Score =  935 bits (2416), Expect = 0.0,   Method: Composition-based stats.
 Identities = 382/911 (41%), Positives = 538/911 (59%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 17  MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAESRPYSRA 76

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + L 
Sbjct: 77  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTGVYQLP 136

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA  +W K  G+  ++IIRI  N       DNFW MA+TGPCGPCSE
Sbjct: 137 KEKLWVTVYQEDDEAHDIWAKEVGVPVERIIRIGDNKGARYASDNFWQMADTGPCGPCSE 196

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 197 IFYDHGPEVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTPLPKQCVDTGMGLERI 256

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+A+ + TG+    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 257 AAVLQHVHSNYEIDLFQALIKAAARETGVSDLTNN--SLKVIADHIRACSFLIVDGVIPG 314

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        ++  L  +MGSAYPEL  A+  + + LR 
Sbjct: 315 NEGRGYVLRRIVRRAIRHGYKLGKKGSFFHRMVADLVEQMGSAYPELKDAQQRVTDVLRQ 374

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGK--DEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ L K   + L+G++AFKL+DT+G PLD+  D+   R + 
Sbjct: 375 EEERFFETIEHGMSILENALAELEKKGRKTLDGELAFKLHDTYGFPLDLTADVCREREVT 434

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F++A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 435 -VDEAAFDEAMARQREQARAAGKFKMAQG-------LEYSGAKTTFHGYEEIVFDD---- 482

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V+E   GQ+  VV D TPFYAE+GGQ+GD 
Sbjct: 483 ------------------AKVVALYVDGASVQEVAQGQQAVVVLDHTPFYAESGGQVGDQ 524

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G      +R  + D  K    +  HH  +E+GIL+    +   ID   R + + NHSATH
Sbjct: 525 GLLANASVRFAVADTLKVQADVVGHHGTLEQGILKVGDVVKAEIDAVRRARTARNHSATH 584

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS + PD  RFD  H+ P+T  +++ +E+ VN  +  N P + 
Sbjct: 585 LMHKALREVLGSHVQQKGSLVDPDKTRFDFAHNAPMTDEQIRRVEEIVNAEVLANAPGIV 644

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 645 RVMPFDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 698

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A   +   D ++ + AS LK     +  R+ ++ ++ ++L+
Sbjct: 699 MEGGVAAGIRRVEAITGDNAVRFVQDLDARINAAASVLKAQPSELTQRITQVQDQVKQLE 758

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
              +  K ++             ++A V  ++  +   D K L+  +D L+ K++S  I+
Sbjct: 759 KELSALKSKMASSQGDELAGQAIEVAGVQVLAATLEGADVKTLRKTVDKLKDKLKSAAIV 818

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 819 LASV-EGGKVSLIAGVTADASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 876

Query: 887 QAIAGVASFLK 897
            A+AGV  +++
Sbjct: 877 AALAGVKGWVE 887


>gi|78066024|ref|YP_368793.1| alanyl-tRNA synthetase [Burkholderia sp. 383]
 gi|77966769|gb|ABB08149.1| alanyl-tRNA synthetase [Burkholderia sp. 383]
          Length = 897

 Score =  934 bits (2415), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/912 (41%), Positives = 535/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTLMFTNSGMV FK++F G +   Y   
Sbjct: 24  MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRA 83

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + L 
Sbjct: 84  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIKFAWELLTTVYQLP 143

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW+M +TGPCGPC+E
Sbjct: 144 KDKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWTMGDTGPCGPCTE 203

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK S+DTGMGLER+
Sbjct: 204 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKQSVDTGMGLERL 263

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ +VT +    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 264 AAVLQHVHSNYEIDLFQNLIKAAARVTEISDLTNN--SLKVIADHIRACSFLIVDGVIPG 321

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG AYPEL +A+  + + LR 
Sbjct: 322 NEGRGYVLRRIVRRAIRHGYKLGRKGSFFHKLVADLVAEMGVAYPELKEAEQRVTDVLRQ 381

Query: 354 EDERFGKTLDRGLVLLDGVLS--HLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+G L+       ++L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 382 EEERFFETIEHGMSILEGALADVEAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGMT 441

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 442 -VDEPAFDDAMARQREQARAAGKFKAAQG-------LEYTGAKTTFHGYEEIAFDD---- 489

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + + A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 490 ------------------AKIVALYVDGSSVNEVKTGQDAVVVLDHTPFYAESGGQVGDQ 531

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    L   ID   R +   NHSATH
Sbjct: 532 GVLANAATRFAVADTLKVQADVIGHHGTLEQGTLKVGDVLRAEIDAHRRARTQRNHSATH 591

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS +  +  RFD  H+ P+T  E++ +E  VN+ I  N P + 
Sbjct: 592 LMHKALREVLGAHVQQKGSLVDAEKTRFDFAHNAPMTDDEIRRVEQIVNNEILANAPGIV 651

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHVS +G+I    IV
Sbjct: 652 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVSRSGDIGFFKIV 705

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   D ++   A+ LK     +  R+ ++ ++ + L+
Sbjct: 706 VEGGVAAGIRRVEAITGDNAVRYVQELDARVNEAAAALKAQPSELTQRIAQVQDQVKSLE 765

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             +I  V  ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 766 KELGALKSKLASSQGDELAQQAVEIGGVFVLAATLDGADAKTLRETVDKLKDKLKSAAIV 825

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +    K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 826 LAAVES-GKVSLIAGVTPDASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 883

Query: 887 QAIAGVASFLKK 898
            A+AGV  ++++
Sbjct: 884 GALAGVKGWVEE 895


>gi|218701187|ref|YP_002408816.1| alanyl-tRNA synthetase [Escherichia coli IAI39]
 gi|218371173|emb|CAR19004.1| alanyl-tRNA synthetase [Escherichia coli IAI39]
          Length = 876

 Score =  934 bits (2415), Expect = 0.0,   Method: Composition-based stats.
 Identities = 397/910 (43%), Positives = 561/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLATGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ + S E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKSEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAVLP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|307730458|ref|YP_003907682.1| alanyl-tRNA synthetase [Burkholderia sp. CCGE1003]
 gi|307584993|gb|ADN58391.1| alanyl-tRNA synthetase [Burkholderia sp. CCGE1003]
          Length = 890

 Score =  934 bits (2414), Expect = 0.0,   Method: Composition-based stats.
 Identities = 382/911 (41%), Positives = 538/911 (59%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 17  MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAESRPYSRA 76

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + L 
Sbjct: 77  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTGVYQLP 136

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA  +W K  G+  ++IIRI  N       DNFW MA+TGPCGPCSE
Sbjct: 137 KEKLWVTVYHEDDEAHDIWAKEVGVPVERIIRIGDNKGARYASDNFWQMADTGPCGPCSE 196

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 197 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTPLPKQCVDTGMGLERI 256

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+A+ + TG+    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 257 AAVLQHVHSNYEIDLFQALIKAAARETGVSDLANN--SLKVIADHIRACSFLIVDGVIPG 314

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        ++  L  +MGSAYPEL  A+  + + LR 
Sbjct: 315 NEGRGYVLRRIVRRAIRHGYKLGKKGSFFHRMVADLVEQMGSAYPELKDAQARVTDVLRQ 374

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ L K     L+G++AFKL+DT+G PLD+  D+   R + 
Sbjct: 375 EEERFFETIEHGMSILENALAELEKKGARTLDGELAFKLHDTYGFPLDLTADVCREREVT 434

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F++A+  QR +ARA      S         L+     T F GY+ +        
Sbjct: 435 -VDEAAFDEAMARQREQARAAGKFKMSQG-------LEYSGAKTTFHGYEEIVFDD---- 482

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V+E   GQ+  VV D TPFYAE+GGQ+GD 
Sbjct: 483 ------------------AKVVALYVDGASVQEVAHGQQTVVVLDHTPFYAESGGQVGDQ 524

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G      +R  +TD  K    +  HH  +E+G L+    +   ID   R + + NHSATH
Sbjct: 525 GLLANASVRFAVTDTLKVQADVVGHHGTLEQGTLKVGDVVKAEIDAVRRARTARNHSATH 584

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS + PD  RFD  H+ P+T  +++ +E+ VN  +  N P + 
Sbjct: 585 LMHKALREVLGSHVQQKGSLVDPDKTRFDFAHNAPMTDEQIRRVEEIVNAEVLANAPGIV 644

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 645 RVMPFDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 698

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A   +   D ++ + A+ LK     +  R+ ++ ++ ++L+
Sbjct: 699 MEGGVAAGIRRVEAITGDNAVRFVQDLDARINAAAAVLKAQPSELTQRITQVQDQVKQLE 758

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
              +  K ++             ++A V  ++  +   D K L+  +D L+ K++S  I+
Sbjct: 759 KELSALKSKMASSQGDELAGQAIEVAGVQVLAATLEGADVKTLRETVDKLKDKLKSAAIV 818

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG +     
Sbjct: 819 LASV-EGGKVSLIAGVTADASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTDPANLG 876

Query: 887 QAIAGVASFLK 897
            A+AGV  +++
Sbjct: 877 AALAGVKGWVE 887


>gi|241204888|ref|YP_002975984.1| alanyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240858778|gb|ACS56445.1| alanyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 884

 Score =  934 bits (2414), Expect = 0.0,   Method: Composition-based stats.
 Identities = 497/904 (54%), Positives = 641/904 (70%), Gaps = 38/904 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+TFL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG EK  Y  
Sbjct: 1   MSGVNDIRSTFLDYFKKNGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEKRPYST 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RH TFFEMLGNFSFG YFKE AI+LAW L+T+ FDL
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHLTFFEMLGNFSFGDYFKENAIELAWKLVTEGFDL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + RL +TVY EDEEA  LWKKI+G S DKIIRI T+DNFW M +TGPCGPCSEIF DQG
Sbjct: 121 PKNRLLVTVYSEDEEAATLWKKIAGFSDDKIIRIPTSDNFWQMGDTGPCGPCSEIFIDQG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           E + GG PGS  E+G+R++E WNLVFMQFEQ    ER  LP+ SIDTGMGLERMA VLQ 
Sbjct: 181 ENVWGGPPGSPEEDGDRFLEFWNLVFMQFEQTAPGERSPLPRPSIDTGMGLERMAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             + +D DLF+ LI   E   G+K       +HRVI DHLRSS+FLIADG+LP+NEGRGY
Sbjct: 241 VQSVFDTDLFRTLIGTIEDTMGVK--AEGSASHRVIADHLRSSAFLIADGVLPSNEGRGY 298

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPL+  LLP L  +MG AYPEL++A+ LI ETL+ E+ RF 
Sbjct: 299 VLRRIMRRAMRHAQLLGAKEPLVYKLLPTLVQQMGRAYPELVRAEALISETLKLEENRFR 358

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL    ++L K ++L+G+ AFKLYDT+G PLD+ QD L AR   G+DI  F 
Sbjct: 359 KTLERGLSLLSDATTNLSKGDMLDGETAFKLYDTYGFPLDLTQDALRAR-EIGVDISGFT 417

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A++ Q++ AR+H  G G   TE IWF LKEK+GAT+F+GYD                  
Sbjct: 418 DAMQRQKAEARSHWAGSGEKATETIWFELKEKHGATEFLGYD------------------ 459

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +V+AIV++G +   A +G KV++V  QTPFY E+GGQ+GDTG    D  
Sbjct: 460 -----TETAEGVVQAIVKEGAVSTAAKAGDKVQIVVSQTPFYGESGGQMGDTGVISSDHG 514

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           +++I+D QK+ EG+FVH   V  G+ +   ++VLT+D+  R +L  NHSATHLLH AL  
Sbjct: 515 KIEISDTQKRGEGLFVHQGTVIDGVFKDGDAVVLTVDHARRSRLRANHSATHLLHEALRE 574

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG+HV+Q GS + P+ LRFDV+H KP+++ ELK +ED  N+I+ QN PV TR+M+ +DA
Sbjct: 575 VLGTHVAQKGSLVAPERLRFDVSHPKPMSAEELKIVEDMANEIVLQNSPVTTRLMSVDDA 634

Query: 660 IASGAAALLGTKYNDRVRVVSVEY-----EDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVV++       + G  +S  LCGGTHV +TG+I L+ ++ ES
Sbjct: 635 IAEGAMALFGEKYGDEVRVVAMGEGVRGAKAGKAYSIELCGGTHVGATGQIGLIRVLGES 694

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
           ++ AG+RRIEA+TG+ AR +L  QDE++K+LA+ LKV  G V+ RVE + +E RKL+   
Sbjct: 695 AVGAGVRRIEAVTGESAREYLAEQDERVKTLAASLKVQPGEVLSRVEALMDERRKLEKEL 754

Query: 775 --AKRKLQLNVED----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
             AKRKL +         +  ++A V F+   IS VD K+LK + D  +  I SG++ LV
Sbjct: 755 GDAKRKLAMGGGQGGSVDAVREVAGVKFLGKAISGVDPKDLKGLADDGKTSIGSGVVALV 814

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQA 888
           G+S + KAS ++ VT DL+ R++AVDL R+++  LGG GGGGRP MAQ+GGP+G+KAD+A
Sbjct: 815 GVSDDGKASAVVAVTPDLVQRYSAVDLVRIASAALGGKGGGGRPDMAQAGGPDGSKADEA 874

Query: 889 IAGV 892
           I  V
Sbjct: 875 IEAV 878


>gi|219870706|ref|YP_002475081.1| alanyl-tRNA synthetase [Haemophilus parasuis SH0165]
 gi|219690910|gb|ACL32133.1| alanyl-tRNA synthetase [Haemophilus parasuis SH0165]
          Length = 875

 Score =  934 bits (2414), Expect = 0.0,   Method: Composition-based stats.
 Identities = 374/912 (41%), Positives = 553/912 (60%), Gaps = 55/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   S IR  FLEFFQ  GH ++PSSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTSEIRQAFLEFFQSKGHTIVPSSSLVPENDPTLLFTNAGMNQFKDVFLGLDKRSYNR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            T+ Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+ LT  +  
Sbjct: 61  ATSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKPDAIAFAWEFLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D+EA+ +W +  G+ A+ I+RI  N       DNFW M +TGPCGP
Sbjct: 121 ALPKEKLWVTVYETDDEAYDIWNREIGVPAEHIVRIGDNKGAPYASDNFWQMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS+ E+G+R+IE+WN+VFMQF +Q       LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSAEEDGDRFIEVWNVVFMQFNRQADGTLKKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+F+ LI+    +  +     +  + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFQALIKEIASLLNVTD--LDNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  +LG        L+P L   MG A   L Q +  I++ 
Sbjct: 299 MPSNEGRGYVLRRIIRRAVRHGNILGAKSAFFYQLVPTLAKAMGQAGEILTQKQAHIQKA 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           L++E+++F +TL+RGL LL+  L+ +  +++L+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LKAEEDQFARTLERGLALLEDALTKVE-NKVLSGEVAFKLYDTYGFPLDLTADVCRERSI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F + ++ QR+RA+A S           +  + +  G+T+F GY++        
Sbjct: 418 T-IDEAGFEREMQAQRARAQASSNFG------TDYNYVIKVDGSTEFKGYEVTE------ 464

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + V A+   G+ VE   SG+   VV D+T FY E+GGQ+GD
Sbjct: 465 -----------------CEATVVALFSNGKAVEAIQSGENAVVVLDRTAFYGESGGQVGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G    +    ++ D QK    +F H   +  G L     +   ++   R  +++NHSAT
Sbjct: 508 SGVIASEICNFEVNDTQKYG-QVFGHIGQLASGTLSVGDKVKAEVNATRRHAITLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++ + LRFD +  + I+ A+L+ IE  +N  I +N+ V 
Sbjct: 567 HLLHSALRQVLGDHVAQKGSLVSENSLRFDFSQGEAISKADLEEIERIINTKIRENIVVT 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T +M+ E A   GA AL G KY DRVRVV +        S  LCGGTHV  TGEI L  +
Sbjct: 627 TEVMDLESAKQKGAMALFGEKYGDRVRVVDMT----AAFSVELCGGTHVKQTGEIGLFKV 682

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           VSE ++ AG+RRIEA+TG+ A   L  Q + L   A  LK    ++V +++++ E+ +K+
Sbjct: 683 VSEGAVAAGVRRIEAVTGENAIGLLHQQQQILNQSAELLKADTASLVEKIQQLQEKSKKV 742

Query: 771 QLIHAKRKLQLNVE-----DLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +    + K +L  +          +I  VN +   +  VD+K L++++D L+ ++ S +I
Sbjct: 743 EKELQQLKDKLAAQAGGELAKQAQQINGVNVVVQRLENVDAKALRTMVDDLKNQLGSAVI 802

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +      ++K ++++ VT+DL D+ NA +L  L A+ + GG GGGR  MA +GG      
Sbjct: 803 V-FATQTDEKVNLIVGVTKDLTDKVNAGELVGLMAQEV-GGKGGGRADMAMAGGSQPENI 860

Query: 886 DQAIAGVASFLK 897
            QA+    ++++
Sbjct: 861 TQALNVATNWIQ 872


>gi|170695494|ref|ZP_02886639.1| alanyl-tRNA synthetase [Burkholderia graminis C4D1M]
 gi|170139685|gb|EDT07868.1| alanyl-tRNA synthetase [Burkholderia graminis C4D1M]
          Length = 890

 Score =  934 bits (2414), Expect = 0.0,   Method: Composition-based stats.
 Identities = 377/911 (41%), Positives = 532/911 (58%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 17  MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAESRPYSRA 76

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + L 
Sbjct: 77  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTGVYQLP 136

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA  +W K  G+  ++IIRI  N       DNFW MA+TGPCGPCSE
Sbjct: 137 KDKLWVTVYHEDDEAHDIWAKEVGVPVERIIRIGDNKGARYASDNFWQMADTGPCGPCSE 196

Query: 175 IFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG P    E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 197 IFYDHGPDVWGGPPGSPDEDGDRYIEIWNLVFMQFNRDAQGNMTPLPKQCVDTGMGLERI 256

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI A+ + TG+    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 257 AAVLQHVHSNYEIDLFQALINAAARETGVSDLTNN--SLKVIADHIRACSFLIVDGVIPG 314

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        ++  L  +MG AYPEL  A+  + + LR 
Sbjct: 315 NEGRGYVLRRIVRRAIRHGYKLGKKGSFFHRMVADLVAQMGGAYPELKDAEQRVTDVLRQ 374

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +LD  L+ L K   + L+G++AFKL+DT+G PLD+  D+   R + 
Sbjct: 375 EEERFFETIEHGMSILDNALAELDKKGGKTLDGELAFKLHDTYGFPLDLTADVCREREVT 434

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F++A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 435 -VDEAAFDEAMARQREQARAAGKFKMAQG-------LEYSGAKTTFHGYEEIVFDD---- 482

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V++   GQ+  VV D TPFYAE+GGQ+GD 
Sbjct: 483 ------------------AKVVALYVDGASVQQVTHGQQAVVVLDHTPFYAESGGQVGDQ 524

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G      +R  + D  K    +  HH  +E+G L+    +   ID   R + + NHSATH
Sbjct: 525 GLLANASVRFAVADTLKVQADVVGHHGTLEQGTLKVGDVVKAEIDAVRRARTARNHSATH 584

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS + PD  RFD  H+ P+T  +++ +E  VN  +  N P + 
Sbjct: 585 LMHKALREVLGSHVQQKGSLVDPDKTRFDFAHNAPMTDEQIRRVEQIVNAEVLANAPGIV 644

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 645 RVMPFDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 698

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A   +   D ++ + A+ LK     +  R+ ++ ++ ++L+
Sbjct: 699 MEGGVAAGIRRVEAITGDNAVRFVQDLDARINAAAAVLKAQPSELTQRITQVQDQVKQLE 758

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
              +  K ++             ++A V  ++  +   D K L+  +D L+ K++S  I+
Sbjct: 759 KELSALKSKMASSQGDELAGQAIEVAGVQVLAATLEGADVKTLRETVDKLKDKLKSAAIV 818

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 819 LASV-EGGKVSLIAGVTADASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 876

Query: 887 QAIAGVASFLK 897
            A+AGV  +++
Sbjct: 877 AALAGVKGWVE 887


>gi|312795632|ref|YP_004028554.1| Alanyl-tRNA synthetase [Burkholderia rhizoxinica HKI 454]
 gi|312167407|emb|CBW74410.1| Alanyl-tRNA synthetase (EC 6.1.1.7) [Burkholderia rhizoxinica HKI
           454]
          Length = 893

 Score =  934 bits (2413), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/911 (42%), Positives = 536/911 (58%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G +   Y   
Sbjct: 20  MKAAEIREKFLRFFESKGHTIVRSSSLVPANDPTLLFTNSGMVQFKDVFLGADTRPYSRA 79

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT+ + L 
Sbjct: 80  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTRVYQLP 139

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L +TVY ED+EA+ +W    G+  ++IIRI  N       DNFW MA+TGPCGPCSE
Sbjct: 140 PEKLTVTVYHEDDEAYDIWANEIGVPLERIIRIGDNKGARYASDNFWQMADTGPCGPCSE 199

Query: 175 IFFDQGECIPGGLPGS-SEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  EEG+R+IEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 200 IFYDHGPQVWGGPPGSADEEGDRFIEIWNLVFMQFNRDAQGNLTPLPKQCVDTGMGLERL 259

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI A+ + TG+    +N  + +VI DH+R+  FLI DG++P 
Sbjct: 260 AAVLQHVHSNYEIDLFQRLIAAAARETGVLDLAHN--SLKVIADHIRACGFLIVDGVIPG 317

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG   P    L+  L  EMG+AYPEL  A+  + + LR 
Sbjct: 318 NEGRGYVLRRIVRRAIRHGYKLGRKSPFFHRLVEDLVGEMGAAYPELKVAQQRVTDVLRQ 377

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +LD  LS L     ++L+G++AFKL+DT+G PLD+  D+   RG  
Sbjct: 378 EEERFFETIEHGMSILDAALSELTARGAKVLDGELAFKLHDTYGFPLDLTADVCRERG-I 436

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
           G+D ++F++A+  QR +ARA        T +            T F GYD          
Sbjct: 437 GVDEVAFDEAMARQREQARAAGKFRMVQTLD-------YTGSKTTFHGYDKHVFDD---- 485

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V    +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 486 ------------------AKVVAVYVDGTAVPSLRAGQQGVVVLDQTPFYAESGGQVGDQ 527

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G      +R  + D  K    +  HH  +E+G L+    +   +D + R + + NHSATH
Sbjct: 528 GTIGNATVRFAVFDTLKVQADVVGHHGTLEQGELKVGDVVSARVDAERRARTARNHSATH 587

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG HV Q GS + PD  RFD +H  P++  E++ +E  VN  +  N P + 
Sbjct: 588 LMHKALREVLGPHVQQKGSLVDPDKTRFDFSHHAPLSDDEIRRVEAIVNAEVLANTPGLA 647

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  +DA+ SGA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 648 RVMPFDDAVKSGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVQRTGDIGLFKIV 701

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   +  L   A+ LKV    +  R+ ++ +++R L+
Sbjct: 702 FEGGVAAGIRRVEAITGDNAVRYVQDLESTLAGAAAALKVQPAELAPRIAQVQDQFRALE 761

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
              A+ K ++              +A V+ ++  +   D K L+  +D L+ K++   I+
Sbjct: 762 KELAQLKSKIASSQGDELVSQAVDVAGVHVLAAQLEGADVKTLRETVDKLKDKLKHAAIV 821

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +    K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG + +K  
Sbjct: 822 LASVD-GGKVSLIAGVTTDASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTDPSKLP 879

Query: 887 QAIAGVASFLK 897
            A++GV  +++
Sbjct: 880 AALSGVKEWIQ 890


>gi|308187884|ref|YP_003932015.1| Alanyl-tRNA synthetase [Pantoea vagans C9-1]
 gi|308058394|gb|ADO10566.1| Alanyl-tRNA synthetase [Pantoea vagans C9-1]
          Length = 875

 Score =  933 bits (2412), Expect = 0.0,   Method: Composition-based stats.
 Identities = 400/911 (43%), Positives = 554/911 (60%), Gaps = 56/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GHE++ SSSL+P NDPTL+FTN+GM  FK++F GQ+K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHEVVTSSSLVPNNDPTLLFTNAGMNQFKDVFLGQDKRDYTRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIGFAWELLTSEQWFS 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+ +W    G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYETDDEAYNIWADEIGVPRERIIRIGDNKGSAYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           SEIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 SEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMLPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R++ VLQ   +NY+IDLF+ LIQA  QVTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RISAVLQHVNSNYEIDLFQKLIQAVAQVTGATD--LSNKSLRVIADHIRSCAFLIADGVI 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MG+A  EL + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKEAFFYKLVAPLVEVMGAAGEELQRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           +SE+++F +TL+RGL LLD  L  L   + L+G++ F+LYDT G P D+  D+   R L 
Sbjct: 361 KSEEDQFARTLERGLALLDEELEKLQ-GDTLDGEIVFRLYDTFGFPADLTADVCRERNLK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            ID   F QA+E+QR RAR              + ++     A+ F GYD L        
Sbjct: 420 -IDEAGFEQAMEQQRQRAREA------SGFGADYSNVIRIDAASSFKGYDQLD------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           +++ VKA+   GE V+E  +GQ   VV D+TPFY E+GGQ+GDT
Sbjct: 466 ----------------LAATVKALYVAGEAVDEVTAGQDAVVVLDETPFYGESGGQVGDT 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK  +    H   +  G LR    L   +D   R ++ +NHSATH
Sbjct: 510 GLLKGKNAEFSVQDTQKYGQ-AIGHVGKLTAGQLRIGDRLEAQVDAARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV+Q GS +    LRFD +H + +   E++ +ED VN  I +NLPV T
Sbjct: 569 LLHAALRQVLGEHVAQKGSLVNDKYLRFDFSHFEAMKPHEIRQVEDIVNAQIRRNLPVET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            +M+ E A + GA AL G KY+ RVRV+++     G  S  LCGGTH + TG+I L  I 
Sbjct: 629 EVMDLEAAKSKGAMALFGEKYDQRVRVLTM-----GDFSVELCGGTHAARTGDIGLFRIQ 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           +ES   AGIRRIEAITG+ A + +  Q  +L+ LA  +K +  N+  +V  + +  R L+
Sbjct: 684 AESGTAAGIRRIEAITGEGALAQVNAQSSQLQDLAQLVKANSSNLNEKVRGLVDYVRALE 743

Query: 772 LIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + + Q   ++ +        +  V  +   ++ V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLRDQQAAQESASLSSNAIDVKGVKLLVSELNNVEPKMLRTMVDDLKNQLGSAIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  VT+DL DR  A +L    A+ + GG GGGRP MAQ+GG + +   
Sbjct: 804 LATVA-EGKVSLIAGVTKDLTDRVKAGELIAGLAQQV-GGKGGGRPDMAQAGGTDADALK 861

Query: 887 QAIAGVASFLK 897
            A+AGV S++ 
Sbjct: 862 GALAGVESWVN 872


>gi|304399190|ref|ZP_07381057.1| alanyl-tRNA synthetase [Pantoea sp. aB]
 gi|304353244|gb|EFM17624.1| alanyl-tRNA synthetase [Pantoea sp. aB]
          Length = 875

 Score =  933 bits (2412), Expect = 0.0,   Method: Composition-based stats.
 Identities = 399/911 (43%), Positives = 552/911 (60%), Gaps = 56/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GHE++ SSSL+P NDPTL+FTN+GM  FK++F GQ+K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHEVVTSSSLVPNNDPTLLFTNAGMNQFKDVFLGQDKRDYTRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIGFAWELLTSEQWFS 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EAF +W    G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYETDDEAFDIWANEIGVPRERIIRIGDNKGSAYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           SEIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 SEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMLPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R++ VLQ   +NY+IDLF+ LIQA  QVTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RISAVLQHVNSNYEIDLFQKLIQAVAQVTGATD--LSNKSLRVIADHIRSCAFLIADGVI 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MG+A  EL + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKEAFFYKLVAPLIEVMGAAGEELQRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           +SE+++F +TL+RGL LLD  L  L   + L+G++ F+LYDT G P D+  D+   R L 
Sbjct: 361 KSEEDQFARTLERGLALLDEELEKLQ-GDTLDGEIVFRLYDTFGFPADLTADVCRERNLK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            ID   F QA+E+QR RAR              + ++     A+ F GYD L        
Sbjct: 420 -IDEAGFEQAMEQQRQRAREA------SGFGADYSNVIRIDAASSFKGYDQLD------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           +++ VKA+   GE V+E  +GQ   VV D+TPFY E+GGQ+GDT
Sbjct: 466 ----------------LAATVKALYVAGEAVDEVTAGQDAVVVLDETPFYGESGGQVGDT 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK  +    H   +  G LR    L   +D   R ++ +NHSATH
Sbjct: 510 GLLKGKNAEFSVQDTQKYGQ-AIGHVGKLTAGQLRIGDRLEAQVDAARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV+Q GS +    LRFD +H + +   E++ +ED VN  I +NLPV T
Sbjct: 569 LLHAALRQVLGEHVAQKGSLVNDKYLRFDFSHFEAMKPQEIRQVEDIVNAQIRRNLPVET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            +M+ + A + GA AL G KY+ RVRV+++     G  S  LCGGTH + TG+I L  I 
Sbjct: 629 EVMDLDAAKSKGAMALFGEKYDQRVRVLTM-----GDFSVELCGGTHAARTGDIGLFRIQ 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           +ES   AGIRRIEAITG+ A + +  Q  +L+ LA  +K +  N+  +V  + +  R L+
Sbjct: 684 AESGTAAGIRRIEAITGEGALAQVNAQSSQLQDLAQLVKANSSNLNEKVRGLVDHVRALE 743

Query: 772 LIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + + Q   ++ +        +  V  +   ++ V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLRDQQAAQESASLSSNAIDVKGVKLLVSELNNVEPKMLRTMVDDLKNQLGSAIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  VT+DL  R  A +L    A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVTKDLTGRVKAGELIAGLAQQV-GGKGGGRPDMAQAGGTDAKGLK 861

Query: 887 QAIAGVASFLK 897
            A+AGV S++ 
Sbjct: 862 GALAGVESWVN 872


>gi|189426203|ref|YP_001953380.1| alanyl-tRNA synthetase [Geobacter lovleyi SZ]
 gi|189422462|gb|ACD96860.1| alanyl-tRNA synthetase [Geobacter lovleyi SZ]
          Length = 876

 Score =  933 bits (2411), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/905 (42%), Positives = 539/905 (59%), Gaps = 42/905 (4%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL++F+  GH ++ SS LIP NDPTLMFTN+GM  FK+ F G E   Y   
Sbjct: 1   MTGNEIRARFLKYFEDRGHVVVSSSGLIPQNDPTLMFTNAGMNQFKDCFLGMEDRGYYRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
            + QKCVRAGGKHNDL+NVGRT RHHTFFEMLGNFSFG YFK+ AI  AW+ LTK+  LD
Sbjct: 61  ASSQKCVRAGGKHNDLENVGRTARHHTFFEMLGNFSFGDYFKKEAIAFAWEFLTKDLGLD 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGE 181
             RLY+TVY +D+EA  +W +  G+  ++I R    DNFWSM +TGPCGPC+EIF+D G 
Sbjct: 121 TSRLYVTVYTDDDEAADIWHQQEGVPRERIYRFGEKDNFWSMGDTGPCGPCTEIFWDNGP 180

Query: 182 CIPGGLPGS--SEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
            +  G P      + +RY+EIWN VFMQF +        LPK ++DTGMGLER+ TV+Q 
Sbjct: 181 EVGCGSPDCAVGCDCDRYMEIWNNVFMQFNRTADGVLHPLPKPAVDTGMGLERITTVMQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKY--EGNNIVNHRVIVDHLRSSSFLIADGILPANEGR 297
             +NYD DL + +I+  E+ +G KY     + V+ RVI DH R+ +FLI DG LP+NEGR
Sbjct: 241 VRSNYDTDLLQGIIRHIERHSGKKYGDNEKDSVSMRVIADHCRAVTFLICDGALPSNEGR 300

Query: 298 GYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDER 357
           GYVLRRIMRRA  +A++LG  EPL+  ++ A+   MG AYPEL + +  I + + +E+ER
Sbjct: 301 GYVLRRIMRRAARHAKMLGVAEPLLCRMVDAVREMMGDAYPELAERETYIRKVVLAEEER 360

Query: 358 FGKTLDRGLVLLDGVLSHLGK--DEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDI 415
           F +TLDRGL +L+  ++ L      ++ G+  FKLYDT G P+D+ +DI+ A G + +D 
Sbjct: 361 FNETLDRGLAILNEEVASLRAGGCSVIPGETLFKLYDTFGFPVDLTEDIVRAEGFS-VDE 419

Query: 416 ISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKV 475
             F   +E QR   R H  G G+     ++  L      T F+GY  L            
Sbjct: 420 PGFEACMEHQRELGREHWKGSGAAGIADVYKELHNHGLRTNFVGYGSL------------ 467

Query: 476 LCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAI 535
                         S V A+++ G+ V+ A +G K++++ D +PFY E+GGQ GDTGC  
Sbjct: 468 -----------TAFSPVTALLRDGKKVQSATAGDKIDLICDTSPFYGESGGQAGDTGCIS 516

Query: 536 GDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHH 595
               RL++    +    + VHHA+V+ G ++T  ++ LT+    RR  + NHSATHLL  
Sbjct: 517 SGSARLEVLATSRPFTDLVVHHALVKEGAIKTGDAVNLTVAIDKRRATARNHSATHLLQA 576

Query: 596 ALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMN 655
           AL  +LG H+ Q GS + P+ LRFD TH   +T  EL+ +ED VN  I  N  +  R M 
Sbjct: 577 ALRQVLGEHIKQAGSLVEPNRLRFDFTHFTGVTPEELQQVEDLVNGWIMDNAELNIREMG 636

Query: 656 REDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESS 715
            ++A+ SGA AL   KY   VRVV +     G  S+ LCGGTHV + G+I L  I+SE  
Sbjct: 637 MQEAVESGATALFDEKYGSTVRVVRI-----GEVSAELCGGTHVRAAGDIGLFKILSEGG 691

Query: 716 IRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHA 775
           I AG+RRIE  TG  A S +   + + +++A  LK     +V RVE++ E  R+LQ    
Sbjct: 692 IAAGVRRIEGATGFNALSFVRRLEGERQTVAELLKADSSKLVDRVEKLVERQRELQREVE 751

Query: 776 KRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGI 830
             + +LN            +   V  ++  +  VD K L+ + D L+ K+ SG+++L G 
Sbjct: 752 SLQGKLNTAQSGDLLSQVQEAGGVKLLAVQVQVVDIKALRDMADQLRDKLGSGVVVL-GA 810

Query: 831 SKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIA 890
             + KA++L+ VT+DL  RF A +L    A ++ GG GGG+P +AQ+GG    K  +A+A
Sbjct: 811 ELDGKANLLVTVTKDLTGRFKAGELVGTLAPII-GGRGGGKPELAQAGGSQPEKLPEALA 869

Query: 891 GVASF 895
            V++ 
Sbjct: 870 AVSAL 874


>gi|332173020|gb|AEE22274.1| alanyl-tRNA synthetase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 865

 Score =  933 bits (2411), Expect = 0.0,   Method: Composition-based stats.
 Identities = 388/903 (42%), Positives = 561/903 (62%), Gaps = 48/903 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL FF   GH+ + SSSL+P +DPTL+FTN+GM  FK++F G E+  Y   
Sbjct: 3   KSTAQIRQAFLNFFADKGHQKVSSSSLVPSDDPTLLFTNAGMNQFKDVFLGTEQRKYTRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK++AI  AW  LT+E  L 
Sbjct: 63  TSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQQAIAYAWTFLTQELKLP 122

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGE 181
           + +L +T+Y ED+EAF +W    G+  +KIIRI T+DNFWSM +TGPCGPCSEIF+D GE
Sbjct: 123 KEKLLVTIYSEDDEAFDIWHNEIGVPKEKIIRIATSDNFWSMGDTGPCGPCSEIFYDHGE 182

Query: 182 CIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEK 240
            I GG P    E+G+R+IEIWNLVFMQF +Q   +   LPK SIDTGMGLER++ +LQ  
Sbjct: 183 HIWGGPPGTPEEDGDRFIEIWNLVFMQFNRQANGDMLPLPKPSIDTGMGLERISAILQNV 242

Query: 241 TNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYV 300
            +NY+ID+F++LI+A+ ++ G         + RV+ DH+RS SFLI+DG++P+NEGRGYV
Sbjct: 243 HSNYEIDIFQNLIKATAEIVGTS--SLEDKSLRVVADHIRSCSFLISDGVMPSNEGRGYV 300

Query: 301 LRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGK 360
           LRRI+RRA+ +   LG        L+ AL TEMG AYPEL + + +IE+ LR E+E+F +
Sbjct: 301 LRRIIRRAVRHGNKLGAKGVFFYKLVAALATEMGDAYPELNEQRAVIEKVLRVEEEQFSR 360

Query: 361 TLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQ 420
           TL+RG+++L+  LS L   +++ G++ FKLYDT+G P D+  D+   +GL+ ID   F Q
Sbjct: 361 TLERGMLILNDALSELE-GKVVPGELVFKLYDTYGFPADLTNDVAREKGLS-IDEEGFEQ 418

Query: 421 ALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKP 480
           A+ EQR RA+           +  +         + F+GY+L                  
Sbjct: 419 AMAEQRKRAQKA------SNFDLDYNEQLRSDLESVFVGYEL------------------ 454

Query: 481 PIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIR 540
                   ++ +K I  QG+ V E  +G +  ++ D++PFYAEAGGQ GDTG  + D   
Sbjct: 455 -----EQNTAQIKEIFVQGQSVAEIAAGMEGTIILDESPFYAEAGGQAGDTGTLVKDSGG 509

Query: 541 LQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTI 600
            ++ D  K  + I   H       L+   S+   ++   R  + +NHSATHL+H AL ++
Sbjct: 510 FEVQDTVKLGKAI--AHKGAALSELKVGDSVQANVNGARRHAIKLNHSATHLMHAALKSV 567

Query: 601 LGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAI 660
           LG HV+Q GS + P+ LRFD +H + +T  ++ ++E  VN+ I  N  + T++M  E A 
Sbjct: 568 LGEHVNQKGSLVQPERLRFDFSHYEAMTKEQVLAVETMVNEQILANHALQTKLMGLEQAK 627

Query: 661 ASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGI 720
            +GA AL G KY+D VRVVS+     G  S  LCGGTHV+ TG+I L  I+SES I +G+
Sbjct: 628 EAGAMALFGEKYDDDVRVVSM-----GDFSMELCGGTHVARTGDIGLFKIISESGIASGV 682

Query: 721 RRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQ 780
           RRIEA+TG  A  ++  Q  +L S+++ LK     V  RV ++ E+ + L+    K K +
Sbjct: 683 RRIEAVTGITALQYVQQQAFELTSISAVLKTDVTTVGERVLQLIEQTKTLEKEVTKLKQE 742

Query: 781 LNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKK 835
           +     S      ++I  V  +S+ +  ++S  L++++D L+ +I SG+I+L G++  +K
Sbjct: 743 IANSAGSDLLSQINEINGVKVLSYHVQGIESGALRTMIDDLKNQIGSGVILL-GVATGEK 801

Query: 836 ASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASF 895
            S++  VT+DL  +  A +L    A+ + GG GGGRP MAQ+GG      D AIA V  +
Sbjct: 802 VSLIAGVTKDLTQKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGSQPENLDSAIASVNEW 860

Query: 896 LKK 898
           L++
Sbjct: 861 LQE 863


>gi|170701933|ref|ZP_02892858.1| alanyl-tRNA synthetase [Burkholderia ambifaria IOP40-10]
 gi|170133166|gb|EDT01569.1| alanyl-tRNA synthetase [Burkholderia ambifaria IOP40-10]
          Length = 874

 Score =  933 bits (2411), Expect = 0.0,   Method: Composition-based stats.
 Identities = 378/912 (41%), Positives = 534/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTLMFTNSGMV FK++F G +   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIRFAWELLTTVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW+M +TGPCGPC+E
Sbjct: 121 KDKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWTMGDTGPCGPCTE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK S+DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKQSVDTGMGLERL 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ +VT +    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIKAAARVTEISDLTNN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGSFFHKLVADLVAEMGGAYPELKEAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLS--HLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+       ++L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALADVEAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGMT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYTGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVDGSAVNEVKAGQDAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    +   ID   R +   NHSATH
Sbjct: 509 GLLANASTRFAVADTLKVQADVVGHHGTLEQGTLKIGDVMRAEIDAHRRARTQRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS +  +  RFD  H+ P+T  E++ +E  VN+ I  N P + 
Sbjct: 569 LMHKALREVLGAHVQQKGSLVDAEKTRFDFAHNAPMTDDEIRRVEQIVNNEILANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I    IV
Sbjct: 629 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGFFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   D ++   A+ LK     +  R+ ++ ++ + L+
Sbjct: 683 VEGGVAAGIRRVEAITGDNAVRYVQDLDARMNEAAAALKAQPSELTQRIAQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             +I  V  ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSKLASSQGDELAQQATEIGGVYVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LAAV-EGGKVSLIAGVTPDASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLKK 898
            A+AGV  ++++
Sbjct: 861 GALAGVKGWVEE 872


>gi|269101880|ref|ZP_06154577.1| alanyl-tRNA synthetase [Photobacterium damselae subsp. damselae CIP
           102761]
 gi|268161778|gb|EEZ40274.1| alanyl-tRNA synthetase [Photobacterium damselae subsp. damselae CIP
           102761]
          Length = 873

 Score =  932 bits (2409), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/910 (42%), Positives = 548/910 (60%), Gaps = 54/910 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            +   IR  +L FF+  GH+++ SSSL+P NDPTL+FTN+GM  FK++F G EK  Y   
Sbjct: 3   MSTDEIRRAYLAFFESKGHQIVESSSLVPANDPTLLFTNAGMNQFKDVFLGLEKRSYTRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+ LT   +L 
Sbjct: 63  TTAQRCVRAGGKHNDLENVGFTARHHTFFEMLGNFSFGDYFKHDAIKYAWEFLTTVLELP 122

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + RL +T+Y+ D+EAF++W K  G+ AD+I+RI  N       DNFW M +TGPCGPC+E
Sbjct: 123 EDRLLVTIYESDDEAFEIWNKEVGIPADRIVRIGDNKGAPFASDNFWQMGDTGPCGPCTE 182

Query: 175 IFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IFFD G+ I GG P    E+G+R+IEIWN VFMQ+ +Q       LPK S+DTGMG+ER+
Sbjct: 183 IFFDHGDHIWGGRPGTPEEDGDRFIEIWNNVFMQYNRQADGTMEPLPKPSVDTGMGIERI 242

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A ++Q   +NY+ID+FK LI+ +  + G  Y+  +  + RV+ DH+RS ++LIADG++P+
Sbjct: 243 AAIMQGVHSNYEIDIFKTLIKDAADIIG--YDDLSNQSLRVVADHIRSCAYLIADGVMPS 300

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L   MG+A  EL + + ++E+ L+ 
Sbjct: 301 NEGRGYVLRRIIRRAVRHGNKLGAKGAFFYKLVGPLADVMGTAGSELKKQQEMVEKVLKI 360

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGI 413
           E+E FG+TLDRGL +L+  L +L    IL+G+  FKLYDT+G P D+  D+   RG   I
Sbjct: 361 EEENFGRTLDRGLTILNEALDNLD-GSILDGETVFKLYDTYGFPADLTNDVARERGFT-I 418

Query: 414 DIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDR 473
           D   F  A+EEQR RAR       +G     + ++ +    T+F GY+   G        
Sbjct: 419 DEEGFEAAMEEQRQRAR------DAGQFGVDYNNVIKVDADTEFKGYEATDG-------- 464

Query: 474 KVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGC 533
                            ++ AI + GE V+   +G++  +V DQTPFYAE+GGQ GDTG 
Sbjct: 465 ---------------EGVIVAIYRDGEEVDALAAGEEAIIVLDQTPFYAESGGQCGDTG- 508

Query: 534 AIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLL 593
           A+            +K      H   +  G L+    L  T+D+  R  +S+NHSATHL+
Sbjct: 509 ALAAAGVAFTVADTQKFGHAIGHKGTLTEGALKVGDKLAATVDHVRRGAISLNHSATHLM 568

Query: 594 HHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRI 653
           H AL  +LG HV+Q GS + PD LRFD +H + +   +L+ +E  VND I  N  + T I
Sbjct: 569 HAALRKLLGEHVAQKGSLVKPDSLRFDFSHLEAVKPEQLREVERMVNDQIRLNHAIDTEI 628

Query: 654 MNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSE 713
           M+ E A   GA AL G KY+D+VRV+S+     G  S+ LCGG H   TG+I L  IVSE
Sbjct: 629 MDIEAAKEKGAMALFGEKYDDQVRVLSM-----GDFSTELCGGIHAKRTGDIGLFKIVSE 683

Query: 714 SSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLI 773
             I AGIRRIEA+TG  A   L  QDE+L   A  +K    +VV +VE +    ++L+  
Sbjct: 684 GGIAAGIRRIEAVTGAAAIEALHAQDEQLAKAARLVKSDTASVVNKVEALVSHSKQLEKE 743

Query: 774 HAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
             + K +L  ++ +       +I  V  +   +   D+K L+ ++D L+ ++ SGI++L 
Sbjct: 744 IQQLKDKLAAQEGAGLINQAQEINGVKVLIAKLDGADNKALRGMVDELKNQLSSGIVVLG 803

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQA 888
            +S + K  ++  VT+DL+ +  A +L  + A+ + GG GGGRP MAQ+GG + +    A
Sbjct: 804 NVS-DDKVGLIAGVTKDLIGKVKAGELVNMVAQQV-GGKGGGRPDMAQAGGTDASALPAA 861

Query: 889 IAGVASFLKK 898
           +    +++++
Sbjct: 862 LESAKAWIEE 871


>gi|257465412|ref|ZP_05629783.1| alanyl-tRNA synthetase [Actinobacillus minor 202]
 gi|257451072|gb|EEV25115.1| alanyl-tRNA synthetase [Actinobacillus minor 202]
          Length = 874

 Score =  932 bits (2409), Expect = 0.0,   Method: Composition-based stats.
 Identities = 378/912 (41%), Positives = 542/912 (59%), Gaps = 56/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   S IR +FL+FFQ  GH ++ SSSL+P NDPTL+FTN+GM  FK++F G EK  Y  
Sbjct: 1   MKTTSEIRQSFLDFFQSKGHTVVESSSLVPENDPTLLFTNAGMNQFKDVFLGLEKRPYTR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEM+GNFSFG YFK+ AIQ  W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKQDAIQFGWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +LY+TVY+ D+EA+ +W KI G+ AD IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLYVTVYETDDEAYDIWHKIVGVPADHIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+   GGLP    E+G+R+IE+WN+VFMQF +Q       LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGDKYWGGLPGTPEEDGDRFIEVWNIVFMQFNRQADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ERM  V+Q   +NY+ID+F+ LI+   ++  +K    +  + RVI DH+RS S+LIADG+
Sbjct: 241 ERMTAVMQHVNSNYEIDIFQTLIKTIAELLNVKD--LDNKSLRVIADHIRSCSYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
            P+NEGRGYVLRRI+RRA+ +  +LG  E     L+P L   MG A   + Q +  I++T
Sbjct: 299 APSNEGRGYVLRRIIRRAVRHGNILGAKEAFFYKLVPTLAQVMGHAGEIVAQKQAHIQKT 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           L++E+E+F +TL+RGL LL+  L+ +  +  L+GDVAFKLYDT+G PLD+  D+   R  
Sbjct: 359 LKAEEEQFARTLERGLALLEDALTKVE-NNTLSGDVAFKLYDTYGFPLDLTADVCRERN- 416

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F   ++ QR RA+A S           + ++ +  G T FIGYD L       
Sbjct: 417 IVIDEAGFEAEMQAQRERAKASSNFG------VDYNNVIKVDGKTDFIGYDNL------- 463

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + V  +   G  V+   SG+   ++ D+TPFYAE GGQ+GD
Sbjct: 464 ----------------TAEATVVGLFSNGNAVDVVKSGENAIIILDKTPFYAEMGGQVGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G    +  +  + D QK    +F H   +E G L+    +   +  + R  + +NHSAT
Sbjct: 508 SGRISTEFCQFHVVDTQKYG-QVFGHIGQIEAGELKVGDKVTAEVAAERRHSIQLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG+HV Q GS +  +GLRFD +  + IT  +L++IE  VN  I +N+ VV
Sbjct: 567 HLLHSALREVLGTHVMQKGSLVNENGLRFDFSQPEAITKEQLEAIERIVNAKIRENIEVV 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
              M  E+A A GA AL G KY D VRVV +      V S  LCGGTHV  TG+I L  I
Sbjct: 627 IEEMGIEEAKAKGAMALFGEKYGDVVRVVDM-----SVFSIELCGGTHVKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
            SE ++ AG+RR+EAITG+ A + L    +  +  A  LK    N+V +++++ ++ ++L
Sbjct: 682 TSEGAVAAGVRRVEAITGEAALAWLHNLQQMTQHSAELLKADSTNLVEKIQQLQDKAKRL 741

Query: 771 QLIHAKRKLQLNVE-----DLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +    + K +   +          +I  VN +   +   + K L++++D L+ ++ S I+
Sbjct: 742 EKELQQLKEKQASQAGADLAKQAKQINGVNVVVTQLENTEPKVLRTMVDDLKNQLGSAIV 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +L G   + K ++++ V+ DL  +  A +L    A  + GG GGGRP MA +GG      
Sbjct: 802 VL-GTVADDKVNLIVGVSSDLTTQIKAGELVGEMATYV-GGKGGGRPDMAMAGGSEPQNL 859

Query: 886 DQAIAGVASFLK 897
            +A+     +++
Sbjct: 860 AKALNFAQEWIQ 871


>gi|197284276|ref|YP_002150148.1| alanyl-tRNA synthetase [Proteus mirabilis HI4320]
 gi|227357820|ref|ZP_03842168.1| alanyl-tRNA synthetase [Proteus mirabilis ATCC 29906]
 gi|194681763|emb|CAR40964.1| alanyl-tRNA synthetase [Proteus mirabilis HI4320]
 gi|227161930|gb|EEI46948.1| alanyl-tRNA synthetase [Proteus mirabilis ATCC 29906]
          Length = 875

 Score =  932 bits (2408), Expect = 0.0,   Method: Composition-based stats.
 Identities = 388/911 (42%), Positives = 543/911 (59%), Gaps = 56/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++PSSSL+P NDPTL+FTN+GM  FK++F G +   Y   
Sbjct: 3   KSTAEIRQAFLDFFHTKGHQIVPSSSLVPNNDPTLLFTNAGMNQFKDVFLGLDNRPYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + F+
Sbjct: 63  TTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAINFAWELLTGKEWFN 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY  D+EA+ +W K  G+ A++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYATDDEAYDIWNKEVGVPAERIIRIGDNKGAPFASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG P    E+G+RYIEIWN+VFMQF +++      LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGTPEEDGDRYIEIWNIVFMQFNRKSDGTMDPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+  VLQ   +NYDIDLF+ LI++  +VT      N   + RVI DH+RS SFL+ DG++
Sbjct: 243 RITAVLQHVNSNYDIDLFRALIKSVAEVTNATDLANK--SLRVIADHIRSCSFLVCDGVI 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NEGRGYVLRRI+RRA+ +  +LG  +     L+  L   M  A  EL   + ++E+ L
Sbjct: 301 PSNEGRGYVLRRIIRRAVRHGYMLGAKDTFFYKLVAPLIDVMAEAGKELKNQQEIVEKVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L  L   + L G+ AF+LYDT+G PLD+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLQLLDEELEKLT-GDTLAGETAFRLYDTYGFPLDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR       S      +  L +    + F GYD          
Sbjct: 420 -VDEEGFELAMEEQRKRARE------SSGFGTDYNELIKVDSRSDFSGYDH--------- 463

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                         N     + AI   G+ V E  +G++  +  D+T FYAE+GGQ+GD 
Sbjct: 464 --------------NEQQGTINAIFHNGQTVTELKAGEEGIIFLDKTAFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G  IG   + ++TD QK  +    H   V  G       +   ID   R  + +NHSATH
Sbjct: 510 GLLIGKDSQFEVTDTQKYGK-AIGHIGKVISGSFIVNHKINAVIDVARRDAIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG+HV+Q GS +    LRFD +H + +   +L+ IED VN  I  N PVVT
Sbjct: 569 LLHAALRQVLGTHVTQKGSLVNDKYLRFDFSHFEAVKPEQLREIEDIVNAQIRLNSPVVT 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            +M+ EDA   GA AL G KY +RVRV+++     G  S+ LCGGTH + TG+I L  I+
Sbjct: 629 ELMDLEDAKQKGAMALFGEKYEERVRVLTM-----GDFSTELCGGTHAARTGDIGLFRIM 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AGIRRIEAITG  A   +  Q + +  +A  LK    N+V +++ + E+YR L+
Sbjct: 684 SESGTAAGIRRIEAITGATAIESVHEQSDLISLVAHALKSDGSNLVEKIKTVQEKYRSLE 743

Query: 772 LIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++ S        +  +  +   ++ V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKDQQAAQESSSLGSQAKNVKGIKLLVRELNNVEPKMLRTMVDDLKNQLGSAIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L     + K S+++ VT+DL  +  A +L    A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 L-STISDGKVSLIVGVTKDLTAKIKAGELISFVAQQI-GGKGGGRPDMAQAGGTDVEALP 861

Query: 887 QAIAGVASFLK 897
            A+A V  +++
Sbjct: 862 AALASVDEWVE 872


>gi|205830049|sp|Q39HB7|SYA_BURS3 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
          Length = 874

 Score =  931 bits (2407), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/912 (41%), Positives = 535/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTLMFTNSGMV FK++F G +   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIKFAWELLTTVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW+M +TGPCGPC+E
Sbjct: 121 KDKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWTMGDTGPCGPCTE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK S+DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKQSVDTGMGLERL 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ +VT +    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIKAAARVTEISDLTNN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGSFFHKLVADLVAEMGVAYPELKEAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLS--HLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+G L+       ++L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEGALADVEAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGMT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKAAQG-------LEYTGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + + A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKIVALYVDGSSVNEVKTGQDAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    L   ID   R +   NHSATH
Sbjct: 509 GVLANAATRFAVADTLKVQADVIGHHGTLEQGTLKVGDVLRAEIDAHRRARTQRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS +  +  RFD  H+ P+T  E++ +E  VN+ I  N P + 
Sbjct: 569 LMHKALREVLGAHVQQKGSLVDAEKTRFDFAHNAPMTDDEIRRVEQIVNNEILANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHVS +G+I    IV
Sbjct: 629 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVSRSGDIGFFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   D ++   A+ LK     +  R+ ++ ++ + L+
Sbjct: 683 VEGGVAAGIRRVEAITGDNAVRYVQELDARVNEAAAALKAQPSELTQRIAQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             +I  V  ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSKLASSQGDELAQQAVEIGGVFVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +    K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LAAVES-GKVSLIAGVTPDASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLKK 898
            A+AGV  ++++
Sbjct: 861 GALAGVKGWVEE 872


>gi|167570231|ref|ZP_02363105.1| alanyl-tRNA synthetase [Burkholderia oklahomensis C6786]
          Length = 874

 Score =  931 bits (2407), Expect = 0.0,   Method: Composition-based stats.
 Identities = 377/912 (41%), Positives = 531/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 1   MKAAEIREKFLRFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + L 
Sbjct: 61  TTSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTTVYKLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY +D+EA+ +W K  G+ A +IIRI  N       DNFW M +TGPCGPCSE
Sbjct: 121 ADKLWVTVYHDDDEAYDIWAKEVGVPAGRIIRIGDNKGARYASDNFWQMGDTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ + TG+    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIKAAARETGIGDLTNN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG AYPEL +A   + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGSFFHKLVADLVAEMGEAYPELKEAGQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L  L     + L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALGDLESKGGKTLDGELAFKLHDTYGFPLDLTADVCRERGVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +   +            T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQGLD-------YSGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYIDGSSVNEVKAGQSAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    +   ID   R + + NHSATH
Sbjct: 509 GVLANAVTRFAVADTLKVQADVIGHHGELEQGALKVGDVVRAEIDAARRARTARNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD  H+ P+T  E++ +E  VN+ +  N P + 
Sbjct: 569 LMHKALRDVLGSHVQQKGSLVDADKTRFDFAHNAPLTDDEIRRVEAIVNEQVLANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL   KY D VRV+ +        S  LCGGTHV  TG+I    IV
Sbjct: 629 RVMPYDEAVKGGAMALFDEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGFFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           +E  + AGIRR+EAITG  A  ++   D ++ + A+ LK     ++ R+ ++ ++ + L+
Sbjct: 683 AEGGVAAGIRRVEAITGDNAVRYVQALDARVNAAAAALKAQPSELIQRIGQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
              A  K +L         L   ++  V+ ++  +   D+K L+  +D L+ K+++  I+
Sbjct: 743 KELAALKSKLASSQGDELALQAIEVGGVHVLAATLDGADAKTLRETVDKLKDKLKNAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +    K S++  VT +   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LAAVD-GGKVSLIAGVTPEASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLKK 898
            A+AGV  ++++
Sbjct: 861 AALAGVKGWVEE 872


>gi|205830050|sp|Q1BX19|SYA_BURCA RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
          Length = 874

 Score =  931 bits (2407), Expect = 0.0,   Method: Composition-based stats.
 Identities = 382/912 (41%), Positives = 538/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTLMFTNSGMV FK++F G +   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHH FFEMLGNFSFG YFK  AI+ AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHAFFEMLGNFSFGDYFKHDAIKFAWELLTTVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW+M +TGPCGPC+E
Sbjct: 121 KDKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWTMGDTGPCGPCTE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK S+DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKQSVDTGMGLERL 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ +VT +    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIKAAARVTEISDLTNN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGAFFHKLVADLVAEMGTAYPELKEAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ +     ++L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALAEVEAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGMT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYSGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVDGSAVNEVKAGQDAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    L   ID Q R +   NHSATH
Sbjct: 509 GVLANAATRFAVADTLKVQADVIGHHGTLEQGTLKVGDVLRAEIDAQRRARTQRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS +  D  RFD  H+ P+T  E++ +E  VN+ I  N P + 
Sbjct: 569 LMHKALREVLGAHVQQKGSLVDADKTRFDFAHNAPMTDDEIRRVEQIVNNEILANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 629 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   D ++   A+ LK     +  R+ ++ E+ + L+
Sbjct: 683 VEGGVAAGIRRVEAITGDNAVRYVQELDARVNEAAAALKAQPSELTQRIAQVQEQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             ++A V  ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSKLASSQGDELAQQAVEVAGVYVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LAAV-EGGKVSLIAGVTPDASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLKK 898
            A+AGV  ++++
Sbjct: 861 GALAGVKGWVEE 872


>gi|107022482|ref|YP_620809.1| alanyl-tRNA synthetase [Burkholderia cenocepacia AU 1054]
 gi|105892671|gb|ABF75836.1| alanyl-tRNA synthetase [Burkholderia cenocepacia AU 1054]
          Length = 897

 Score =  931 bits (2407), Expect = 0.0,   Method: Composition-based stats.
 Identities = 382/912 (41%), Positives = 538/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTLMFTNSGMV FK++F G +   Y   
Sbjct: 24  MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRA 83

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHH FFEMLGNFSFG YFK  AI+ AW+LLT  + L 
Sbjct: 84  TTAQRSVRAGGKHNDLENVGYTARHHAFFEMLGNFSFGDYFKHDAIKFAWELLTTVYQLP 143

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW+M +TGPCGPC+E
Sbjct: 144 KDKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWTMGDTGPCGPCTE 203

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK S+DTGMGLER+
Sbjct: 204 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKQSVDTGMGLERL 263

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ +VT +    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 264 AAVLQHVHSNYEIDLFQNLIKAAARVTEISDLTNN--SLKVIADHIRACSFLIVDGVIPG 321

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 322 NEGRGYVLRRIVRRAIRHGYKLGRKGAFFHKLVADLVAEMGTAYPELKEAEQRVTDVLRQ 381

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ +     ++L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 382 EEERFFETIEHGMSILEAALAEVEAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGMT 441

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 442 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYSGAKTTFHGYEEIAFDD---- 489

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 490 ------------------AKVVALYVDGSAVNEVKAGQDAVVVLDHTPFYAESGGQVGDQ 531

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    L   ID Q R +   NHSATH
Sbjct: 532 GVLANAATRFAVADTLKVQADVIGHHGTLEQGTLKVGDVLRAEIDAQRRARTQRNHSATH 591

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS +  D  RFD  H+ P+T  E++ +E  VN+ I  N P + 
Sbjct: 592 LMHKALREVLGAHVQQKGSLVDADKTRFDFAHNAPMTDDEIRRVEQIVNNEILANAPGIV 651

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 652 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 705

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   D ++   A+ LK     +  R+ ++ E+ + L+
Sbjct: 706 VEGGVAAGIRRVEAITGDNAVRYVQELDARVNEAAAALKAQPSELTQRIAQVQEQVKSLE 765

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             ++A V  ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 766 KELGALKSKLASSQGDELAQQAVEVAGVYVLAATLDGADAKTLRETVDKLKDKLKSAAIV 825

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 826 LAAV-EGGKVSLIAGVTPDASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 883

Query: 887 QAIAGVASFLKK 898
            A+AGV  ++++
Sbjct: 884 GALAGVKGWVEE 895


>gi|171321470|ref|ZP_02910415.1| alanyl-tRNA synthetase [Burkholderia ambifaria MEX-5]
 gi|171093253|gb|EDT38456.1| alanyl-tRNA synthetase [Burkholderia ambifaria MEX-5]
          Length = 874

 Score =  931 bits (2406), Expect = 0.0,   Method: Composition-based stats.
 Identities = 378/911 (41%), Positives = 534/911 (58%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTLMFTNSGMV FK++F G +   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIRFAWELLTTVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW+M +TGPCGPC+E
Sbjct: 121 KDKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWTMGDTGPCGPCTE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK S+DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKQSVDTGMGLERL 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ +VT +    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIKAAARVTEISDLTNN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGSFFHKLVADLVAEMGAAYPELKEAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLS--HLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+       ++L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALADVEAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGMT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYTGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVDGSAVNEVKAGQDAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    L   ID   R +   NHSATH
Sbjct: 509 GVLANAATRFAVADTLKVQADVVGHHGTLEQGTLKIGDVLRAEIDAHRRARTQRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS +  +  RFD  H+ P+T  E++ +E  VN+ I  N P + 
Sbjct: 569 LMHKALREVLGAHVQQKGSLVDAEKTRFDFAHNAPMTDDEIRRVEQIVNNEILANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I    IV
Sbjct: 629 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGFFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A   +   D ++   A+ LK     +  R+ ++ ++ + L+
Sbjct: 683 VEGGVAAGIRRVEAITGDNAVRFVQDLDARMNEAAAALKAQPSELTQRIAQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             ++  V  ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSKLASSQGDELAQQATEVGGVYVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG +     
Sbjct: 803 LAAV-EGGKVSLIAGVTPDASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTDPANLP 860

Query: 887 QAIAGVASFLK 897
            A+AGV  +++
Sbjct: 861 GALAGVKGWVE 871


>gi|183596274|ref|ZP_02958302.1| hypothetical protein PROSTU_00005 [Providencia stuartii ATCC 25827]
 gi|188023874|gb|EDU61914.1| hypothetical protein PROSTU_00005 [Providencia stuartii ATCC 25827]
          Length = 876

 Score =  931 bits (2406), Expect = 0.0,   Method: Composition-based stats.
 Identities = 393/910 (43%), Positives = 556/910 (61%), Gaps = 55/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHTKGHQVVSSSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRAYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + F+
Sbjct: 63  TTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAINFAWELLTGKEWFN 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY+ D+EA+ +W K  G+  D+IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKEKLWVTVYETDDEAYDIWHKEVGIPVDRIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D GE I GG PGS  E+G+RYIEIWN+VFMQF +Q+      LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGEHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQSDGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDID+F+ LI A+ + TG      +  + RVI DH+RS +FL++DG++
Sbjct: 243 RIAAVLQHVNSNYDIDIFQELIAAAAKATGSND--LSNKSLRVIADHIRSCAFLVSDGVI 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NEGRGYVLRRI+RRA+ +  +LG  +     L+  L   MG+A  EL + +  +E+ L
Sbjct: 301 PSNEGRGYVLRRIIRRAVRHGYMLGAKDTFFYKLVAPLINVMGAAADELARQQSTVEKVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+  F+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLQLLDEELAALK-GDTLDGETVFRLYDTYGFPMDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F +A+E+QR RAR       S      + SL +    ++F GY           
Sbjct: 420 -VDEEGFERAMEDQRRRARE------SSGFGTDYNSLIKVEKHSEFSGY----------- 461

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                         N   + + AI + G+ V+   +G++  V+ D+T FYAE+GGQ+GDT
Sbjct: 462 ------------AYNEQLATITAIYKNGQPVDSLNAGEEGLVILDKTAFYAESGGQVGDT 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G    D     +TD QK       H   VE G L     +   ID + R  + +NHSATH
Sbjct: 510 GLLRNDSGSFIVTDTQKYG-QAIGHIGKVESGSLVINHRIDAKIDVERRDAIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HVSQ GS +    LRFD +H + +T+A+L+ +ED VN  I +N P+ T
Sbjct: 569 LLHAALRQVLGEHVSQKGSLVNDKYLRFDFSHFEAMTAAQLREVEDIVNAQIRKNTPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            +M+ E A A GA AL G KY +RVRV+S+    GG  S  LCGGTH S TG+I L  I+
Sbjct: 629 ELMDLESAKAKGAMALFGEKYEERVRVLSM----GGDFSIELCGGTHASRTGDIGLFRIL 684

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA TG+ A   +  Q E+L ++A  LK    ++V +V+   E+ R+L+
Sbjct: 685 SESGTAAGVRRIEATTGESALESVHSQSEQLNAIAHLLKGDMSSLVEKVKSALEKSRQLE 744

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          I  V  +   ++  + K L++++D L+ +++S II+
Sbjct: 745 KEILQLKDQQASQESASLSSKAKDIKGVKLLVSQLNNTEPKLLRTMVDDLKNQLKSAIIV 804

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L   +   K S+++ VT DL  +  A DL    A+ + GG GGGRP MAQ+GG + +   
Sbjct: 805 L-STTSGDKVSIIVGVTNDLTAKIKAGDLISYVAQQV-GGKGGGRPDMAQAGGTDVSALP 862

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 863 TAMASVEDWV 872


>gi|315635122|ref|ZP_07890400.1| alanine--tRNA ligase [Aggregatibacter segnis ATCC 33393]
 gi|315476084|gb|EFU66838.1| alanine--tRNA ligase [Aggregatibacter segnis ATCC 33393]
          Length = 874

 Score =  931 bits (2405), Expect = 0.0,   Method: Composition-based stats.
 Identities = 387/912 (42%), Positives = 554/912 (60%), Gaps = 56/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR ++L+FF   GH+++ SSSL+P NDPTL+FTN+GM  FKN+F G EK  Y  
Sbjct: 1   MKTTAQIRQSYLDFFHSKGHQVVASSSLVPDNDPTLLFTNAGMNQFKNVFLGLEKRPYTR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI   W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAIHYGWEFLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + RL++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW M +TGPCGP
Sbjct: 121 GLPKERLWVTVYETDDEAYNIWHKEIGIPAERIIRIGDNKGAPYASDNFWQMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRHADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NYDID+FK LI    ++TG K   N   + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYDIDIFKTLIAKVAELTGEKDLANK--SLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG TE     L+P L   M  A  E+ + +  +E+ 
Sbjct: 299 VPSNEGRGYVLRRIIRRAVRHGHLLGATEAFFYKLVPTLIDVMAEAGEEVKKQQATVEKF 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  L+++  + +L+G+VAFKLYDT+G PLD+  D+   RG 
Sbjct: 359 LRLEEEQFARTLERGLTLLDEALANVK-ENVLSGEVAFKLYDTYGFPLDLTADVCRERG- 416

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID + F + +E QR RA++ S           + S+    G T+F GY          
Sbjct: 417 IAIDEVGFEREMELQRVRAQSASQFGM------DYNSVIRVDGTTRFEGYTESETL---- 466

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + V A+  +G  VE   +GQ   V+ D TPFYAE+GGQ+GD
Sbjct: 467 -------------------AKVTALFHEGNPVESISAGQSAVVILDNTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
            G   G+G    + D QK    +F H   + +G L    S+   +D   R+++S+NHSAT
Sbjct: 508 IGRLEGNGFCFDVKDTQKYG-QVFGHIGELTQGSLSVGQSVNAVVDDVRRQRISLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++   LRFD    + I+ A+L  +E  VN  +  N P+ 
Sbjct: 567 HLLHAALRQVLGEHVAQKGSLVSDTLLRFDFAQHEAISKAQLAEVERIVNQQVRANNPIQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM  E A A GA AL G KY+++VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMELEAAKAKGAMALFGEKYSEQVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           V+E+++ AGIRRIEAITG+ A   L  Q   L   A  LK    +V  ++  + ++Y+K+
Sbjct: 682 VTETAVAAGIRRIEAITGETAIEWLQHQQTLLNQSAELLKSDVNSVTDKISLLQDKYKKV 741

Query: 771 QLIHAKRKLQLNVE-----DLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  +I  V+ +   +  +++K L++++D+L+ ++ S ++
Sbjct: 742 EKELQTLKEKAALQAGNDLAKSAVEINGVSVIVQQLDGIEAKSLRAMVDSLKNQLGSAVV 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +      ++K ++++ VT+DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 VFASAL-DEKVNLIVGVTQDLTAKVKAGELVNLMAQQV-GGKGGGRPDMAMAGGTEPQNI 859

Query: 886 DQAIAGVASFLK 897
           ++A++  + +LK
Sbjct: 860 NKALSVCSDWLK 871


>gi|317049269|ref|YP_004116917.1| alanyl-tRNA synthetase [Pantoea sp. At-9b]
 gi|316950886|gb|ADU70361.1| alanyl-tRNA synthetase [Pantoea sp. At-9b]
          Length = 875

 Score =  931 bits (2405), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 547/910 (60%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F GQ+K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGQDKRDYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  AW+LLT  + F 
Sbjct: 63  TTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKKDAIAYAWELLTGEQWFK 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+ +W    G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKDRLWVTVYETDDEAYDIWANDIGIPRERIIRIGDNKGSAYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           SEIFFD G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 SEIFFDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMQPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NY+IDLF  LI++   VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYEIDLFAKLIKSVADVTGATD--LSNKSLRVIADHIRSCAFLIADGVI 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  +     L+  L   MGSA  +L + +  +E  L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKDAFFYKLVAPLIEVMGSAGEDLQRQQAQVENVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F KTL+RGL LLD  L+ L   + L+G+  F+LYDT G P+D+  D+   R L 
Sbjct: 361 KAEEEQFAKTLERGLALLDEELAKLQ-GDTLDGETVFRLYDTFGFPVDLTADVCRERDLK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            ID   F  A+E+QR RAR              + ++     A+ F GYD L        
Sbjct: 420 -IDEAGFEVAMEQQRQRAREA------SGFGADYNNVIRIDSASAFKGYDQL-------- 464

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++S V+A+   G+ V+   +GQ   VV D+TPFY E+GGQ+GDT
Sbjct: 465 ---------------ALASTVQALFVDGQQVDHVSAGQDAVVVLDETPFYGESGGQVGDT 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G+     + D QK       H   + +G LR    L   +D + R ++ +NHSATH
Sbjct: 510 GVLAGNNAEFSVQDTQKYG-QAIGHIGKLTQGQLRVGDRLNAQVDEERRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV+Q GS +    LRFD +H + +   E++ +ED VN  I +NL V T
Sbjct: 569 LLHAALRQVLGDHVAQKGSLVNDKYLRFDFSHFEAMKPQEIRQVEDIVNAQIRRNLAVET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY+ RVRV+S+     G  S+ LCGGTH + TG+I L  I 
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDQRVRVLSM-----GDFSTELCGGTHAARTGDIGLFRIQ 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +  Q  +L  +A  +K +  N+  +V  + +  R L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGALAQVNAQSHQLHDIAQLVKANSSNLNEKVRGLVDHVRALE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + + Q   ++          +     +   +S V+ K L+++MD L+ ++ S II+
Sbjct: 744 KELQQLRDQQAAQESASLSSKAIDVKGTKLLVSELSNVEPKMLRTMMDDLKNQLGSAIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  VT+DL DR  A +L    A  + GG GGGRP MAQ+GG N     
Sbjct: 804 LATVA-EGKVSLIAGVTKDLTDRVKAGELVGELAAQV-GGKGGGRPDMAQAGGTNPQALA 861

Query: 887 QAIAGVASFL 896
            A+AGV  ++
Sbjct: 862 GALAGVQDWV 871


>gi|240949596|ref|ZP_04753931.1| alanyl-tRNA synthetase [Actinobacillus minor NM305]
 gi|240295854|gb|EER46530.1| alanyl-tRNA synthetase [Actinobacillus minor NM305]
          Length = 874

 Score =  930 bits (2404), Expect = 0.0,   Method: Composition-based stats.
 Identities = 380/912 (41%), Positives = 543/912 (59%), Gaps = 56/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   S IR +FL+FFQ  GH ++ SSSL+P NDPTL+FTN+GM  FK++F G EK  Y  
Sbjct: 1   MKTTSEIRQSFLDFFQSKGHTVVDSSSLVPENDPTLLFTNAGMNQFKDVFLGLEKRPYTR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEM+GNFSFG YFK+ AIQ  W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKQDAIQFGWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +LY+TVY+ D+EA+ +W KI G+ AD IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLYVTVYETDDEAYDIWHKIVGVPADHIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+   GGLP    E+G+R+IE+WN+VFMQF +Q       LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGDKYWGGLPGTPEEDGDRFIEVWNIVFMQFNRQADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ERM  V+Q   +NY+ID+F+ LI+   ++  +K    +  + RVI DH+RS S+LIADG+
Sbjct: 241 ERMTAVMQHVNSNYEIDIFQTLIKTVAELLNVKD--LDNKSLRVIADHIRSCSYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  +LG  E     L+P L   MG A   + Q +  I++T
Sbjct: 299 VPSNEGRGYVLRRIIRRAVRHGNILGAKEAFFYKLVPTLAQVMGHAGEIVAQKQAHIQKT 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           L++E+E+F +TL+RGL LL+  L+ +  ++ L+GDVAFKLYDT+G PLD+  D+   R  
Sbjct: 359 LKAEEEQFARTLERGLALLEDALTKVE-NKTLSGDVAFKLYDTYGFPLDLTADVCRERN- 416

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F   ++ QR RA+A S           + ++ +  G T FIGYD L       
Sbjct: 417 IAIDEAGFEAEMQAQRERAKASSNFG------VDYNNVIKVDGKTNFIGYDNL------- 463

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + V  +   G  V+   SG+   ++ DQTPFYAE GGQ+GD
Sbjct: 464 ----------------TAEATVVGLFSNGNAVDVIKSGENAIIILDQTPFYAEMGGQVGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G    +  +  + D QK    +F H   +E G L+    +   +  + R  + +NHSAT
Sbjct: 508 SGRISTEFCQFNVADTQKYG-QVFGHIGQLEAGELKVGDKVTAEVAAERRHSIQLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LGSHV Q GS +   GLRFD +  + IT  +L+ IE  VN  I +N+ VV
Sbjct: 567 HLLHSALRKVLGSHVMQKGSLVNEKGLRFDFSQPEAITKEQLEEIERIVNAKIRENIQVV 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
              M  E+A A GA AL G KY D VRVV +      V S  LCGGTHV  TG+I L  +
Sbjct: 627 IEEMGIEEAKAKGAMALFGEKYGDIVRVVDM-----SVFSIELCGGTHVKRTGDIGLFKL 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
            SE ++ AG+RR+EAITG+ A + L    +  +  A  LK    N+V +++++ ++ ++L
Sbjct: 682 TSEGAVAAGVRRVEAITGEAALAWLHNLQQMTQHSAELLKADSTNLVEKIQQLQDKAKRL 741

Query: 771 QLIHAKRKLQLNVE-----DLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +    + K +   +          +I  VN +   +   + K L++++D L+ ++ S I+
Sbjct: 742 EKELQQLKEKQASQAGADLAKQAKQINGVNVVVTQLENAEPKVLRTMVDDLKNQLGSAIV 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +L G   ++K ++++ V+ DL  +  A +L    AK   GG GGGRP MA +GG      
Sbjct: 802 VL-GTVVDEKVNLIVGVSSDLTTQIKAGELVGEMAK-CVGGKGGGRPDMAMAGGSEPQNL 859

Query: 886 DQAIAGVASFLK 897
            +A+     +++
Sbjct: 860 AKALNFAQEWIQ 871


>gi|209884575|ref|YP_002288432.1| alanyl-tRNA synthetase [Oligotropha carboxidovorans OM5]
 gi|209872771|gb|ACI92567.1| alanyl-tRNA synthetase [Oligotropha carboxidovorans OM5]
          Length = 909

 Score =  930 bits (2404), Expect = 0.0,   Method: Composition-based stats.
 Identities = 477/908 (52%), Positives = 619/908 (68%), Gaps = 38/908 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR++FL FF KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG EK  YQ 
Sbjct: 22  MSGVNEIRSSFLNFFAKNGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEKLPYQR 81

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK+RAI+LAW L+TKEF L
Sbjct: 82  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGNYFKDRAIELAWTLITKEFGL 141

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + RL +TV+ ED+EA  LWKKI+GL   K+IRI T+DNFW M +TGPCGPCSEIFFD G
Sbjct: 142 PKDRLLVTVFSEDDEAASLWKKIAGLPDSKVIRIATSDNFWQMGDTGPCGPCSEIFFDHG 201

Query: 181 ECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + +PGG P    E+G+R+IEIWNLVFMQFEQ     R  LP  SIDTGMGLERMA VLQ 
Sbjct: 202 DKVPGGPPGSPDEDGDRFIEIWNLVFMQFEQTAGGVRTPLPHPSIDTGMGLERMAAVLQG 261

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           K +NY+IDLF  LI+A   +TG    G    + RVI DHLR+SSFLIADG+LP+NEGRGY
Sbjct: 262 KHDNYEIDLFVALIRAISDLTGTDPHGPQKASLRVIADHLRASSFLIADGVLPSNEGRGY 321

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  L+ AL  EMG AYPEL++A+ L+EETL+ E+ RF 
Sbjct: 322 VLRRIMRRAMRHAQLLGAKEPLMYRLVWALVREMGQAYPELVRAESLVEETLKLEETRFR 381

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTLDRGL +LD   + L   ++ +G+ AF LYDT+G PLD+ QD L  RG+  +D+ SF 
Sbjct: 382 KTLDRGLAILDEKSASLKPGDMFDGETAFTLYDTYGFPLDLTQDALRTRGIH-VDLASFT 440

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E+Q+++ARA   G G    EK+WF L E+ GAT+F+GYD                  
Sbjct: 441 DAMEQQKAKARASWAGSGDAAAEKVWFPLHEELGATEFLGYD------------------ 482

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +V A+V+ G +V+   +G    VV +QTPFY E+GGQ+GDTG   GDG 
Sbjct: 483 -----TEIAEGVVTALVKDGAVVDSLNAGDAAAVVLNQTPFYGESGGQVGDTGILTGDGG 537

Query: 540 -RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALS 598
            R ++TD QKKA  +FVH   +E+G L+   +L L +D+  R  +  NHSATHLLH AL 
Sbjct: 538 VRFRVTDTQKKAGDLFVHVGTLEQGALKKGAALQLEVDHTRRGAIRANHSATHLLHEALR 597

Query: 599 TILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNRED 658
            +LG H++Q GS ++P+ LRFD  H+KPI + EL+ IED  NDI+ QN  V TR+M  +D
Sbjct: 598 QVLGDHIAQRGSLVSPERLRFDFAHTKPIAADELRRIEDIANDIVLQNSEVTTRLMGLDD 657

Query: 659 AIASGAAALLGTKYNDRVRVVSVEYEDGGV--HSSALCGGTHVSSTGEIMLLYIVSESSI 716
           A +SGA AL G KY D VRVVS+    G     S  LCGGTHV  TG+I L+ I  ES++
Sbjct: 658 ARSSGARALFGEKYGDEVRVVSMGQTSGNALGWSVELCGGTHVKRTGDIGLVSITGESAV 717

Query: 717 RAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAK 776
            +G+RRIEA+TG+ AR       E  K+ A+ LK +  ++  RV  + EE +KL+   + 
Sbjct: 718 ASGVRRIEALTGRAARHAANHSIETAKAAAAELKTTLEDMPARVAALVEERKKLERDLSD 777

Query: 777 RKLQLNVEDLS----------CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
            + +L +   +             + DV  ++  +  ++ K+LKS+ D  +K++ SG++ 
Sbjct: 778 ARKKLAMGGGAGGNGSTAASDVRNVGDVKLLARAVQGIEVKDLKSLADQGKKQLGSGVVA 837

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           LV  S++ KASV++ VT DL  RFNAVDL R +++VLGG GGGG+P MAQ+GGP+G+KAD
Sbjct: 838 LVATSEDGKASVVVGVTPDLTSRFNAVDLVRKASEVLGGKGGGGKPDMAQAGGPDGSKAD 897

Query: 887 QAIAGVAS 894
            A+  + +
Sbjct: 898 AALKAIEA 905


>gi|238027796|ref|YP_002912027.1| alanyl-tRNA synthetase [Burkholderia glumae BGR1]
 gi|237876990|gb|ACR29323.1| Alanyl-tRNA synthetase [Burkholderia glumae BGR1]
          Length = 874

 Score =  930 bits (2404), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/910 (41%), Positives = 536/910 (58%), Gaps = 55/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 1   MKAAEIREKFLRFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGTESRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  +W+LLT  + L 
Sbjct: 61  TTSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIHYSWELLTSVYGLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY +D+EA+ +W K  G+ A++IIRI  N       DNFW M +TGPCGPCSE
Sbjct: 121 KEKLWVTVYHDDDEAYDIWAKEVGVPAERIIRIGDNKGARYASDNFWQMGDTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK SIDTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKPSIDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ + TG+    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIKAAARETGVADLANN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGAFFHKLVADLVAEMGAAYPELKEAEGRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ L     ++L+G++AFKL+DT+G PLD+  D+   R + 
Sbjct: 359 EEERFLETIEHGMTILEAALAELDAKGGKLLDGELAFKLHDTYGFPLDLTADVCREREVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +   +            T F GY+ L        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQGLD-------YSGAKTTFHGYEKLALDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + + A+   G  V EA +G++  VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKIVALYVGGTAVNEAKAGEQAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  VE+G L+    L   +D + R +   NHSATH
Sbjct: 509 GTLANAAARFAVEDTLKVQADVIGHHGTVEQGALKVGDVLRAEVDAERRARTQRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG HV Q GS +  +  RFD  H+ P++  E++ +E  VN  I  N P + 
Sbjct: 569 LMHKALREVLGGHVQQKGSLVDAEKTRFDFAHNAPLSDEEIRRVEAIVNAEILANAPGII 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R M+ ++A+  GA AL G KY D VRV+ +        S  LCGGTHVS TG+I    IV
Sbjct: 629 RNMSYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVSRTGDIGFFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           +E  + AGIRR+EAITG  A  ++   D +L + A+ LK     +  R+ ++ ++ + L+
Sbjct: 683 AEGGVAAGIRRVEAITGDNAVRYVQELDARLSTAAAMLKAQPAELTQRIAQVQDQLKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
              A  K +L              +  +  ++  +   DSK L+   D L+ K++   ++
Sbjct: 743 KELAALKSRLASSQGDELAQQAVDVKGLRVLAATLEGADSKTLRETADKLKDKLKHAAVV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT +   +  A +L    A+ + GG GGGRP MAQ+GG    K  
Sbjct: 803 LAAV-EGGKVSLIAGVTAEASKQVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPGKLP 860

Query: 887 QAIAGVASFL 896
           +A+AGVA+++
Sbjct: 861 EALAGVAAWV 870


>gi|109899322|ref|YP_662577.1| alanyl-tRNA synthetase [Pseudoalteromonas atlantica T6c]
 gi|123360521|sp|Q15RG5|SYA_PSEA6 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|109701603|gb|ABG41523.1| alanyl-tRNA synthetase [Pseudoalteromonas atlantica T6c]
          Length = 865

 Score =  930 bits (2403), Expect = 0.0,   Method: Composition-based stats.
 Identities = 388/903 (42%), Positives = 560/903 (62%), Gaps = 48/903 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL FF   GH+ + SSSL+P +DPTL+FTN+GM  FK++F G E+  Y   
Sbjct: 3   KSTAQIRQAFLNFFADKGHQKVSSSSLVPSDDPTLLFTNAGMNQFKDVFLGTEQRKYTRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK +AI  AW  LT+   L 
Sbjct: 63  TSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHQAIGYAWSFLTEVLKLP 122

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGE 181
           + +L +TVY ED+EAF +W    G+  +KIIRI T+DNFWSM +TGPCGPCSEIF+D GE
Sbjct: 123 KDKLLVTVYSEDDEAFDIWHNDIGIPKEKIIRIATSDNFWSMGDTGPCGPCSEIFYDHGE 182

Query: 182 CIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEK 240
            I GG PGS  E+G+R+IEIWNLVFMQF +Q   +   LPK SIDTGMGLER++ ++Q  
Sbjct: 183 HIWGGPPGSPEEDGDRFIEIWNLVFMQFNRQANGDMLPLPKPSIDTGMGLERISAIIQNV 242

Query: 241 TNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYV 300
            +NY+ID+F++LI+A+ ++ G+        + RV+ DH+RS SFLI+DG++P+NEGRGYV
Sbjct: 243 HSNYEIDIFQNLIKATAKIVGVT--SLEDKSLRVVADHIRSCSFLISDGVMPSNEGRGYV 300

Query: 301 LRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGK 360
           LRRI+RRA+ +   LG        L+ AL TEMG AYPEL + + +IE+ LR E+E+F +
Sbjct: 301 LRRIIRRAVRHGNKLGANGVFFYKLVAALATEMGDAYPELNEQRAVIEKVLRVEEEQFSR 360

Query: 361 TLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQ 420
           TL+RG+++L+  L+ L   +++ GDV FKLYDT+G P D+  D+   +GL+ ID   F Q
Sbjct: 361 TLERGMLILNDALNELE-GKVVPGDVVFKLYDTYGFPADLTNDVAREKGLS-IDEEGFEQ 418

Query: 421 ALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKP 480
           A+ EQR RA+           +  +         + F+GY+                   
Sbjct: 419 AMAEQRKRAQKA------SNFDVDYNEQLRSDLESIFVGYEH------------------ 454

Query: 481 PIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIR 540
                   ++ +  +  +G+ V E  +G +  V+ D++PFYAEAGGQ GDTG  + D   
Sbjct: 455 -----EDNTATITELFFKGQSVNELAAGAEGTVILDESPFYAEAGGQAGDTGTLVTDAGG 509

Query: 541 LQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTI 600
             + D  K  + I    A + +       S++  ++   R  + +NHSATHL+H AL +I
Sbjct: 510 FSVKDTVKLGKAIAHKGAALSKLS--VGDSVLAKVNGVRRHAIKLNHSATHLMHAALKSI 567

Query: 601 LGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAI 660
           LG HV+Q GS +  D LRFD +H + ++  ++ ++E  VN+ I  N P+ T++M  E A 
Sbjct: 568 LGEHVNQKGSLVQADRLRFDFSHFEAMSKEQVLAVETMVNEQILANHPLQTQLMGLEQAK 627

Query: 661 ASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGI 720
            +GA AL G KY+D VRVVS+     G  S  LCGGTHV  TG+I L  I+SES I +G+
Sbjct: 628 EAGAMALFGEKYDDDVRVVSM-----GSFSMELCGGTHVERTGDIGLFKIISESGIASGV 682

Query: 721 RRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQ 780
           RRIEA+TG  A  H+  Q  +L S+++ LK    +   RV ++ E+ + L+   AK K +
Sbjct: 683 RRIEAVTGLTALQHVQQQTFELSSISAVLKTDVNSAGERVVQLIEQTKTLEKEVAKLKQE 742

Query: 781 LNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKK 835
           +     S      ++I  V  +S+ +  ++S  L++++D L+ +I SG+I+L G++   K
Sbjct: 743 IANSAGSDLLSQINEINGVKVLSYHVQGIESGALRTMIDDLKNQIGSGVILL-GLATGDK 801

Query: 836 ASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASF 895
            S++  VT+DL  +  A +L    A+ + GG GGGRP MAQ+GG      D AIA V+ +
Sbjct: 802 VSLIAGVTKDLTHKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGSQPENLDTAIASVSEW 860

Query: 896 LKK 898
           L++
Sbjct: 861 LQE 863


>gi|330816605|ref|YP_004360310.1| Alanyl-tRNA synthetase [Burkholderia gladioli BSR3]
 gi|327368998|gb|AEA60354.1| Alanyl-tRNA synthetase [Burkholderia gladioli BSR3]
          Length = 874

 Score =  929 bits (2402), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/910 (41%), Positives = 533/910 (58%), Gaps = 55/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGTESRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  +W+LLT  + L 
Sbjct: 61  TTSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKKDAIHYSWELLTSVYGLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY +D+EA+ +W K  G+  ++IIRI  N       DNFW M +TGPCGPCSE
Sbjct: 121 KEKLWVTVYHDDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWQMGDTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK SIDTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKPSIDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ + TG+    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIKAAARETGVADLTNN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGAFFHKLVADLVAEMGGAYPELKEAEGRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +LD  L+ L     + L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFLETIEHGMTILDAALAELDAKGAKQLDGELAFKLHDTYGFPLDLTADVCRERGMT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYSGAKTTFHGYEDIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + + A+   G  V++A +G++  VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKIVALYVGGTAVQQAQAGEQAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  VE+G L+   +L   ID   R +   NHS TH
Sbjct: 509 GVLANAATRFAVEDTLKVQADVIGHHGTVEQGTLKVGDTLRAEIDAARRARTERNHSVTH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD  H+ P++  E++ +E  VN  I  N P + 
Sbjct: 569 LMHKALREVLGSHVQQKGSLVDADKTRFDFAHNAPMSDDEIRRVEAIVNAEILANSPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
             M+ ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I    IV
Sbjct: 629 SNMSYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVRRTGDIGFFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   D +L + AS LK     +  R+ ++ ++ + L+
Sbjct: 683 MEGGVAAGIRRVEAITGDNALRYVQELDARLNTAASMLKAQPAELTQRIGQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
              A  K +L              +  V  ++  +   DSK L+  +D L+ K++   ++
Sbjct: 743 KELAALKSKLASSQGDELAQQAVDVKGVQVLAATLDGADSKTLRETVDKLKDKLKHAAVV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT +   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LAAV-EGGKVSLIAGVTAEASKQVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFL 896
            A+AGV +++
Sbjct: 861 AALAGVQAWV 870


>gi|307249853|ref|ZP_07531828.1| Alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 4
           str. M62]
 gi|306858107|gb|EFM90188.1| Alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 4
           str. M62]
          Length = 874

 Score =  929 bits (2402), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/912 (41%), Positives = 543/912 (59%), Gaps = 56/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   S IR +FL+FF   GH ++PSSSL+P NDPTL+FTN+GM  FK++F G EK  Y  
Sbjct: 1   MKTTSEIRQSFLDFFHSKGHTVVPSSSLVPENDPTLLFTNAGMNQFKDVFLGLEKRPYTR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEM+GNFSFG YFK  AIQ  W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKHDAIQFGWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +LY+TVY+ D+EA+ +W KI G+  D IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLYVTVYETDDEAYDIWNKIVGVPTDHIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D GE   GGLPGS  E+G+RYIE+WN+VFMQF +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGETFWGGLPGSPEEDGDRYIEVWNIVFMQFNRLADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ERM  V+Q   +NY+ D+F+ LI+    +  +     +  + RV+ DH+R+ S+LIADG+
Sbjct: 241 ERMTAVMQHVNSNYETDIFQTLIKEVAGLLNVTD--LDNKSLRVVADHIRACSYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L T MG A   L Q +  I++T
Sbjct: 299 VPSNEGRGYVLRRIIRRAVRHGNLLGAKEAFFYKLVPTLATVMGHAGEVLTQKQAHIQKT 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           L++E+E+F +TL+RGL LL+  L+ +  +  L+G+VAFKLYDT+G PLD+  D+   R L
Sbjct: 359 LKAEEEQFARTLERGLALLEDALTKVE-NNTLSGEVAFKLYDTYGFPLDLTADVCREREL 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F   +  QR RA+A S           + ++ +  G T FIGYD L       
Sbjct: 418 T-IDEAGFEAEMTAQRERAKASSNFG------TDYNNVIKVEGQTDFIGYDNLE------ 464

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + +  +   G+ V+   SG+   ++ DQTPFYAE GGQ+GD
Sbjct: 465 -----------------AQATIVGLFSNGKAVDTIQSGESAVIILDQTPFYAEMGGQVGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G    +     + D QK    +F H   +  G L     +  T+    R  ++ NHSAT
Sbjct: 508 SGLISTEICNFTVNDTQKYG-QVFGHIGQLTSGSLSIGDKVTATVHATRRIAITANHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++ + LRFD +  + I+ ++L+ IE  VN  I +N+ V 
Sbjct: 567 HLLHSALREVLGDHVAQKGSLVSENILRFDFSQPEAISKSQLEEIERIVNRKIRENIQVT 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
              M+ E A   GA AL G KY D VRVV +        S  LCGGTHV  TG+I L  +
Sbjct: 627 IETMDIESAKKKGAMALFGEKYGDVVRVVGMTE-----FSIELCGGTHVQRTGDIGLFKL 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           VSE ++ AGIRR+EA+T + A   L  Q + L+  A FLK    ++V +++++ ++ ++ 
Sbjct: 682 VSEGAVAAGIRRVEAVTAETAIEWLHNQQKVLQQSAEFLKADSNSLVEKIQQLQDKVKRT 741

Query: 771 QLIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +    + K +L  +  S      +KI  VN +   +  V+ K L++++D L+ +++S I+
Sbjct: 742 EKELQQLKDKLAAQAGSELVKQANKINGVNVVVQKLENVEVKSLRTMVDDLKNQLESAIV 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +  G   ++K ++++ VT+DL  + NA +L    A+ + GG GGGR  MA +GG      
Sbjct: 802 V-FGTVADEKVNLIVGVTKDLSSKVNAGELVGAMAQQV-GGKGGGRADMAMAGGSEPQNL 859

Query: 886 DQAIAGVASFLK 897
           D A+     +++
Sbjct: 860 DNALKFAEEWIQ 871


>gi|119472239|ref|ZP_01614418.1| alanyl-tRNA synthetase [Alteromonadales bacterium TW-7]
 gi|119445057|gb|EAW26352.1| alanyl-tRNA synthetase [Alteromonadales bacterium TW-7]
          Length = 866

 Score =  929 bits (2402), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/903 (43%), Positives = 543/903 (60%), Gaps = 48/903 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF    H+++PSSSLIP ND TL+F N+GMV FK++F G E   Y   
Sbjct: 4   MTTAQIRQQFLDFFASKQHQVVPSSSLIPGNDATLLFNNAGMVQFKDVFLGAESRPYTRA 63

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI+ AW+ LT+   L 
Sbjct: 64  TSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQEAIKFAWEFLTEVVKLP 123

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGE 181
           Q +L +T+Y +DEEAF+ W K  GLS D+IIRI T+DNFWSM +TGPCGPCSEIF+D GE
Sbjct: 124 QEKLLVTIYHDDEEAFEYWSKDIGLSEDRIIRIATSDNFWSMGDTGPCGPCSEIFYDHGE 183

Query: 182 CIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEK 240
            I GG PGS  E+G+R+IEIWNLVFMQ+ +QN      LPK S+DTGMGLER++ +LQ  
Sbjct: 184 HIWGGPPGSPEEDGDRFIEIWNLVFMQYNRQNDGTMLPLPKQSVDTGMGLERISAILQGV 243

Query: 241 TNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYV 300
            +NY+IDLF+ LI A+  VT  +    +  + RV+ DH+RS +FLI+DG++P+NEGRGYV
Sbjct: 244 HSNYEIDLFQGLIAAAASVTNAQDM--DDKSLRVVADHIRSCAFLISDGVMPSNEGRGYV 301

Query: 301 LRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGK 360
           LRRI+RRA+ +   LG        L+ AL  +MG AYPEL + + +IE+ LR E+E+FGK
Sbjct: 302 LRRIIRRAVRHGNKLGAQGAFFFKLVAALIEQMGQAYPELAKQQEIIEKVLRIEEEQFGK 361

Query: 361 TLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQ 420
           TL+RGL +L+  LS L   +++ GD+ FKLYDT+G P D+  D+   R +  ID   F +
Sbjct: 362 TLERGLAILEESLSDLK-GDVIPGDLVFKLYDTYGFPADLTADVARERQMT-IDHKGFEE 419

Query: 421 ALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKP 480
            +  QR  A+        G     +    +    T F GYD                   
Sbjct: 420 CMAVQRKTAQQA------GKFGADYNEQLKSDKHTDFKGYDST----------------- 456

Query: 481 PIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIR 540
                   S+ V  +   GE V+    GQ+  V+ D+TPFYAE+GGQ GDTG     G  
Sbjct: 457 ------HYSATVVEVFAGGEAVQLLEDGQEGIVILDRTPFYAESGGQTGDTGTITVAGGE 510

Query: 541 LQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTI 600
             +T+  K        H    +G +     +  TID   R  +  NH+ATH+LH AL  +
Sbjct: 511 FNVTNTTKLGNAF--AHHGTVQGRIGVNDKVDATIDDARRENIKKNHTATHILHEALRQL 568

Query: 601 LGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAI 660
           LG HVSQ GS +  D LRFD +H + +T  EL+ IE  VND I +N  + T +M  +DA 
Sbjct: 569 LGEHVSQKGSLVQADRLRFDFSHFEAVTKDELRDIERVVNDEIRRNFALNTELMAIDDAK 628

Query: 661 ASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGI 720
           A GA AL G KY+D VRVV++     G +S  LCGGTHV   G+I L  IVSES I AG+
Sbjct: 629 AKGAMALFGEKYDDEVRVVTI-----GDYSIELCGGTHVERAGDIGLFKIVSESGIAAGV 683

Query: 721 RRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQ 780
           RRIEA+TG  A +++  Q+++L  +A+ +K    +V+ +V  + E+ + L+   A+   +
Sbjct: 684 RRIEAVTGADAVAYVSEQEQQLSDVAALVKGDSASVLEKVTALLEKSKGLEKQIAQLNDK 743

Query: 781 LNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKK 835
           L          S  +I  V  +   +   +SK L+ ++D L+ KI SG+I L G++   K
Sbjct: 744 LASAAGASLLDSIVEINGVKLLVANVEGTESKALRGMVDDLKNKIGSGVIAL-GVASGDK 802

Query: 836 ASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASF 895
            S++  VT+DL  +  A +L    A  + GG GGGRP MAQ+GG        A+  V ++
Sbjct: 803 VSLIAGVTKDLTGKVKAGELVNHMASQV-GGKGGGRPDMAQAGGSEPQNLAAALDSVTAW 861

Query: 896 LKK 898
           L +
Sbjct: 862 LTE 864


>gi|304391435|ref|ZP_07373377.1| alanyl-tRNA synthetase [Ahrensia sp. R2A130]
 gi|303295664|gb|EFL90022.1| alanyl-tRNA synthetase [Ahrensia sp. R2A130]
          Length = 884

 Score =  929 bits (2402), Expect = 0.0,   Method: Composition-based stats.
 Identities = 468/906 (51%), Positives = 609/906 (67%), Gaps = 34/906 (3%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+TFL +F+KNGH  + SS L+P NDPTLMFT +GMV FKN+FTG E   Y  
Sbjct: 1   MSGVNDIRSTFLSYFEKNGHAAVDSSPLVPRNDPTLMFTAAGMVQFKNLFTGLETRNYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT+E+ +
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKADAIEFAWNLLTEEYGI 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
           D  RL +TVY +D+EAF LWKKI+GLS D+IIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 121 DASRLLVTVYHDDDEAFDLWKKIAGLSDDRIIRIATSDNFWAMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R++EIWNLVFMQFEQ    ER  LPK SIDTGMGLER+A VLQ 
Sbjct: 181 DHIWGGPPGSPEEDGDRFVEIWNLVFMQFEQVTVDERVNLPKPSIDTGMGLERIAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NY+IDLFK LI ASEQ TG+  + N   +HRVI DHLR+S FLIADG+LP NEGRGY
Sbjct: 241 THDNYEIDLFKALISASEQATGVGSDDNTRASHRVIADHLRASCFLIADGVLPGNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A LLG  +PLM  L+PAL  +MG A+PEL + + L+ ETL  E+ RF 
Sbjct: 301 VLRRIMRRAMRHASLLGAQDPLMYRLVPALVAQMGEAFPELRRTQSLMTETLNLEEVRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL RGL LLD   + L   + L+G VAFKLYDT+G PLD+ QD L  R +  +D   ++
Sbjct: 361 KTLTRGLDLLDTASADLKAGDALDGRVAFKLYDTYGFPLDLTQDALRRRDIT-VDTDEYS 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+EEQ++ ARA   G G    + IWF L+EK+GAT+F+GY+                  
Sbjct: 420 TAMEEQKAVARASWAGAGGAADDAIWFKLREKHGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T      V AI+Q G  V  A  G +V V+ +QTPFYAE+GGQ+GDTG  +    
Sbjct: 462 -----TEKAEGSVLAILQDGAEVSTAKKGDEVSVILNQTPFYAESGGQMGDTGTLVVGET 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           +L ITD +K+ +G+FVH   V+ G L+      L ID+  R +L  NHSATHL+H AL  
Sbjct: 517 KLTITDTKKRGDGLFVHMGTVDSGTLKVGDGASLEIDHARRSKLRSNHSATHLVHEALRE 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
            LG HVSQ GS + P+ LRFD +HSKP+ + E++ IE   N+ + QN  V T +M  +DA
Sbjct: 577 TLGDHVSQKGSLVAPERLRFDFSHSKPVETEEMRRIEAMANEYVLQNSQVSTTLMAVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSVE----YEDGGVHSSALCGGTHVSSTGEIMLLYIVSESS 715
           I  GA A  G KY D VRVVS+       +    S  LCGGTHV +TG+I L+ +V ES+
Sbjct: 637 IELGAQAQFGEKYGDEVRVVSMGKVGEGNEAKAWSLELCGGTHVKNTGDIGLVTVVGESA 696

Query: 716 IRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHA 775
           + +G+RRIEA+TGQ AR +L+ QDE L+S A+ LK +  +V  RV  + +E +KL+   A
Sbjct: 697 VSSGVRRIEALTGQAAREYLLQQDELLRSTAAKLKTTPADVPTRVAALIDERKKLERELA 756

Query: 776 KRKLQLNVE-----DLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGI 830
           + K QL +      + +   I  V F+  ++  V  ++LK ++D  + +I SG++ +   
Sbjct: 757 EAKKQLALGVDGGTEAAAEDIGGVQFVGRVLQGVSPRDLKGLVDEEKTRIGSGVVAIAAN 816

Query: 831 SKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIA 890
           +++ K +V++ VT+DL DRF+AV L R  ++ LGG GGGGRP MAQ+GGP+G   D A+ 
Sbjct: 817 NEDGKGAVVVGVTKDLTDRFDAVVLVRAGSEALGGKGGGGRPDMAQAGGPDGANVDAALD 876

Query: 891 GVASFL 896
            V + L
Sbjct: 877 AVRAAL 882


>gi|300718056|ref|YP_003742859.1| Alanyl-tRNA synthetase [Erwinia billingiae Eb661]
 gi|299063892|emb|CAX61012.1| Alanyl-tRNA synthetase [Erwinia billingiae Eb661]
          Length = 875

 Score =  929 bits (2402), Expect = 0.0,   Method: Composition-based stats.
 Identities = 394/910 (43%), Positives = 549/910 (60%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FFQ  GH+++ SSSL+P NDPTL+FTN+GM  FK++F GQ+K  Y   
Sbjct: 3   KSTAEIRQAFLDFFQSKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGQDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + F+
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIGFAWELLTGAQWFN 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY+ D+EAF +W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKEKLWVTVYETDDEAFDIWEKEVGVPRERIIRIGDNKGGAYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           SEIFFD G+ I GG PGS  E+G+R+IEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 SEIFFDHGDHIWGGPPGSPEEDGDRFIEIWNIVFMQFNRQPDGTMLPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+  VLQ   +NY+IDLF  LI +  +VTG         + RVI DH+RS +FLIADG++
Sbjct: 243 RITAVLQHVNSNYEIDLFARLIASVAEVTGATD--LTSKSLRVIADHIRSCAFLIADGVI 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG        L+  L + MGSA  EL   +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAQGSFFWKLVGPLISVMGSAGEELASQQSQVEQIL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F KTL+RGL LLD  L  L   + L+G+  F+LYDT G P D+  D+   R L 
Sbjct: 361 KTEEEQFAKTLERGLALLDEELEKLQ-GDTLDGETVFRLYDTFGFPADLTADVCRERNLK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            ID   F +A+E+QR RAR              +  + +   A+ F GY+ L        
Sbjct: 420 -IDEAGFEKAMEQQRQRAREA------SGFGADYSKVIQIDAASAFKGYEQLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++S V AI   G+   E V+GQ+  +V D+TPFY E+GGQ+GDT
Sbjct: 466 ----------------LNSTVTAIFVDGKPATEIVAGQEGVIVLDETPFYGESGGQVGDT 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G    D     + D QK       H   +  G +R    L   +D   R ++ +NHSATH
Sbjct: 510 GELKSDAATFTVNDTQKYG-QAIGHTGTLAAGQIRIGDRLSAQVDQARRDRIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV+Q GS +    LRFD +H + +   E++ +E+ VN  + +NL + T
Sbjct: 569 LLHAALRQVLGHHVAQKGSLVNDKYLRFDFSHFEAMKPEEIRQVEEIVNAQVRRNLAIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM  E A + GA AL G KY+D VRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMELEAAKSHGAMALFGEKYDDHVRVLSM-----GDFSTELCGGTHASRTGDIGLFRIL 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A   +  Q E+L+ +A  +K +  N+  +V  + +  R L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGALGLMYAQSEQLQEIAHLIKANNSNLNEKVRAMIDHVRGLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++         +I     +   +S V+ K L++++D L+ +++S II+
Sbjct: 744 RELQQLKDQQAAQESASLSSKAIEIKGTRLLVSELSNVEPKMLRTMVDELKNQLKSAIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ + K S++  VT+DL DR  A +L    A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-DGKVSLIAGVTKDLTDRVKAGELVGELAQQV-GGKGGGRPDMAQAGGTDAQALP 861

Query: 887 QAIAGVASFL 896
            A+AGV S++
Sbjct: 862 AALAGVESWV 871


>gi|148828002|ref|YP_001292755.1| alanyl-tRNA synthetase [Haemophilus influenzae PittGG]
 gi|205830061|sp|A5UHW6|SYA_HAEIG RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|148719244|gb|ABR00372.1| alanyl-tRNA synthetase [Haemophilus influenzae PittGG]
          Length = 874

 Score =  929 bits (2401), Expect = 0.0,   Method: Composition-based stats.
 Identities = 387/913 (42%), Positives = 547/913 (59%), Gaps = 56/913 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAINFAWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDDEAYNIWNKEVGVPAERIIRIGDNKGSPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LP+ S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNVVFMQFNRLADGTMEKLPRPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+FK LI  + ++ G         + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFKTLIAKTAEIVGATD--LTNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  ++   +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKESFFYKLVPTLIEVMAEAGKDVKAKQTNVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  LS +  D IL+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LRLEEEQFARTLERGLSLLDEALSQVK-DGILSGEVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID  +F++ +E QR+RA+A S           + S+    G T+F GY  +       
Sbjct: 418 T-IDEQAFDREMEAQRTRAQAASQFG------VDYNSVIRVDGETKFEGYTEVES----- 465

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + + A+   G+ VE   +GQ   V+ + TPFYAE+GGQ+GD
Sbjct: 466 ------------------QAKITALFYDGKSVESIEAGQSAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G     G+   + D QK    +F H   + +G L+   S+   +D + R   S+NHSAT
Sbjct: 508 SGYLSTQGVTFNVKDTQKYG-QVFGHIGELTQGSLKVGQSVNAIVDAKRRHNTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  ILG HV Q GS ++   LRFD    + IT  +L  IE  VN  I  N PV 
Sbjct: 567 HLLHAALRQILGLHVVQKGSLVSDKALRFDFAQPEAITKEQLSEIETLVNQKIRANFPVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM+ + A A GA AL G KY D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMDIDSAKAKGAMALFGEKYGDKVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           ++E+++ AGIRRIEA+TGQ A   L  Q   L   A  LK     +  +++++ ++ +K+
Sbjct: 682 ITENAVAAGIRRIEAVTGQNAIDWLHNQQRILTQSADLLKSDVNTLAEKIQQLQDKTKKV 741

Query: 771 QLIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI  V+ ++  +  +++K L+ ++D L+ ++ SG+I
Sbjct: 742 EKELQGLKEKAAMQAGSDFVKSAVKINGVSVIAQQLDGIETKSLRVMVDDLKNQLGSGVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
               I  +KK ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 AFASIL-DKKVNLVVGVTNDLTAKIKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQPENV 859

Query: 886 DQAIAGVASFLKK 898
            QAI     +L K
Sbjct: 860 AQAIKVAQDWLNK 872


>gi|145630561|ref|ZP_01786341.1| alanyl-tRNA synthetase [Haemophilus influenzae R3021]
 gi|144983951|gb|EDJ91393.1| alanyl-tRNA synthetase [Haemophilus influenzae R3021]
          Length = 874

 Score =  929 bits (2401), Expect = 0.0,   Method: Composition-based stats.
 Identities = 385/913 (42%), Positives = 547/913 (59%), Gaps = 56/913 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAINFAWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDDEAYNIWNKDVGVPAERIIRIGDNKGSPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LP+ S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNVVFMQFNRLADGTMEKLPRPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+FK LI  + ++ G         + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFKTLIAKTAEIVGTTD--LTNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  ++   +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKESFFYKLVPTLIDVMAEAGKDVKAKQTNVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  LS +  D IL+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LRLEEEQFARTLERGLSLLDEALSQVK-DGILSGEVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID  +F++ +E QR+RA+A S           + S+    G T+F GY  +       
Sbjct: 418 T-IDEQAFDREMEAQRTRAQAASQFG------VDYNSVIRVDGETKFEGYTEVES----- 465

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + + A+   G+ VE   +GQ   V+ + TPFYA++GGQ+GD
Sbjct: 466 ------------------QAKITALFYDGKSVESIEAGQSAVVILENTPFYAKSGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G     G+   + D QK    +F H   + +G L+   S+   +D +     S+NHSAT
Sbjct: 508 SGYLSTQGVTFNVKDTQKYG-QVFGHIGELTQGSLKVGQSVNAIVDAKRLHNTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  ILG HV Q GS ++   LRFD    + IT  +L  IE  VN  I  N PV 
Sbjct: 567 HLLHAALRQILGLHVVQKGSLVSDKALRFDFAQPEAITKEQLSEIETLVNQKIRANFPVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM+ + A A GA AL G KY D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMDIDSAKAKGAMALFGEKYGDKVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           ++E+++ AGIRRIEA+TGQ A   L  Q   L   A  LK     +V +++++ ++ +K+
Sbjct: 682 ITENAVAAGIRRIEAVTGQNAIDWLHNQQRILTQSADLLKSDVNTLVEKIQQLQDKTKKV 741

Query: 771 QLIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI  V+ ++  +  +++K L+ ++D L+ ++ SG+I
Sbjct: 742 EKELQALKEKAAMQAGSDFVKSAVKINGVSVIAQQLDGIETKSLRVMVDDLKNQLGSGVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
               I  ++K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 AFASIL-DEKVNLVVGVTNDLTAKIKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQPENV 859

Query: 886 DQAIAGVASFLKK 898
            QAI     +L K
Sbjct: 860 AQAIKVAQDWLNK 872


>gi|54310165|ref|YP_131185.1| alanyl-tRNA synthetase [Photobacterium profundum SS9]
 gi|46914606|emb|CAG21383.1| putative alanyl-tRNA synthetase [Photobacterium profundum SS9]
          Length = 906

 Score =  929 bits (2401), Expect = 0.0,   Method: Composition-based stats.
 Identities = 380/910 (41%), Positives = 533/910 (58%), Gaps = 54/910 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            +   IR  FL FF+  GH+++ SSSL+P NDPTL+FTN+GM  FK+ F G EK  Y   
Sbjct: 36  MSTDEIRRAFLAFFESKGHQIVESSSLVPANDPTLLFTNAGMNQFKDTFLGIEKRSYTRA 95

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI+ AW+ LT    L 
Sbjct: 96  TTAQRCVRAGGKHNDLENVGFTARHHTFFEMLGNFSFGDYFKQDAIKYAWEFLTDVLGLP 155

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           Q RL +T+Y+ D+EAF +W K  G+ AD+I+RI  N       DNFW M +TGPCGPCSE
Sbjct: 156 QDRLLVTIYETDDEAFDIWNKEMGIPADRIVRIGDNKGAPYASDNFWQMGDTGPCGPCSE 215

Query: 175 IFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D GE I GG P    E+G+R+IEIWN VFMQF +Q       LPK S+DTGMG+ER+
Sbjct: 216 IFYDHGEHIWGGRPGTPEEDGDRFIEIWNNVFMQFNRQADGTMEPLPKPSVDTGMGIERI 275

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A ++Q   +NY+ID+F+ LI+ S +V G  YE  +  + RV+ DH+RS +FLI DG++P+
Sbjct: 276 AAIMQGVHSNYEIDIFQTLIKKSAEVIG--YEDLSNQSLRVVADHIRSCAFLIVDGVMPS 333

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG +      L+  L   MG+A  EL + + L+E+ L+ 
Sbjct: 334 NEGRGYVLRRIIRRAVRHGNKLGASGAFFYKLVGPLAEIMGTAGDELKKRQALVEKILKI 393

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGI 413
           E++ FG+TLDRGL +L+  L +L   E L+G+  FKLYDT+G P D+  D+   R    I
Sbjct: 394 EEDNFGRTLDRGLTILNDALDNLSGKE-LDGETVFKLYDTYGFPADLTNDVARERDFT-I 451

Query: 414 DIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDR 473
           D   FN A+E QR RAR        G     +    +    T+F GY             
Sbjct: 452 DEEGFNNAMEAQRQRAREA------GKFGVDYNESIKVDVNTEFCGYT------------ 493

Query: 474 KVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGC 533
                           S + A+ + GE V+  ++G+   ++ D TPFYAE+GGQ GD G 
Sbjct: 494 -----------GTAAQSSIVALYRDGEAVDSILAGEDALIILDNTPFYAESGGQCGDAGV 542

Query: 534 AIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLL 593
              +     ++D QK       H   + +G L     L   +D   R  +++NHSATHLL
Sbjct: 543 LTAENTVFNVSDTQKFGA-AIGHQGSLVQGALNVGDKLEAQVDVVRRTAITLNHSATHLL 601

Query: 594 HHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRI 653
           H AL  +LG HV+Q GS + PD LRFD ++ + +   +L+ IE  VN+ I  N  + T I
Sbjct: 602 HSALRNLLGEHVAQKGSLVKPDALRFDFSNLEAVKPEQLREIERVVNEQIRLNHSIDTNI 661

Query: 654 MNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSE 713
           M+ E A   GA AL G KY+D VRV+S+     G  S+ LCGG H  +TG+I L  I SE
Sbjct: 662 MDIESAKQKGAMALFGEKYDDEVRVLSM-----GEFSTELCGGIHAKNTGDIGLFKITSE 716

Query: 714 SSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLI 773
             I AGIRRIEA+TG  A   L  Q+  L   AS +K    +V  +V  +    ++L+  
Sbjct: 717 GGIAAGIRRIEAVTGAAAIDALHAQEALLSETASIVKSDAASVATKVSALLAHSKQLEKD 776

Query: 774 HAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
             + + +L  ++ +       +I  V  +   +   D+K L+ ++D ++ K+ SGI++L 
Sbjct: 777 IQQLQDKLAAQESAGLLDQAKEINGVKVLITQLDGADNKALRGMLDEIKNKLGSGIVVLG 836

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQA 888
            +S + K  +++ VT+DL  +  A +L  + A+ + GG GGGRP MAQ+GG +      A
Sbjct: 837 NVSGD-KVGLIVGVTKDLTGKVKAGELVNMVAQQV-GGKGGGRPDMAQAGGTDAAALPAA 894

Query: 889 IAGVASFLKK 898
           +  V  +L +
Sbjct: 895 LESVTPWLTE 904


>gi|148826541|ref|YP_001291294.1| alanyl-tRNA synthetase [Haemophilus influenzae PittEE]
 gi|229845865|ref|ZP_04465977.1| alanyl-tRNA synthetase [Haemophilus influenzae 7P49H1]
 gi|205830060|sp|A5UDR0|SYA_HAEIE RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|148716701|gb|ABQ98911.1| alanyl-tRNA synthetase [Haemophilus influenzae PittEE]
 gi|229810869|gb|EEP46586.1| alanyl-tRNA synthetase [Haemophilus influenzae 7P49H1]
          Length = 874

 Score =  929 bits (2400), Expect = 0.0,   Method: Composition-based stats.
 Identities = 388/913 (42%), Positives = 548/913 (60%), Gaps = 56/913 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAINFAWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDDEAYNIWNKEVGVPAERIIRIGDNKSAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LP+ S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNVVFMQFNRLADGTMEKLPRPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+FK LI  + ++ G         + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFKTLIAKTAEIVGATD--LTNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  ++   +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKESFFYKLVPTLIDVMAEAGKDVKAKQTNVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  LS +  D IL+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LRLEEEQFARTLERGLSLLDEALSQVK-DGILSGEVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID  +F++ +E QR+RA+A S           + S+    G T+F GY  +       
Sbjct: 418 T-IDEQAFDREMEAQRTRAQAASQFG------VDYNSIIRVDGETKFEGYTEVES----- 465

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + + A+   G+ VE   +GQ   V+ + TPFYAE+GGQ+GD
Sbjct: 466 ------------------QAKITALFYDGKSVESIEAGQSAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G     G+   + D QK    +F H   + +G L+   S+   +D + R   S+NHSAT
Sbjct: 508 SGYLSAQGVTFNVKDTQKYG-QVFGHIGELTQGSLKVGQSVNAIVDAKRRHNTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  ILG HV Q GS ++   LRFD    + IT  +L  IE  VN  I  N PV 
Sbjct: 567 HLLHAALRQILGLHVVQKGSLVSDKALRFDFAQPEAITKEQLTQIETLVNQKIRANFPVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM+ + A A GA AL G KY D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMDIDSAKAKGAMALFGEKYGDKVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           ++E+++ AGIRRIEAITGQ A   L  Q   L   A  LK     +V +++++ ++ +K+
Sbjct: 682 ITENAVAAGIRRIEAITGQNAIDWLHNQQRILTQSADLLKSDVNTLVEKIQQLQDKTKKV 741

Query: 771 QLIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI  V+ ++  +  +++K L+ ++D L+ ++ SG+I
Sbjct: 742 EKELQGLKEKAAMQAGSDFVKSAVKINGVSVITQQLDGIETKSLRVMVDDLKNQLGSGVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
               I  ++K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 AFASIL-DEKVNLVVGVTNDLTAKIKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQPENV 859

Query: 886 DQAIAGVASFLKK 898
            QAI     +L K
Sbjct: 860 AQAIKVAQDWLNK 872


>gi|307256675|ref|ZP_07538454.1| Alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 10
           str. D13039]
 gi|306864723|gb|EFM96627.1| Alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 10
           str. D13039]
          Length = 874

 Score =  929 bits (2400), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/912 (41%), Positives = 543/912 (59%), Gaps = 56/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   S IR +FL+FF   GH ++PSSSL+P NDPTL+FTN+GM  FK++F G EK  Y  
Sbjct: 1   MKTTSEIRQSFLDFFHSKGHTVVPSSSLVPENDPTLLFTNAGMNQFKDVFLGLEKRPYTR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEM+GNFSFG YFK  AIQ  W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKHDAIQFGWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +LY+TVY+ D+EA+ +W KI G+  D IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLYVTVYETDDEAYDIWNKIVGVPTDHIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D GE   GGLPGS  E+G+RYIE+WN+VFMQF +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGETFWGGLPGSPEEDGDRYIEVWNIVFMQFNRLADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ERM  V+Q   +NY+ D+F+ LI+    +  +     +  + RV+ DH+R+ S+LIADG+
Sbjct: 241 ERMTAVMQHVNSNYETDIFQTLIKEVAGLLNVSD--LDNKSLRVVADHIRACSYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L T MG A   L Q +  I++T
Sbjct: 299 VPSNEGRGYVLRRIIRRAVRHGNLLGAKEAFFYKLVPTLATVMGHAGEVLTQKQAHIQKT 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           L++E+E+F +TL+RGL LL+  L+ +  +  L+G+VAFKLYDT+G PLD+  D+   R L
Sbjct: 359 LKAEEEQFARTLERGLALLEDALTKVE-NNTLSGEVAFKLYDTYGFPLDLTADVCREREL 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F   +  QR RA+A S           + ++ +  G T FIGYD L       
Sbjct: 418 T-IDEAGFEAEMTAQRERAKASSNFG------TDYNNVIKVEGQTDFIGYDNLE------ 464

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + +  +   G+ V+   SG+   ++ DQTPFYAE GGQ+GD
Sbjct: 465 -----------------AQATIVGLFSNGKAVDTIQSGESAVIILDQTPFYAEMGGQVGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G    +     + D QK    +F H   +  G L     +  T+    R  ++ NHSAT
Sbjct: 508 SGLISTEICNFAVNDTQKYG-QVFGHIGQLTSGSLSIGDKVTATVHATRRIAITANHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++ + LRFD +  + I+ ++L+ IE  VN  I +N+ V 
Sbjct: 567 HLLHSALREVLGDHVAQKGSLVSENILRFDFSQPEAISKSQLEEIERIVNRKIRKNIQVT 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
              M+ E A   GA AL G KY D VRVV +        S  LCGGTHV  TG+I L  +
Sbjct: 627 IETMDIESAKKKGAMALFGEKYGDVVRVVGMTE-----FSIELCGGTHVQRTGDIGLFKL 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           VSE ++ AGIRR+EA+T + A   L  Q + L+  A FLK    ++V +++++ ++ ++ 
Sbjct: 682 VSEGAVAAGIRRVEAVTAETAIEWLHNQQKVLQQSAEFLKADSNSLVEKIQQLQDKAKRT 741

Query: 771 QLIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +    + K +L  +  S      +KI  VN +   +  V+ K L++++D L+ +++S I+
Sbjct: 742 EKELQQLKDKLAAQAGSELVKQANKINGVNVVVQKLENVEVKSLRTMVDDLKNQLESAIV 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +  G   ++K ++++ VT+DL  + NA +L    A+ + GG GGGR  MA +GG      
Sbjct: 802 V-FGTVADEKVNLIVGVTKDLSSKVNAGELVGAMAQQV-GGKGGGRADMAMAGGSEPQNL 859

Query: 886 DQAIAGVASFLK 897
           D A+     +++
Sbjct: 860 DNALKFAEEWIQ 871


>gi|165976064|ref|YP_001651657.1| alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|205829970|sp|B0BNS8|SYA_ACTPJ RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|165876165|gb|ABY69213.1| alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
          Length = 874

 Score =  929 bits (2400), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/912 (41%), Positives = 543/912 (59%), Gaps = 56/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   S IR +FL+FF   GH ++PSSSL+P NDPTL+FTN+GM  FK++F G EK  Y  
Sbjct: 1   MKTTSEIRQSFLDFFHSKGHTVVPSSSLVPENDPTLLFTNAGMNQFKDVFLGLEKRPYTR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEM+GNFSFG YFK  AIQ  W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKHDAIQFGWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +LY+TVY+ D+EA+ +W KI G+  D IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLYVTVYETDDEAYDIWNKIVGVPTDHIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D GE   GGLPGS  E+G+RYIE+WN+VFMQF +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGETFWGGLPGSPEEDGDRYIEVWNIVFMQFNRLADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ERM  V+Q   +NY+ D+F+ LI+    +  +     +  + RV+ DH+R+ S+LIADG+
Sbjct: 241 ERMTAVMQHVNSNYETDIFQTLIKEVAGLLNVSD--LDNKSLRVVADHIRACSYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L T MG A   L Q +  I++T
Sbjct: 299 VPSNEGRGYVLRRIIRRAVRHGNLLGAKEAFFYKLVPTLATVMGHAGEVLTQKQAHIQKT 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           L++E+E+F +TL+RGL LL+  L+ +  +  L+G+VAFKLYDT+G PLD+  D+   R L
Sbjct: 359 LKAEEEQFARTLERGLALLEDALTKVE-NNTLSGEVAFKLYDTYGFPLDLTADVCREREL 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F   +  QR RA+A S           + ++ +  G T FIGYD L       
Sbjct: 418 T-IDEAGFEAEMTAQRERAKASSNFG------TDYNNVIKVEGQTDFIGYDNLE------ 464

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + +  +   G+ V+   SG+   ++ DQTPFYAE GGQ+GD
Sbjct: 465 -----------------AQATIVGLFSNGKAVDTIQSGESAVIILDQTPFYAEMGGQVGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G    +     + D QK    +F H   +  G L     +  T+    R  ++ NHSAT
Sbjct: 508 SGLISTEICNFTVNDTQKYG-QVFGHIGQLTSGSLSIGDKVTATVHATRRIAITANHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++ + LRFD +  + I+ ++L+ IE  VN  I +N+ V 
Sbjct: 567 HLLHSALREVLGDHVAQKGSLVSENILRFDFSQPEAISKSQLEEIERIVNRKIRENIQVT 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
              M+ E A   GA AL G KY D VRVV +        S  LCGGTHV  TG+I L  +
Sbjct: 627 IETMDIESAKKKGAMALFGEKYGDVVRVVGMTE-----FSIELCGGTHVQRTGDIGLFKL 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           VSE ++ AGIRR+EA+T + A   L  Q + L+  A FLK    ++V +++++ ++ ++ 
Sbjct: 682 VSEGAVAAGIRRVEAVTAETAIEWLHNQQKVLQQSAEFLKADSNSLVEKIQQLQDKAKRT 741

Query: 771 QLIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +    + K +L  +  S      +KI  VN +   +  V+ K L++++D L+ +++S I+
Sbjct: 742 EKELQQLKDKLAAQAGSELVKQANKINGVNVVVQKLENVEVKSLRTMVDDLKNQLESAIV 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +  G   ++K ++++ VT+DL  + NA +L    A+ + GG GGGR  MA +GG      
Sbjct: 802 V-FGTVADEKVNLIVGVTKDLSSKVNAGELVGAMAQQV-GGKGGGRADMAMAGGSEPQNL 859

Query: 886 DQAIAGVASFLK 897
           D A+     +++
Sbjct: 860 DNALKFAEEWIQ 871


>gi|134295482|ref|YP_001119217.1| alanyl-tRNA synthetase [Burkholderia vietnamiensis G4]
 gi|205830008|sp|A4JDM9|SYA_BURVG RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|134138639|gb|ABO54382.1| alanyl-tRNA synthetase [Burkholderia vietnamiensis G4]
          Length = 874

 Score =  929 bits (2400), Expect = 0.0,   Method: Composition-based stats.
 Identities = 382/911 (41%), Positives = 537/911 (58%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTLMFTNSGMV FK++F G ++  Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDQRPYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIRFAWELLTTVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGPC+E
Sbjct: 121 KDKLWVTVYQEDDEAYDIWAKEVGVPAERIIRIGDNKGARYASDNFWTMGDTGPCGPCTE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK S+DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKQSVDTGMGLERL 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ +VT       N  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIKAAARVTETAD--LNNNSLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGAFFHKLVADLVAEMGAAYPELKEAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLS--HLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+       ++L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALADVEAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGMT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYTGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+  +G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVEGSSVGEVKAGQDAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    L   ID Q R +   NHSATH
Sbjct: 509 GVLANAATRFAVADTLKVQADVIGHHGTLEQGTLKVGDVLRAEIDAQRRARTQRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS +  D  RFD  H+ P+T  E++ +E  VND I  N P + 
Sbjct: 569 LMHKALREVLGAHVQQKGSLVDADKTRFDFAHNAPLTDDEIRRVEQIVNDEILANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 629 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVQRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   D ++   A+ LK     +  R+ ++ E+ + L+
Sbjct: 683 VEGGVAAGIRRVEAITGDNAVRYVQELDARVNEAAAALKAQPSELTQRIAQVQEQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             ++  V  ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSKLASSQGDELAQQAVEVGGVFVLAATLDGADAKTLRETVDKLKYKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT +   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LAAV-EGGKVSLIAGVTPEASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLK 897
            A+AGV  +++
Sbjct: 861 GALAGVKGWIE 871


>gi|167563044|ref|ZP_02355960.1| alanyl-tRNA synthetase [Burkholderia oklahomensis EO147]
          Length = 874

 Score =  929 bits (2400), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/912 (41%), Positives = 532/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 1   MKAAEIREKFLRFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + L 
Sbjct: 61  TTSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTTVYKLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY +D+EA+ +W K  G+ A +IIRI  N       DNFW M +TGPCGPCSE
Sbjct: 121 ADKLWVTVYHDDDEAYDIWAKEVGVPAGRIIRIGDNKGARYASDNFWQMGDTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ + TG+    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIKAAARETGIGDLTNN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG AYPEL +A   + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGSFFHKLVADLVAEMGEAYPELKEAGQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L  L     + L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALGDLESKGGKTLDGELAFKLHDTYGFPLDLTADVCRERGVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +   +            T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQGLD-------YSGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYIDGSSVNEVKAGQSAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    +   ID   R + + NHSATH
Sbjct: 509 GVLANAVTRFAVADTLKVQADVIGHHGELEQGALKVGDVVRAEIDAARRARTARNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD  H+ P+T  E++ +E  VN+ +  N P + 
Sbjct: 569 LMHKALRDVLGSHVQQKGSLVDADKTRFDFAHNAPLTDDEIRRVEAIVNEQVLANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I    IV
Sbjct: 629 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGFFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           +E  + AGIRR+EAITG  A  H+   D ++ + A+ LK     ++ R+ ++ ++ + L+
Sbjct: 683 AEGGVAAGIRRVEAITGDNAVRHVQALDARVNAAAAALKAQPSELIQRIGQVQDQVKLLE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
              A  K +L         L   ++  V+ ++  +   D+K L+  +D L+ K+++  I+
Sbjct: 743 KELAALKSKLASSQGDELALQAIEVGGVHVLAATLDGADAKTLRETVDKLKDKLKNAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +    K S++  VT +   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LAAVD-GGKVSLIAGVTPEASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLKK 898
            A+AGV  ++++
Sbjct: 861 AALAGVKGWVEE 872


>gi|145628290|ref|ZP_01784091.1| alanyl-tRNA synthetase [Haemophilus influenzae 22.1-21]
 gi|145638384|ref|ZP_01793994.1| alanyl-tRNA synthetase [Haemophilus influenzae PittII]
 gi|144980065|gb|EDJ89724.1| alanyl-tRNA synthetase [Haemophilus influenzae 22.1-21]
 gi|145272713|gb|EDK12620.1| alanyl-tRNA synthetase [Haemophilus influenzae PittII]
 gi|309751524|gb|ADO81508.1| Alanyl-tRNA synthetase [Haemophilus influenzae R2866]
          Length = 874

 Score =  929 bits (2400), Expect = 0.0,   Method: Composition-based stats.
 Identities = 385/913 (42%), Positives = 550/913 (60%), Gaps = 56/913 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAINFAWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDDEAYNIWNKEVGVPAERIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LP+ S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNVVFMQFNRLADGTMEKLPRPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+FK LI  + ++ G      +  + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFKTLIAKTAEIVGATD--LSNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  ++   +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKESFFYKLVPTLIEVMAEAGKDVKAKQTNVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  L+ +  D++L+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LRLEEEQFARTLERGLSLLDEALAQVK-DDVLSGEVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID  +F++ +E QR+RA+A S           + S+    G T+F GY  +       
Sbjct: 418 T-IDEQAFDREMESQRTRAQAASQFG------VDYNSVIRVDGETKFEGYTEVES----- 465

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + + A+   G+ VE   +GQ   V+ + TPFYAE+GGQ+GD
Sbjct: 466 ------------------QAKITALFHDGKSVESIEAGQSAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G     G+   + D QK    +F H   + +G L+   S+   +D + R   S+NHSAT
Sbjct: 508 SGYLSAQGVTFNVKDTQKYG-QVFGHIGELTQGSLKVGQSVNTIVDAKRRHNTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  ILG HV Q GS ++   LRFD    + IT  +L  IE  VN  I  N PV 
Sbjct: 567 HLLHAALRQILGLHVVQKGSLVSDKALRFDFAQPEAITKEQLSEIETLVNQKIRANFPVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM+ + A A GA AL G KY D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMDIDSAKAKGAMALFGEKYGDKVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           ++E+++ AGIRRIEA+TGQ A   L  Q   L   A  LK     +V +++++ ++ +K+
Sbjct: 682 ITENAVAAGIRRIEAVTGQNAIDWLHNQQRILTQSADLLKSDVNTLVEKIQQLQDKTKKV 741

Query: 771 QLIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI  V+ ++  +  +++K L+ ++D L+ ++ SG+I
Sbjct: 742 EKELQGLKEKAAMQAGSDFVKSAVKINGVSVIAQQLDGIETKSLRVMVDDLKNQLGSGVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
               I  ++K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 AFASIL-DEKVNLVVGVTNDLTAKIKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQPENV 859

Query: 886 DQAIAGVASFLKK 898
            QAI     +L K
Sbjct: 860 AQAIKVAQDWLNK 872


>gi|59798539|sp|Q6LMU3|SYA_PHOPR RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
          Length = 873

 Score =  929 bits (2400), Expect = 0.0,   Method: Composition-based stats.
 Identities = 380/910 (41%), Positives = 533/910 (58%), Gaps = 54/910 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            +   IR  FL FF+  GH+++ SSSL+P NDPTL+FTN+GM  FK+ F G EK  Y   
Sbjct: 3   MSTDEIRRAFLAFFESKGHQIVESSSLVPANDPTLLFTNAGMNQFKDTFLGIEKRSYTRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI+ AW+ LT    L 
Sbjct: 63  TTAQRCVRAGGKHNDLENVGFTARHHTFFEMLGNFSFGDYFKQDAIKYAWEFLTDVLGLP 122

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           Q RL +T+Y+ D+EAF +W K  G+ AD+I+RI  N       DNFW M +TGPCGPCSE
Sbjct: 123 QDRLLVTIYETDDEAFDIWNKEMGIPADRIVRIGDNKGAPYASDNFWQMGDTGPCGPCSE 182

Query: 175 IFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D GE I GG P    E+G+R+IEIWN VFMQF +Q       LPK S+DTGMG+ER+
Sbjct: 183 IFYDHGEHIWGGRPGTPEEDGDRFIEIWNNVFMQFNRQADGTMEPLPKPSVDTGMGIERI 242

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A ++Q   +NY+ID+F+ LI+ S +V G  YE  +  + RV+ DH+RS +FLI DG++P+
Sbjct: 243 AAIMQGVHSNYEIDIFQTLIKKSAEVIG--YEDLSNQSLRVVADHIRSCAFLIVDGVMPS 300

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG +      L+  L   MG+A  EL + + L+E+ L+ 
Sbjct: 301 NEGRGYVLRRIIRRAVRHGNKLGASGAFFYKLVGPLAEIMGTAGDELKKRQALVEKILKI 360

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGI 413
           E++ FG+TLDRGL +L+  L +L   E L+G+  FKLYDT+G P D+  D+   R    I
Sbjct: 361 EEDNFGRTLDRGLTILNDALDNLSGKE-LDGETVFKLYDTYGFPADLTNDVARERDFT-I 418

Query: 414 DIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDR 473
           D   FN A+E QR RAR        G     +    +    T+F GY             
Sbjct: 419 DEEGFNNAMEAQRQRAREA------GKFGVDYNESIKVDVNTEFCGYT------------ 460

Query: 474 KVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGC 533
                           S + A+ + GE V+  ++G+   ++ D TPFYAE+GGQ GD G 
Sbjct: 461 -----------GTAAQSSIVALYRDGEAVDSILAGEDALIILDNTPFYAESGGQCGDAGV 509

Query: 534 AIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLL 593
              +     ++D QK       H   + +G L     L   +D   R  +++NHSATHLL
Sbjct: 510 LTAENTVFNVSDTQKFGA-AIGHQGSLVQGALNVGDKLEAQVDVVRRTAITLNHSATHLL 568

Query: 594 HHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRI 653
           H AL  +LG HV+Q GS + PD LRFD ++ + +   +L+ IE  VN+ I  N  + T I
Sbjct: 569 HSALRNLLGEHVAQKGSLVKPDALRFDFSNLEAVKPEQLREIERVVNEQIRLNHSIDTNI 628

Query: 654 MNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSE 713
           M+ E A   GA AL G KY+D VRV+S+     G  S+ LCGG H  +TG+I L  I SE
Sbjct: 629 MDIESAKQKGAMALFGEKYDDEVRVLSM-----GEFSTELCGGIHAKNTGDIGLFKITSE 683

Query: 714 SSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLI 773
             I AGIRRIEA+TG  A   L  Q+  L   AS +K    +V  +V  +    ++L+  
Sbjct: 684 GGIAAGIRRIEAVTGAAAIDALHAQEALLSETASIVKSDAASVATKVSALLAHSKQLEKD 743

Query: 774 HAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
             + + +L  ++ +       +I  V  +   +   D+K L+ ++D ++ K+ SGI++L 
Sbjct: 744 IQQLQDKLAAQESAGLLDQAKEINGVKVLITQLDGADNKALRGMLDEIKNKLGSGIVVLG 803

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQA 888
            +S + K  +++ VT+DL  +  A +L  + A+ + GG GGGRP MAQ+GG +      A
Sbjct: 804 NVSGD-KVGLIVGVTKDLTGKVKAGELVNMVAQQV-GGKGGGRPDMAQAGGTDAAALPAA 861

Query: 889 IAGVASFLKK 898
           +  V  +L +
Sbjct: 862 LESVTPWLTE 871


>gi|307254463|ref|ZP_07536300.1| Alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 9
           str. CVJ13261]
 gi|307258922|ref|ZP_07540653.1| Alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 11
           str. 56153]
 gi|306862604|gb|EFM94561.1| Alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 9
           str. CVJ13261]
 gi|306866946|gb|EFM98803.1| Alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 11
           str. 56153]
          Length = 874

 Score =  929 bits (2400), Expect = 0.0,   Method: Composition-based stats.
 Identities = 380/912 (41%), Positives = 543/912 (59%), Gaps = 56/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   S IR +FL+FF   GH ++PSSSL+P NDPTL+FTN+GM  FK++F G EK  Y  
Sbjct: 1   MKTTSEIRQSFLDFFHSKGHTVVPSSSLVPENDPTLLFTNAGMNQFKDVFLGLEKRPYTR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEM+GNFSFG YFK  AIQ  W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKHDAIQFGWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +LY+TVY+ D+EA+ +W KI G+  D IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLYVTVYETDDEAYDIWNKIVGVPTDHIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D GE   GGLPGS  E+G+RYIE+WN+VFMQF +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGETFWGGLPGSPEEDGDRYIEVWNIVFMQFNRLADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ERM  V+Q   +NY+ D+F+ LI+    +  +     +  + RV+ DH+R+ S+LIADG+
Sbjct: 241 ERMTAVMQHVNSNYETDIFQTLIKEVAGLLNVSD--LDNKSLRVVADHIRACSYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L T MG A   L Q +  I++T
Sbjct: 299 VPSNEGRGYVLRRIIRRAVRHGNLLGAKEAFFYKLVPTLATVMGHAGEVLTQKQAHIQKT 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           L++E+E+F +TL+RGL LL+  L+ +  +  L+G+VAFKLYDT+G PLD+  D+   R L
Sbjct: 359 LKAEEEQFARTLERGLALLEDALTKVE-NNTLSGEVAFKLYDTYGFPLDLTADVCREREL 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F   +  QR RA+A S           + ++ +  G T FIGYD L       
Sbjct: 418 T-IDEAGFEAEMTAQRERAKASSNFG------TDYNNVIKVEGQTDFIGYDNLE------ 464

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + +  +   G+ V+   SG+   ++ DQTPFYAE GGQ+GD
Sbjct: 465 -----------------AQATIVGLFSNGKAVDTIQSGESAVIILDQTPFYAEMGGQVGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G          + D QK    +F H   +  G L     +  T+D   R  ++ NHSAT
Sbjct: 508 SGLISTGICNFAVNDTQKYG-QVFGHIGQLTSGSLSIGDKVTATVDATRRVAITANHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++ + LRFD +  + I+ ++L+ IE  VN  I +N+ V 
Sbjct: 567 HLLHSALREVLGDHVAQKGSLVSENILRFDFSQPEAISKSQLEEIERIVNRKIRENIQVT 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
              M+ E A   GA AL G KY D VRVV +        S  LCGGTHV  TG+I L  +
Sbjct: 627 IETMDIESAKKKGAMALFGEKYGDVVRVVGMTE-----FSIELCGGTHVQRTGDIGLFKL 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           VSE ++ AGIRR+EA+T + A   L  Q + L+  A FLK    ++V +++++ ++ ++ 
Sbjct: 682 VSEGAVAAGIRRVEAVTAETAIEWLHNQQKVLQQSAEFLKADSNSLVEKIQQLQDKAKRT 741

Query: 771 QLIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +    + K +L  +  S      +KI  VN +   +  V+ K L++++D L+ +++S I+
Sbjct: 742 EKELQQLKDKLAAQAGSELVKQANKINGVNVVVQKLENVEVKSLRTMVDDLKNQLESAIV 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +  G   ++K ++++ VT+DL  + NA +L    A+ + GG GGGR  MA +GG      
Sbjct: 802 V-FGTVADEKVNLIVGVTKDLSSKVNAGELVGAMAQQV-GGKGGGRADMAMAGGSEPQNL 859

Query: 886 DQAIAGVASFLK 897
           D A+     +++
Sbjct: 860 DNALKFAEEWIQ 871


>gi|145632173|ref|ZP_01787908.1| alanyl-tRNA synthetase [Haemophilus influenzae 3655]
 gi|144987080|gb|EDJ93610.1| alanyl-tRNA synthetase [Haemophilus influenzae 3655]
          Length = 874

 Score =  929 bits (2400), Expect = 0.0,   Method: Composition-based stats.
 Identities = 387/913 (42%), Positives = 549/913 (60%), Gaps = 56/913 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAINFAWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDDEAYNIWNKEVGVPAERIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LP+ S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNVVFMQFNRLADGTMEKLPRPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+FK LI  + ++ G      +  + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFKTLIAKTAEIVGATD--LSNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  ++   +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKESFFYKLVPTLIEVMAEAGKDVKAKQTNVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  LS +  D IL+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LRLEEEQFARTLERGLSLLDEALSQVK-DGILSGEVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID  +F++ +E QR+RA+A S           + S+    G T+F GY  +       
Sbjct: 418 T-IDEQAFDREMESQRTRAQAASQFG------VDYNSVIRVDGETKFEGYTEVES----- 465

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + + A+   G+ VE   +GQ   V+ + TPFYAE+GGQ+GD
Sbjct: 466 ------------------QAKITALFYDGKSVESIEAGQSAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G     G+   + D QK    +F H   + +G L+   S+   +D + R   S+NHSAT
Sbjct: 508 SGYLSAQGVTFNVKDTQKYG-QVFGHIGELTQGSLKVGQSVNAIVDAKRRHNTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  ILG HV Q GS ++   LRFD    + IT  +L  IE  VN  I  N PV 
Sbjct: 567 HLLHAALRQILGLHVVQKGSLVSDKALRFDFAQPEAITKEQLSEIETLVNQKILANFPVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM+ + A A GA AL G KY D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMDIDSAKAKGAMALFGEKYGDKVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           ++E+++ AGIRRIEA+TGQ A   L  Q   L   A  LK     +V +++++ ++ +K+
Sbjct: 682 ITENAVAAGIRRIEAVTGQNAIDWLHNQQRILTQSADLLKSDVNTLVEKIQQLQDKTKKV 741

Query: 771 QLIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI  V+ ++  +  +++K L+ ++D L+ ++ SG+I
Sbjct: 742 EKELQGLKEKAAMQAGSDFVKSAVKINGVSVIAQQLDGIETKSLRVMVDDLKNQLGSGVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
               I  ++K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 AFASIL-DEKVNLVVGVTNDLTAKIKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQPENV 859

Query: 886 DQAIAGVASFLKK 898
            QAI     +L K
Sbjct: 860 AQAIKVAQDWLNK 872


>gi|296158159|ref|ZP_06840991.1| alanyl-tRNA synthetase [Burkholderia sp. Ch1-1]
 gi|295891495|gb|EFG71281.1| alanyl-tRNA synthetase [Burkholderia sp. Ch1-1]
          Length = 874

 Score =  929 bits (2400), Expect = 0.0,   Method: Composition-based stats.
 Identities = 377/911 (41%), Positives = 539/911 (59%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAESRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTGVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA  +W K  G+  ++IIRI  N       DNFW MA+TGPCGPCSE
Sbjct: 121 KDKLWVTVYHEDDEAHDIWAKEVGVPVERIIRIGDNKGARYASDNFWQMADTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTPLPKQCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+A+ + TG+    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQALIKAAARETGVSDLTNN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        ++  L  +MG+AYPEL  A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGKKGSFFHRMVADLVAQMGAAYPELKDAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLG--KDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+G L+ L     + L+G++AFKL+DT+G PLD+  D+   R + 
Sbjct: 359 EEERFFETIEHGMSILEGALAELEAGSSKTLDGELAFKLHDTYGFPLDLTADVCREREVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F++A+  QR +ARA      +         L+     T F GYD +        
Sbjct: 419 -VDEAAFDEAMTRQREQARAAGKFKMAQG-------LEYSGEKTTFHGYDEIVFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+  +G  V++A  GQ+  VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVIALYVEGASVQQASQGQQAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G      +R  ++D  K    +  HH  +E+G L+    +   ID   R + + NHSATH
Sbjct: 509 GVLANASVRFAVSDTLKVQADVVGHHGTLEQGTLKVGDVVKAEIDAVRRARTARNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS +  D  RFD  H+ P+T  +++ +E+ VN  +  N P + 
Sbjct: 569 LMHKALREVLGTHVQQKGSLVDADKTRFDFAHNAPLTDEQIRRVEEIVNAEVLANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M+ ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 629 RVMSFDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A   +   D ++ + A+ LK     +  R+ ++ ++ + L+
Sbjct: 683 MEGGVAAGIRRVEAITGDNAVRFVQDLDARINAAAAVLKAQPSELTQRIVQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
              +  K ++             ++  V+ ++  +   D K L+  +D L+ K++S  I+
Sbjct: 743 KELSALKSKMASSQGDELAGQAIEVGGVHVLAATLEGADVKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LASV-EGGKVSLIAGVTADASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLK 897
            A+AGV  +++
Sbjct: 861 AALAGVKGWVE 871


>gi|303253696|ref|ZP_07339833.1| alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|307247624|ref|ZP_07529667.1| Alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
 gi|302647421|gb|EFL77640.1| alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|306855894|gb|EFM88054.1| Alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
          Length = 874

 Score =  928 bits (2399), Expect = 0.0,   Method: Composition-based stats.
 Identities = 380/912 (41%), Positives = 544/912 (59%), Gaps = 56/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   S IR +FL+FF   GH ++PSSSL+P NDPTL+FTN+GM  FK++F G EK  Y  
Sbjct: 1   MKTTSEIRQSFLDFFHSKGHTVVPSSSLVPENDPTLLFTNAGMNQFKDVFLGLEKRPYTR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEM+GNFSFG YFK  AIQ  W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKHDAIQFGWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +LY+TVY+ D+EA+ +W KI G+  D IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLYVTVYETDDEAYDIWNKIVGVPTDHIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D GE   GGLPGS  E+G+RYIE+WN+VFMQF +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGETFWGGLPGSPEEDGDRYIEVWNIVFMQFNRLADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ERM  V+Q   +NY+ D+F+ LI+    +  +     +  + RV+ DH+R+ S+LIADG+
Sbjct: 241 ERMTAVMQHVNSNYETDIFQTLIKEVAGLLNVSD--LDNKSLRVVADHIRACSYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L T MG A   L Q +  I++T
Sbjct: 299 VPSNEGRGYVLRRIIRRAVRHGNLLGAKEAFFYKLVPTLATVMGHAGEVLTQKQAHIQKT 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           L++E+E+F +TL+RGL LL+  L+ +  +  L+G+VAFKLYDT+G PLD+  D+   R L
Sbjct: 359 LKAEEEQFARTLERGLALLEDALTKVE-NNTLSGEVAFKLYDTYGFPLDLTADVCREREL 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F   +  QR RA+A S           + ++ +  G T FIGYD L       
Sbjct: 418 T-IDEAGFEAEMTAQRERAKASSNFG------TDYNNVIKVEGQTDFIGYDNLE------ 464

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + +  +   G+ V+   SG+   ++ DQTPFYAE GGQ+GD
Sbjct: 465 -----------------AQATIVGLFSNGKAVDTIQSGESAVIILDQTPFYAEMGGQVGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G    +     + D QK    +F H   +  G L     +  T+D   R  ++ NHSAT
Sbjct: 508 SGLISTEICNFAVNDTQKYG-QVFGHIGQLTSGSLSIGDKVTATVDATRRVAITANHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++ + LRFD +  + I+ ++L+ IE  VN  I +N+ V 
Sbjct: 567 HLLHSALREVLGDHVAQKGSLVSENILRFDFSQPEAISKSQLEEIERIVNRKIRENIQVT 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
              M+ E A   GA AL G KY D VRVV +        S  LCGGTHV  TG+I L  +
Sbjct: 627 IETMDIESAKKKGAMALFGEKYGDVVRVVGMTE-----FSIELCGGTHVQRTGDIGLFKL 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           VSE ++ AGIRR+EA+T + A   L  Q + L+  A FLK    ++V +++++ ++ ++ 
Sbjct: 682 VSEGAVAAGIRRVEAVTAETAIEWLHNQQKVLQQSAEFLKADSNSLVEKIQQLQDKAKRT 741

Query: 771 QLIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +    + K +L  +  S      +KI  VN +   +  V+ K L++++D L+ +++S I+
Sbjct: 742 EKELQQLKDKLAAQAGSELVKQANKINGVNVVVQKLENVEVKSLRTMVDDLKNQLESAIV 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +  G   ++K ++++ VT+DL  + NA +L    A+ + GG GGGR  MA +GG      
Sbjct: 802 V-FGTVADEKVNLIVGVTKDLSSKVNAGELVGAMAQQV-GGKGGGRADMAMAGGSEPQNL 859

Query: 886 DQAIAGVASFLK 897
           D A+     +++
Sbjct: 860 DNALKFAEEWIQ 871


>gi|146341851|ref|YP_001206899.1| alanyl-tRNA synthetase [Bradyrhizobium sp. ORS278]
 gi|205829995|sp|A4YXQ6|SYA_BRASO RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|146194657|emb|CAL78682.1| alanyl-tRNA synthetase [Bradyrhizobium sp. ORS278]
          Length = 891

 Score =  928 bits (2399), Expect = 0.0,   Method: Composition-based stats.
 Identities = 464/896 (51%), Positives = 606/896 (67%), Gaps = 39/896 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+TFL FF  NGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG EK  Y  
Sbjct: 1   MSGVNEIRSTFLNFFAANGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRPYHR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE AI+LAW L+TKEF L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKENAIELAWKLVTKEFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + +L  TVY +D+EAF LWKKI+GL   +IIRI  +DNFW M +TGPCGPCSEIF+D G
Sbjct: 121 PKDKLTATVYIDDDEAFGLWKKIAGLPESRIIRIAGSDNFWQMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSSE-EGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS+E +G+R+IEIWNLVFMQ+EQ     R  LPK SIDTG GLER+A VLQ 
Sbjct: 181 DKIWGGPPGSAEADGDRFIEIWNLVFMQYEQLEGGVRNPLPKPSIDTGAGLERVAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           K +NYDIDLF  LI+A   +T    +G    + RVI DHLR+SSFLI+DG+LP+NEGRGY
Sbjct: 241 KHDNYDIDLFVALIRAIADLTNADPQGPQKASLRVIADHLRASSFLISDGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  L+ AL  EMG AYPELI+A+ LI+ETLR E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAREPLMHKLVGALTREMGQAYPELIRAEGLIKETLRLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL +LD   + L K ++ +GDVAF LYDT+G PLD+ QD L +RG   +D  SF 
Sbjct: 361 KTLERGLAILDEKSASLSKGDMFDGDVAFTLYDTYGFPLDLTQDALKSRG-ISVDQASFT 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E Q+++ARA   G G   TE +WF L+EK GAT+F+GY+                  
Sbjct: 420 DAMERQKAKARAAWAGSGEAATETVWFPLREKLGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T      V A+V+ G  V+   +G+   +V +QTPFY E+GGQ+GDTG   G+G+
Sbjct: 462 -----TETAEGAVTALVKDGAEVDSLKAGESGAIVLNQTPFYGESGGQVGDTGVLTGEGV 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           R++ITD QKKA  +F H   VE+G L+    L L +D+  R  +  NHSATH+LH AL  
Sbjct: 517 RVRITDTQKKAGDLFAHIGTVEQGTLKLGTPLQLDVDHIRRSAIRANHSATHILHEALRQ 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG H++Q GS ++PD LRFD  H KPIT+ EL  +ED  ND++ +N  V TR+M  +DA
Sbjct: 577 VLGDHIAQRGSLVSPDRLRFDFVHPKPITAEELARVEDIANDVVLENAEVTTRLMGLDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSVE------YEDGGVHSSALCGGTHVSSTGEIMLLYIVSE 713
             +GA AL G KY D VRVVS+         +    S  LCGGTHV  TG+I L+ + SE
Sbjct: 637 REAGARALFGEKYGDEVRVVSMGNAARDHGNNAMGWSVELCGGTHVKRTGDIGLIAVTSE 696

Query: 714 SSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLI 773
           S++ +G+RRIEA+T + AR+H        K+ A+ L+ +   V  R+  + EE +KL+  
Sbjct: 697 SAVASGVRRIEALTARGARAHANHNLSLAKAAAAELRTTVDEVPARITALMEERKKLERE 756

Query: 774 HAKRKLQLNV--------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
            +  + +L +              ++A +  M+  +  V+ K+LKS++D  +K++ SG++
Sbjct: 757 LSDARKKLAMGGGAAAGGAAAGIREVAGIKLMARAVDGVEVKDLKSLVDEAKKQLGSGVV 816

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPN 881
            +VG S++ KA V++ VT DL  RFNAV+L R +++ LGG GGGGRP MAQ+GGP+
Sbjct: 817 AIVGRSEDGKAGVVVGVTADLTARFNAVELVRAASEALGGKGGGGRPDMAQAGGPD 872


>gi|307245509|ref|ZP_07527596.1| Alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|306853568|gb|EFM85786.1| Alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
          Length = 874

 Score =  928 bits (2399), Expect = 0.0,   Method: Composition-based stats.
 Identities = 380/912 (41%), Positives = 543/912 (59%), Gaps = 56/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   S IR +FL+FF   GH ++PSSSL+P NDPTL+FTN+GM  FK++F G EK  Y  
Sbjct: 1   MKTTSEIRQSFLDFFHSKGHTVVPSSSLVPENDPTLLFTNAGMNQFKDVFLGLEKRPYTR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEM+GNFSFG YFK  AIQ  W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKHDAIQFGWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +LY+TVY+ D+EA+ +W KI G+  D IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLYVTVYETDDEAYDIWNKIVGVPTDHIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D GE   GGLPGS  E+G+RYIE+WN+VFMQF +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGETFWGGLPGSPEEDGDRYIEVWNIVFMQFNRLADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ERM  V+Q   +NY+ D+F+ LI+    +  +     +  + RV+ DH+R+ S+LIADG+
Sbjct: 241 ERMTAVMQHVNSNYETDIFQTLIKEVAGLLNVSD--LDNKSLRVVADHIRACSYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L T MG A   L Q +  I++T
Sbjct: 299 VPSNEGRGYVLRRIIRRAVRHGNLLGAKEAFFYKLVPTLATVMGHAGEVLTQKQAHIQKT 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           L++E+E+F +TL+RGL LL+  L+ +  +  L+G+VAFKLYDT+G PLD+  D+   R L
Sbjct: 359 LKAEEEQFARTLERGLALLEDALTKVE-NNTLSGEVAFKLYDTYGFPLDLTADVCREREL 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F   +  QR RA+A S           + ++ +  G T FIGYD L       
Sbjct: 418 T-IDKAGFEAEMTAQRERAKASSNFG------TDYNNVIKVEGQTDFIGYDNLE------ 464

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + +  +   G+ V+   SG+   ++ DQTPFYAE GGQ+GD
Sbjct: 465 -----------------AQATIVGLFSNGKAVDTIQSGESAVIILDQTPFYAEMGGQVGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G          + D QK    +F H   +  G L     +  T+D   R  ++ NHSAT
Sbjct: 508 SGLISTGICNFAVNDTQKYG-QVFGHIGQLTSGSLSIGDKVTATVDATRRVAITANHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++ + LRFD +  + I+ ++L+ IE  VN  I +N+ V 
Sbjct: 567 HLLHSALREVLGDHVAQKGSLVSENILRFDFSQPEAISKSQLEEIERIVNRKIRENIQVT 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
              M+ E A   GA AL G KY D VRVV +        S  LCGGTHV  TG+I L  +
Sbjct: 627 IETMDIESAKKKGAMALFGEKYGDVVRVVGMTE-----FSIELCGGTHVQRTGDIGLFKL 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           VSE ++ AGIRR+EA+T + A   L  Q + L+  A FLK    ++V +++++ ++ ++ 
Sbjct: 682 VSEGAVAAGIRRVEAVTAETAIEWLHNQQKVLQQSAEFLKADSNSLVEKIQQLQDKAKRT 741

Query: 771 QLIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +    + K +L  +  S      +KI  VN +   +  V+ K L++++D L+ +++S I+
Sbjct: 742 EKELQQLKDKLAAQAGSELVKQANKINGVNVVVQKLENVEVKSLRTMVDDLKNQLESAIV 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +  G   ++K ++++ VT+DL  + NA +L    A+ + GG GGGR  MA +GG      
Sbjct: 802 V-FGTVADEKVNLIVGVTKDLSSKVNAGELVGAMAQQV-GGKGGGRADMAMAGGSEPQNL 859

Query: 886 DQAIAGVASFLK 897
           D A+     +++
Sbjct: 860 DNALKFAEEWIQ 871


>gi|53729167|ref|ZP_00134001.2| COG0013: Alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|126208134|ref|YP_001053359.1| alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae L20]
 gi|205829968|sp|A3N018|SYA_ACTP2 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|126096926|gb|ABN73754.1| alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 5b
           str. L20]
          Length = 874

 Score =  928 bits (2399), Expect = 0.0,   Method: Composition-based stats.
 Identities = 378/912 (41%), Positives = 542/912 (59%), Gaps = 56/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   S IR +FL+FF   GH ++PSSSL+P NDPTL+FTN+GM  FK++F G EK  Y  
Sbjct: 1   MKTTSEIRQSFLDFFHSKGHTVVPSSSLVPENDPTLLFTNAGMNQFKDVFLGLEKRPYTR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEM+GNFSFG YFK  AIQ  W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKHDAIQFGWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +LY+TVY+ D+EA+ +W KI G+  D IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLYVTVYETDDEAYDIWNKIVGVPTDHIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D GE   GGLPGS  E+G+RYIE+WN+VFMQF +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGETFWGGLPGSPEEDGDRYIEVWNIVFMQFNRLADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ERM  V+Q   +NY+ D+F+ LI+    +  +     +  + RV+ DH+R+ S+LIADG+
Sbjct: 241 ERMTAVMQHVNSNYETDIFQTLIKEVAGLLNVSD--LDNKSLRVVADHIRACSYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L T MG A   L Q +  I++T
Sbjct: 299 VPSNEGRGYVLRRIIRRAVRHGNLLGAKEAFFYKLVPTLATVMGHAGEVLTQKQAHIQKT 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           L++E+E+F +TL+RGL LL+  L+ +  +  L+G+VAFKLYDT+G PLD+  D+   R L
Sbjct: 359 LKAEEEQFARTLERGLALLEDALTKVE-NNTLSGEVAFKLYDTYGFPLDLTADVCREREL 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F   +  QR RA+A S           + ++ +  G T FIGYD L       
Sbjct: 418 T-IDEAGFEAEMTAQRERAKASSNFG------TDYNNVIKVEGQTDFIGYDNLE------ 464

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + +  +   G+ V+   SG+   ++ DQT FYAE GGQ+GD
Sbjct: 465 -----------------AQATIVGLFSNGKAVDTIQSGESAVIILDQTSFYAEMGGQVGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G    +     + D QK    +F H   +  G L     +  T+    R  ++ NHSAT
Sbjct: 508 SGLISTEICNFAVNDTQKYG-QVFGHIGQLTSGSLSIGDKVTATVHATRRIAITANHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++ + LRFD +  + I+ ++L+ IE  VN  I +N+ V 
Sbjct: 567 HLLHSALREVLGDHVAQKGSLVSENILRFDFSQPEAISKSQLEEIERIVNRKIRENIQVT 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
              M+ E A   GA AL G KY D VRVV +        S  LCGGTHV  TG+I L  +
Sbjct: 627 IETMDIESAKKKGAMALFGEKYGDVVRVVGMTE-----FSIELCGGTHVQRTGDIGLFKL 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           VSE ++ AGIRR+EA+T + A   L  Q + L+  A FLK    ++V +++++ ++ ++ 
Sbjct: 682 VSEGAVAAGIRRVEAVTAETAIEWLHNQQKVLQQSAEFLKADSNSLVEKIQQLQDKAKRT 741

Query: 771 QLIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +    + K +L  +  S      +KI  VN +   +  V+ K L++++D L+ +++S I+
Sbjct: 742 EKELQQLKDKLAAQAGSELVKQANKINGVNVVVQKLENVEVKSLRTMVDDLKNQLESAIV 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +  G   ++K ++++ VT+DL  + NA +L    A+ + GG GGGR  MA +GG      
Sbjct: 802 V-FGTVADEKVNLIVGVTKDLSSKVNAGELVGAMAQQV-GGKGGGRADMAMAGGSEPQNL 859

Query: 886 DQAIAGVASFLK 897
           D A+     +++
Sbjct: 860 DNALKFAEEWIQ 871


>gi|229844682|ref|ZP_04464821.1| alanyl-tRNA synthetase [Haemophilus influenzae 6P18H1]
 gi|229812396|gb|EEP48086.1| alanyl-tRNA synthetase [Haemophilus influenzae 6P18H1]
          Length = 874

 Score =  928 bits (2399), Expect = 0.0,   Method: Composition-based stats.
 Identities = 387/913 (42%), Positives = 550/913 (60%), Gaps = 56/913 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAINFAWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDDEAYNIWNKEVGVPAERIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LP+ S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNVVFMQFNRLADGTMEKLPRPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+FK LI+ + ++ G      +  + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFKTLIEKTAEIVGATD--LSNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  ++   +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKESFFYKLVPTLIEVMAEAGKDVKAKQTNVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  LS +  D IL+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LRLEEEQFARTLERGLSLLDEALSQVK-DGILSGEVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID  +F++ +E QR+RA+A S           + S+    G T+F GY  +       
Sbjct: 418 T-IDEQAFDREMESQRTRAQAASQFG------VDYNSVIRVDGETKFEGYTEVES----- 465

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + + A+   G+ VE   +GQ   V+ + TPFYAE+GGQ+GD
Sbjct: 466 ------------------QAKITALFYDGKSVESIEAGQSAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G     G+   + D QK    +F H   + +G L+   S+   +D + R   S+NHSAT
Sbjct: 508 SGYLSAQGVTFNVKDTQKYG-QVFGHIGELTQGSLKVGQSVNAIVDAKRRHNTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  ILG HV Q GS ++   LRFD    + IT  +L  IE  VN  I  N PV 
Sbjct: 567 HLLHAALRQILGLHVVQKGSLVSDKALRFDFAQPEAITKEQLSEIETLVNQKIRANFPVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM+ + A A GA AL G KY D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMDIDSAKAKGAMALFGEKYGDKVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           ++E+++ AGIRRIEA+TGQ A   L  Q   L   A  LK     +V +++++ ++ +K+
Sbjct: 682 ITENAVAAGIRRIEAVTGQNAIDWLHNQQRILTQSADLLKSDVNTLVEKIQQLQDKTKKV 741

Query: 771 QLIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI  V+ ++  +  +++K L+ ++D L+ ++ SG+I
Sbjct: 742 EKELQGLKEKAAMQAGSDFVKSAVKINGVSVIAQQLDGIETKSLRVMVDDLKNQLGSGVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
               I  ++K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 AFASIL-DEKVNLVVGVTNDLTAKIKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQPENV 859

Query: 886 DQAIAGVASFLKK 898
            QAI     +L K
Sbjct: 860 AQAIKVAQDWLNK 872


>gi|322514279|ref|ZP_08067338.1| alanine--tRNA ligase [Actinobacillus ureae ATCC 25976]
 gi|322119833|gb|EFX91853.1| alanine--tRNA ligase [Actinobacillus ureae ATCC 25976]
          Length = 874

 Score =  928 bits (2398), Expect = 0.0,   Method: Composition-based stats.
 Identities = 374/912 (41%), Positives = 543/912 (59%), Gaps = 56/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   S IR +FL+FF   GH ++PSSSL+P NDPTL+FTN+GM  FK++F G EK  Y  
Sbjct: 1   MKTTSEIRQSFLDFFHSKGHTVVPSSSLVPENDPTLLFTNAGMNQFKDVFLGLEKRPYTR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEM+GNFSFG YFK+ AIQ  W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKQDAIQFGWEYLTSLQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +LY+TVY+ D+EA+ +W KI G+  D IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLYVTVYETDDEAYDIWNKIVGVPTDHIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+   GGLP    E+G+RYIE+WN+VFMQF +Q       LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGDTFWGGLPGTPEEDGDRYIEVWNIVFMQFNRQADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ERM  V+Q   +NY+ D+F+ LI+    +  +     +  + RV+ DH+R+ S+LIADG+
Sbjct: 241 ERMTAVMQHVNSNYETDIFQTLIKEVAGLLNVTD--LDNKSLRVVADHIRACSYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L T MG A   L Q +  I++T
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGNLLGAKEAFFYKLVPTLATVMGHAGEILTQKQAHIQKT 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           L++E+E+F +TL+RGL LL+  L+ +  +  L+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LKAEEEQFARTLERGLALLEDALTKVE-NNTLSGEVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F   +  QR RA+A S           + ++ +  G T FIGYD L       
Sbjct: 418 T-IDEAGFEAEMSAQRERAKASSNFG------TDYSNVIKVDGQTDFIGYDNLE------ 464

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + +  +   G+ V+   SG+   ++ DQTPFYAE GGQ+GD
Sbjct: 465 -----------------AQATIVGLFSNGKAVDTIHSGESAVIILDQTPFYAEMGGQVGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
            G    +     ++D QK    +F H   +  G L     +   ++   R+ ++ NHSAT
Sbjct: 508 NGLISTEICEFTVSDTQKYG-QVFGHVGQLTSGSLAIGDKVTAHVEINRRQAITANHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++ D LRFD +  + IT A+L+ IE  VN  I +N+ VV
Sbjct: 567 HLLHSALREVLGDHVAQKGSLVSEDALRFDFSQPEAITKAQLEEIERIVNRNIRENIQVV 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
              M+ E A   GA AL G KY D VRVV +        S  LCGGTHV  TGEI L  +
Sbjct: 627 IETMDIESAKQKGAMALFGEKYGDVVRVVGMTE-----FSIELCGGTHVQHTGEIGLFKL 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           VSE ++ AG+RR+EA+TG++A   L  Q   ++  A  LK    ++V +++++ ++ ++ 
Sbjct: 682 VSEGAVAAGVRRVEAVTGEKAMDWLHNQQRVIQQSAELLKADSNSLVEKIQQLQDKAKRT 741

Query: 771 QLIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +    + K +   +  S       +I  VN +   +  V++K L++++D L+ + ++ I+
Sbjct: 742 EKELQQLKDKFAAQAGSELAKQASQINGVNVIVQKLEGVETKSLRTMVDDLKNQFENAIV 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +   ++ + K ++++ VT+DL  + NA +L    A+ + GG GGGR  MA +GG      
Sbjct: 802 VFGSVA-DDKVNLIVGVTKDLSSKVNAGELVGAMAQQV-GGKGGGRADMAMAGGSEPQHL 859

Query: 886 DQAIAGVASFLK 897
           D A+     +++
Sbjct: 860 DSALKFAQEWIQ 871


>gi|190149963|ref|YP_001968488.1| alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|307263291|ref|ZP_07544909.1| Alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 13
           str. N273]
 gi|205829969|sp|B3H177|SYA_ACTP7 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|189915094|gb|ACE61346.1| alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|306871353|gb|EFN03079.1| Alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 13
           str. N273]
          Length = 874

 Score =  928 bits (2397), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/912 (41%), Positives = 544/912 (59%), Gaps = 56/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   S IR +FL+FF   GH ++PSSSL+P NDPTL+FTN+GM  FK++F G EK  Y  
Sbjct: 1   MKTTSEIRQSFLDFFHSKGHTVVPSSSLVPENDPTLLFTNAGMNQFKDVFLGLEKRPYTR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEM+GNFSFG YFK  AIQ  W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKHDAIQFGWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +LY+TVY+ D+EA+ +W KI G+  D IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLYVTVYETDDEAYDIWNKIVGVPTDHIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D GE   GGLPGS  E+G+RYIE+WN+VFMQF +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGETFWGGLPGSPEEDGDRYIEVWNIVFMQFNRLADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ERM  V+Q   +NY+ D+F+ LI+    +  +     +  + RV+ DH+R+ S+LIADG+
Sbjct: 241 ERMTAVMQHVNSNYETDIFQTLIKEVAGLLNVTD--LDNKSLRVVADHIRACSYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L T MG A   L Q +  I++T
Sbjct: 299 VPSNEGRGYVLRRIIRRAVRHGNLLGAKEAFFYKLVPTLATVMGHAGEVLTQKQAHIQKT 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           L++E+E+F +TL+RGL LL+  L+ +  +  L+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LKAEEEQFARTLERGLALLEDALTKVE-NNTLSGEVAFKLYDTYGFPLDLTADVCREREI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F   +  QR RA+A S           + ++ +  G T FIGYD L       
Sbjct: 418 T-IDEAGFEAEMTAQRERAKASSNFG------ADYNNVIKVEGQTDFIGYDNL------- 463

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + +  +   G+ V+   SG+   ++ DQTPFYAE GGQ+GD
Sbjct: 464 ----------------AAQATIVGLFSNGKAVDTIQSGESAVIILDQTPFYAEMGGQVGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G    +     + D QK    +F H   +  G L     +  T+D   R  ++ NHSAT
Sbjct: 508 SGLISTEICNFAVNDTQKYG-QVFGHIGQLTSGSLSIGDKVTATVDATRRVAITANHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++ + LRFD +  + I+ ++L+ IE  VN  I +N+ V 
Sbjct: 567 HLLHSALREVLGDHVAQKGSLVSENILRFDFSQPEAISKSQLEEIERIVNRKIRENIQVT 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
              M+ E A   GA AL G KY D VRVV +        S  LCGGTHV  TG+I L  +
Sbjct: 627 IETMDIESAKKKGAMALFGEKYGDVVRVVGMTE-----FSIELCGGTHVQRTGDIGLFKL 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           VSE ++ AGIRR+EA+T + A   L  Q + L+  A FLK    ++V +++++ ++ ++ 
Sbjct: 682 VSEGAVAAGIRRVEAVTAETAIEWLHNQQKVLQQSAEFLKADSNSLVEKIQQLQDKAKRT 741

Query: 771 QLIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +    + K +L  +  S      +KI  VN +   +  V+ K L++++D L+ +++S I+
Sbjct: 742 EKELQQLKDKLAAQAGSELVKQANKINGVNVVVQKLENVEVKSLRTMVDDLKNQLESAIV 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +  G   ++K ++++ VT+DL  + NA +L    A+ + GG GGGR  MA +GG      
Sbjct: 802 V-FGTVADEKVNLIVGVTKDLSSKVNAGELVGAMAQQV-GGKGGGRADMAMAGGSEPQNL 859

Query: 886 DQAIAGVASFLK 897
           D A+     +++
Sbjct: 860 DNALKFAEEWIQ 871


>gi|90423082|ref|YP_531452.1| alanyl-tRNA synthetase [Rhodopseudomonas palustris BisB18]
 gi|122476792|sp|Q218Q3|SYA_RHOPB RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|90105096|gb|ABD87133.1| alanyl-tRNA synthetase [Rhodopseudomonas palustris BisB18]
          Length = 890

 Score =  928 bits (2397), Expect = 0.0,   Method: Composition-based stats.
 Identities = 468/912 (51%), Positives = 627/912 (68%), Gaps = 40/912 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+ FL +F K+GHE++PSS L+P NDPTLMFTN+GMV FKN+FTG EK     
Sbjct: 1   MSGVNEIRSAFLNYFGKDGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRANHR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK+ AI+LAW+L+TKEF L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKDHAIELAWNLITKEFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + RL +TV+ ED+EAF LWKKI+GL   KIIRI T+DNFW M +TGPCGPCSEIFFD G
Sbjct: 121 PKERLLVTVFSEDDEAFALWKKIAGLPDSKIIRIPTSDNFWQMGDTGPCGPCSEIFFDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + IPGG PGS  E+G+R+IEIWNLVFMQF+Q    +R  LPK SIDTGMGLER+A VLQ 
Sbjct: 181 DHIPGGPPGSPEEDGDRFIEIWNLVFMQFDQIAPGQRNPLPKPSIDTGMGLERIAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           K +NYDIDLF+ LI+A  ++TG   +G +  + RVI DHLR+SSFLIADG+LP+NEGRGY
Sbjct: 241 KHDNYDIDLFQALIRAIAELTGADPKGEHKASLRVIADHLRASSFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM + +LLG TEPLM  L+ AL  EMG AYPEL++A+ +IEETLR E+ RF 
Sbjct: 301 VLRRIMRRAMRHGQLLGATEPLMWRLVWALVREMGQAYPELVRAEPMIEETLRLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTLDRGL++LD   S L K ++ +G+ AF LYDT+G PLD+ QD L  RG   +DI SF 
Sbjct: 361 KTLDRGLIILDEKSSTLKKGDMFDGETAFTLYDTYGFPLDLTQDALRNRG-ISVDIASFT 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A++ QR++ARA   G G   TE +WF L+E+ GAT+F+GY+                  
Sbjct: 420 DAMDRQRAKARASWAGSGDTATETVWFGLREQLGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +V A+V+ G+ V++   G+   +V +QTPFYAE+GGQ+GDTG   G+G+
Sbjct: 462 -----TETAEGVVAALVKDGQKVDQLKVGEAGAIVLNQTPFYAESGGQVGDTGVMTGEGV 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           R ++T+ QKKA  +FVH   VE+G L  + +L+L +D+  R  +  NHSATHLLH AL  
Sbjct: 517 RFRVTETQKKAHDLFVHLGTVEQGTLTPDTALLLEVDHTRRSSIRANHSATHLLHEALRQ 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG H++Q GS +  D LRFD  H KPI++ EL+ +ED  N+++ +N  V TR+M  +DA
Sbjct: 577 VLGDHIAQKGSLVAEDRLRFDFVHQKPISADELRRVEDIANEVVLENDEVTTRLMAVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSVE------YEDGGVHSSALCGGTHVSSTGEIMLLYIVSE 713
             +GA AL G KY D VRVV++         +    S  LCGGTHV  TG+I L+ I  E
Sbjct: 637 REAGARALFGEKYGDEVRVVTMGKSARQHGSNALGWSVELCGGTHVRRTGDIGLISITGE 696

Query: 714 SSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLI 773
           S++ +G+RRIEA+TG+ AR       +  K+ A+ L+ S  ++  RV  + +E +KL+  
Sbjct: 697 SAVASGVRRIEALTGRFARQSANAAIDTAKATAAELRTSVDDMPARVAALMDERKKLERE 756

Query: 774 HAKRKLQL---------NVEDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGI 824
            A+ + +L            +    ++  V  ++  +  ++ K+LKS++D  +K++ SG+
Sbjct: 757 LAEARKKLAMGGGGAAAANGEAGVREVGGVKLLARAVEGIEIKDLKSLVDQGKKQLGSGV 816

Query: 825 IMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNK 884
           I LV  S + K S+++ VT DL+ RF+AVDL R +++VLGG GGGG+P MAQ+GGP+G+K
Sbjct: 817 IALVATSADGKGSIVVGVTPDLVARFSAVDLVRKASEVLGGKGGGGKPDMAQAGGPDGSK 876

Query: 885 ADQAIAGVASFL 896
           A  A+  +A  +
Sbjct: 877 AQAALDAIAEAI 888


>gi|303249632|ref|ZP_07335837.1| alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|307252204|ref|ZP_07534102.1| Alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|302651444|gb|EFL81595.1| alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|306860348|gb|EFM92363.1| Alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
          Length = 874

 Score =  928 bits (2397), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/912 (41%), Positives = 544/912 (59%), Gaps = 56/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   S IR +FL+FF   GH ++PSSSL+P NDPTL+FTN+GM  FK++F G EK  Y  
Sbjct: 1   MKTTSEIRQSFLDFFHSKGHTVVPSSSLVPENDPTLLFTNAGMNQFKDVFLGLEKRPYTR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEM+GNFSFG YFK  AIQ  W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKHDAIQFGWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +LY+TVY+ D+EA+ +W KI G+  D IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLYVTVYETDDEAYDIWNKIVGVPTDHIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D GE   GGLPGS  E+G+RYIE+WN+VFMQF +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGETFWGGLPGSPEEDGDRYIEVWNIVFMQFNRLADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ERM  V+Q   +NY+ D+F+ LI+    +  +     +  + RV+ DH+R+ S+LIADG+
Sbjct: 241 ERMTAVMQHVNSNYETDIFQTLIKEVAGLLNVSD--LDNKSLRVVADHIRACSYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L T MG A   L Q +  I++T
Sbjct: 299 VPSNEGRGYVLRRIIRRAVRHGNLLGAKEAFFYKLVPTLATVMGHAGEVLTQKQAHIQKT 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           L++E+E+F +TL+RGL LL+  L+ +  +  L+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LKAEEEQFARTLERGLALLEDALTKVE-NNTLSGEVAFKLYDTYGFPLDLTADVCREREI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F   +  QR RA+A S           + ++ +  G T FIGYD L       
Sbjct: 418 T-IDEAGFEAEMTAQRERAKASSNFG------ADYNNVIKVEGQTDFIGYDNL------- 463

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + +  +   G+ V+   SG+   ++ DQTPFYAE GGQ+GD
Sbjct: 464 ----------------AAQATIVGLFSNGKAVDTIQSGESAVIILDQTPFYAEMGGQVGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G    +     + D QK    +F H   +  G L     +  T+D   R  ++ NHSAT
Sbjct: 508 SGLISTEICNFAVNDTQKYG-QVFGHIGQLTSGSLSIGDKVTATVDATRRVAITANHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++ + LRFD +  + I+ ++L+ IE  VN  I +N+ V 
Sbjct: 567 HLLHSALREVLGDHVAQKGSLVSENILRFDFSQPEAISKSQLEEIERIVNRKIRENIQVT 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
              M+ E A   GA AL G KY D VRVV +        S  LCGGTHV  TG+I L  +
Sbjct: 627 IETMDIESAKKKGAMALFGEKYGDVVRVVGMTE-----FSIELCGGTHVQRTGDIGLFKL 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           VSE ++ AGIRR+EA+T + A   L  Q + L+  A FLK    ++V +++++ ++ ++ 
Sbjct: 682 VSEGAVAAGIRRVEAVTAETAIEWLHNQQKVLQQSAEFLKADSNSLVEKIQQLQDKAKRT 741

Query: 771 QLIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +    + K +L  +  S      +KI  VN +   +  V+ K L++++D L+ +++S I+
Sbjct: 742 EKELQQLKDKLAAQAGSELVKQANKINGVNVVVQKLENVEVKSLRTMVDDLKNQLESAIV 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +  G   ++K ++++ VT+DL  + NA +L    A+ + GG GGGR  MA +GG      
Sbjct: 802 V-FGTVADEKVNLIVGVTKDLSSKVNAGELVGAMAQQV-GGKGGGRADMAMAGGSEPQNL 859

Query: 886 DQAIAGVASFLK 897
           D A+     +++
Sbjct: 860 DNALKFAEEWIQ 871


>gi|91784488|ref|YP_559694.1| alanyl-tRNA synthetase [Burkholderia xenovorans LB400]
 gi|122970272|sp|Q13W97|SYA_BURXL RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|91688442|gb|ABE31642.1| alanyl-tRNA synthetase [Burkholderia xenovorans LB400]
          Length = 874

 Score =  928 bits (2397), Expect = 0.0,   Method: Composition-based stats.
 Identities = 377/911 (41%), Positives = 540/911 (59%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAESRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTGVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA  +W K  G+  ++IIRI  N       DNFW MA+TGPCGPCSE
Sbjct: 121 KDKLWVTVYHEDDEAHDIWAKEVGVPVERIIRIGDNKGARYASDNFWQMADTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTPLPKQCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+A+ + TG+    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQALIKAAARETGVSDLTNN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        ++  L  +MG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGKKGSFFHRMVADLVAQMGAAYPELKEAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLG--KDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+G L+ L     + L+G++AFKL+DT+G PLD+  D+   R + 
Sbjct: 359 EEERFFETIEHGMSILEGALAELEAGSSKTLDGELAFKLHDTYGFPLDLTADVCREREVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F++A+  QR +ARA      +         L+     T F GYD +        
Sbjct: 419 -VDEAAFDEAMTRQREQARAAGKFKMAQG-------LEYSGEKTTFHGYDEVVFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+  +G  V++A  GQ+  VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVIALYVEGASVQQASQGQQAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G      +R  ++D  K    +  HH  +E+G L+    +   ID   R + + NHSATH
Sbjct: 509 GVLANASVRFAVSDTLKVQADVVGHHGTLEQGTLKVGDVVKAEIDAVRRARTARNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS +  D  RFD  H+ P+T  +++ +E+ VN  +  N P + 
Sbjct: 569 LMHKALREVLGTHVQQKGSLVDADKTRFDFAHNAPLTDEQIRRVEEIVNAEVLANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M+ ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 629 RVMSFDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A   +   D ++ + A+ LK     +  R+ ++ ++ + L+
Sbjct: 683 MEGGVAAGIRRVEAITGDNAVRFVQDLDARINAAAAVLKAQPSELTQRIVQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
              +  K ++             ++  V+ ++  +   D K L+  +D L+ K++S  I+
Sbjct: 743 KELSALKSKMASSQGDELAGQAIEVGGVHVLAATLEGADVKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LASV-EGGKVSLIAGVTADASRKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLK 897
            A+AGV  +++
Sbjct: 861 AALAGVKGWVE 871


>gi|261867354|ref|YP_003255276.1| alanyl-tRNA synthetase [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412686|gb|ACX82057.1| alanyl-tRNA synthetase [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 874

 Score =  928 bits (2397), Expect = 0.0,   Method: Composition-based stats.
 Identities = 386/912 (42%), Positives = 554/912 (60%), Gaps = 56/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR ++L+FF   GH+++ SSSL+P NDPTL+FTN+GM  FKN+F G EK  Y  
Sbjct: 1   MKTTAQIRQSYLDFFHSKGHQVVASSSLVPENDPTLLFTNAGMNQFKNVFLGLEKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI   W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAIHFGWEFLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + RL++TVY+ DEEA+K+W    G+ A++IIRI  N       DNFW M +TGPCGP
Sbjct: 121 GLPKERLWVTVYETDEEAYKIWHDEIGIVAERIIRIGDNKGAPYASDNFWQMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRHADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NYDID+F+ LI  + ++TG K       + RVI DH+RS ++LI DG+
Sbjct: 241 ERISAVLQHVNSNYDIDIFQKLIAKTAELTGEKD--LTNKSLRVIADHIRSCAYLIVDGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  E+ + +  +E+ 
Sbjct: 299 VPSNEGRGYVLRRIIRRAVRHGHLLGAAEAFFYKLVPTLIEVMAQAGEEVKKHQATVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  L+ +   ++L+G+VAFKLYDT+G PLD+  D+   RG+
Sbjct: 359 LRLEEEQFARTLERGLTLLDEALAEVK-GKVLSGEVAFKLYDTYGFPLDLTADVCRERGI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F + +E QR RA++ S           + ++    G T+F GY          
Sbjct: 418 T-IDEAGFEREMENQRLRAQSASQFGM------DYNNVIRVDGITRFEGYTESETL---- 466

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + V A+   G+ V+   SGQ   V+ D TPFYAE+GGQ+GD
Sbjct: 467 -------------------AKVTALFHDGKPVDTISSGQSAVVILDNTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
            G   G+G    + D QK    +F H   + +G L    S+   +D   R+++S+NHSAT
Sbjct: 508 IGRLEGNGFNFDVKDTQKYG-QVFGHIGELTQGSLSVGQSVNAVVDEVRRQRISLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++   LRFD    +PI+ A+L  +E  VN  +  N P+ 
Sbjct: 567 HLLHAALRQVLGEHVAQKGSLVSDALLRFDFAQHEPISKAQLAEVERIVNQQVRANNPIK 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM  E A A GA AL G KY+D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMELEAAKAKGAMALFGEKYSDQVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           V+E+++ AGIRRIEAITG+ A   L  Q   L   A  LK    ++  ++  + ++++K+
Sbjct: 682 VTETAVAAGIRRIEAITGETAIEWLQNQQSLLNQSAELLKSDVNSITDKISLLQDKFKKV 741

Query: 771 QLIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI  V+ ++  +  +++K L+S++D+L+ ++ S +I
Sbjct: 742 EKELQTLKEKAALQAGNDLAQSAVKINGVSVIAQQLDGIEAKSLRSMVDSLKNQLGSAVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +   +  ++K ++++ VT+DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 VFASVV-DEKVNLIVGVTQDLTGKVKAGELVNLMAQQV-GGKGGGRPDMAMAGGTQPENV 859

Query: 886 DQAIAGVASFLK 897
           ++A++  + +LK
Sbjct: 860 NKALSVCSDWLK 871


>gi|152977739|ref|YP_001343368.1| alanyl-tRNA synthetase [Actinobacillus succinogenes 130Z]
 gi|205829971|sp|A6VKD6|SYA_ACTSZ RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|150839462|gb|ABR73433.1| alanyl-tRNA synthetase [Actinobacillus succinogenes 130Z]
          Length = 874

 Score =  928 bits (2397), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/912 (41%), Positives = 541/912 (59%), Gaps = 56/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEM+GNFSFG YFK  AI  AW+ LT  K  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKYDAINFAWEFLTSPKWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +LY+TVY+ D+EA+ +W K  G+  + IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 ALPKEKLYVTVYETDDEAYDIWNKEVGVPQEHIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GGLP    E+G+RYIEIWN+VFMQF +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGLPGTPEEDGDRYIEIWNIVFMQFNRLADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ERM  VLQ   +NY+ID+F+ LI+   ++ G    GN   + RVI DH+RS ++LIADG+
Sbjct: 241 ERMTAVLQHVNSNYEIDIFQTLIKKVAEIVGTTDLGNK--SLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  ++ + +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKETFFYKLVPTLIEVMAEAGKQVKEKQANVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL+LLD  L+++  + +L+G+VAFKLYDT+G PLD+  D+   R  
Sbjct: 359 LRLEEEQFARTLERGLILLDAELANVK-NGVLSGEVAFKLYDTYGFPLDLTADVCRERN- 416

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             +D   F++ +E QR RA++ S           + S+    G T+F GY  +       
Sbjct: 417 IAVDENGFDKEMEAQRLRAQSASNFGM------DYTSIIRVDGETKFEGYTNVESL---- 466

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + V A+ + G+ VE   +GQ   V+ + TPFYAE GGQ+GD
Sbjct: 467 -------------------AKVTALFRDGKAVESVSAGQSAVVILENTPFYAEMGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G    +G+   + D QK    +F H   + +G L     +   +D Q R+   +NHSAT
Sbjct: 508 SGMLTANGLHFDVKDTQKYG-QVFGHIGELTQGTLSVGQIVNAQVDAQRRQYTKLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++  GLRFD    + +T  ++  IE  VN  I  N PV+
Sbjct: 567 HLLHAALRQVLGEHVAQKGSLVSDVGLRFDFVQPEAVTKEQIMEIERLVNFHIRANHPVL 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T  M   +A + GA AL G KY + VRVV++        S  LCGG HV  TGEI LL I
Sbjct: 627 TEEMGVAEAKSKGAIALFGEKYGETVRVVTMSP-----FSIELCGGLHVERTGEIGLLKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           +SE ++ AGIRR+EA+TG+ A + L  Q   L   A  LK    ++  ++ ++ ++ +K 
Sbjct: 682 ISEGAVAAGIRRVEAVTGEEAINWLFNQQTILAQSADLLKSDIPSLPEKIIQLQDKVKKT 741

Query: 771 QLIHAKRKLQLNVE-----DLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +    + K +  ++       S  KI  V+ ++H +   D+K L+ ++D L+ ++ S +I
Sbjct: 742 EKELQQLKEKAAMQAGSDLAKSAVKINGVSVVTHQLDGADAKVLRVMVDDLKNQLGSAVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
            L   S   K +++  VT DL  +  A +L  + A+ + GG GGGRP MA +GG      
Sbjct: 802 ALGSAS-GGKVNLIAGVTADLTAKVKAGELVNVMAQQV-GGKGGGRPDMAMAGGSQPENL 859

Query: 886 DQAIAGVASFLK 897
             A+   + +LK
Sbjct: 860 SAALIVASDWLK 871


>gi|167582193|ref|ZP_02375067.1| alanyl-tRNA synthetase [Burkholderia thailandensis TXDOH]
          Length = 874

 Score =  927 bits (2396), Expect = 0.0,   Method: Composition-based stats.
 Identities = 380/912 (41%), Positives = 537/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTTVYKLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY +D+EA+ +W K  G+ A++IIRI  N       DNFW M +TGPCGPCSE
Sbjct: 121 ADKLWVTVYHDDDEAYDIWAKEVGVPAERIIRIGDNKGARYASDNFWQMGDTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+AS + TG+    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQQLIKASARETGVADLANN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG   P    L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGPFFHKLVADLVAEMGAAYPELKEAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLD--GVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+           + L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALADLDAAGGKTLDGELAFKLHDTYGFPLDLTADVCRERGVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYTGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+  +G  V E  +G+   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVEGASVGEVKAGESAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G+L+    +   ID   R + + NHSATH
Sbjct: 509 GVLANAATRFAVADTLKVQADVIGHHGELEQGVLKVGDVVRAEIDAARRARTARNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD  H+ P+T  E++ +E  VN+ +  N P + 
Sbjct: 569 LMHKALRDVLGSHVQQKGSLVDADKTRFDFAHNAPLTDDEIRRVEAIVNEQVLANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  +DA+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 629 RVMPYDDAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           +E  + AGIRR+EAITG  A  ++   D ++ + A+ LK     ++ R+ ++ ++ + L+
Sbjct: 683 AEGGVAAGIRRVEAITGDNAVRYVQALDARVNAAAAALKAQPSELIQRIGQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             ++  V+ ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSKLASSQGDELVQQAVEVGGVHVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LAAV-EGGKVSLIAGVTADASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLKK 898
            A+AGV  ++++
Sbjct: 861 AALAGVKGWVEE 872


>gi|301169533|emb|CBW29134.1| alanyl-tRNA synthetase [Haemophilus influenzae 10810]
          Length = 874

 Score =  927 bits (2396), Expect = 0.0,   Method: Composition-based stats.
 Identities = 387/913 (42%), Positives = 548/913 (60%), Gaps = 56/913 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAINFAWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDDEAYNIWNKDVGVPAERIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LP+ S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNVVFMQFNRLADGTMEKLPRPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+FK LI  + ++ G         + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFKTLIAKTAEIVGATD--LTNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  ++   +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKESFFYKLVPTLIDVMAEAGKDVKAKQTNVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  LS +  D IL+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LRLEEEQFARTLERGLSLLDEALSQVK-DGILSGEVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID  +F++ +E QR+RA+A S           + S+    G T+F GY  +       
Sbjct: 418 T-IDEQAFDREMEAQRTRAQAASQFG------VDYNSVIRVDGETKFEGYTEVES----- 465

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + + A+   G+ VE   +GQ   V+ + TPFYAE+GGQ+GD
Sbjct: 466 ------------------QAKITALFYDGKSVESIEAGQSAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G     G+   + D QK    +F H   + +G L+   S+   +D + R   S+NHSAT
Sbjct: 508 SGYLSAQGVTFNVKDTQKYG-QVFGHIGELTQGSLKVGQSVNAIVDAKRRHNTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  ILG HV Q GS ++   LRFD    + IT  +L  IE  VN  I  N PV 
Sbjct: 567 HLLHAALRQILGLHVVQKGSLVSDKALRFDFAQPEAITKEQLSEIETLVNQKIRANFPVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM+ + A A GA AL G KY D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMDIDSAKAKGAMALFGEKYGDKVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           ++E+++ AGIRRIEA+TGQ A   L  Q   L   A  LK     +V +++++ ++ +K+
Sbjct: 682 ITENAVAAGIRRIEAVTGQNAIDWLHNQQRILTQSADLLKSDVNTLVEKIQQLQDKTKKV 741

Query: 771 QLIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI  V+ ++  +  +++K L+ ++D L+ ++ SG+I
Sbjct: 742 EKELQGLKEKAAMQAGSDFVKSAVKINGVSVIAQQLDGIETKSLRVMVDDLKNQLGSGVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
               I  ++K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 AFASIL-DEKVNLVVGVTNDLTAKIKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQPENV 859

Query: 886 DQAIAGVASFLKK 898
            QAI     +L K
Sbjct: 860 TQAIKVAQDWLNK 872


>gi|295677107|ref|YP_003605631.1| alanyl-tRNA synthetase [Burkholderia sp. CCGE1002]
 gi|295436950|gb|ADG16120.1| alanyl-tRNA synthetase [Burkholderia sp. CCGE1002]
          Length = 874

 Score =  927 bits (2396), Expect = 0.0,   Method: Composition-based stats.
 Identities = 376/911 (41%), Positives = 535/911 (58%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 1   MKAADIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAESRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT+ + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTEVYKLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA  +W K  G+  ++IIRI  N       DNFW MA+TGPCGPCSE
Sbjct: 121 KDKLWVTVYQEDDEAHDIWAKEVGVPVERIIRIGDNKGARYASDNFWQMADTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTPLPKQCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LIQA+ + TG+    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQALIQAAGRETGVTDLTNN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  +MG AYPEL QA+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGKKGSFFHRLVADLVAQMGDAYPELAQAEKRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ L     + L+G++AFKL+DT+G PLD+  D+   R + 
Sbjct: 359 EEERFFETIEHGMSILEAALADLDAKGGKTLDGELAFKLHDTYGFPLDLTADVCREREVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKMAQG-------LEYSGAKTTFHGYEEIVFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V++  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVDGASVQQVQAGQPAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    +   ID   R + + NHSATH
Sbjct: 509 GVLANASTRFAVADTLKVQADVVGHHGTLEQGTLKVGDVVKAEIDAVRRARTARNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD  H+ P+T  +++ +E+ VN  +  N P + 
Sbjct: 569 LMHKALREVLGSHVQQKGSLVDADKTRFDFAHNAPMTDEQIRRVEEIVNAEVLANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M+ +DA+  GA AL G KY D VRV+ +        S  LCGGTHV+ +G+I    IV
Sbjct: 629 RLMSYDDAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVNRSGDIGFFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   + ++ + A+ LK     +  R+ ++ ++ + L+
Sbjct: 683 MEGGVAAGIRRVEAITGDNAVRYVQELEARVNAAAAVLKAQPAELTQRIGQVQDQVKALE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
              +  K ++             ++  V+ ++  +   D K L+  +D L+ K++S  I+
Sbjct: 743 KELSALKSKMASSQGDELAGQAIEVGGVHVLAATLEGADVKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LASV-EGGKVSLIAGVTADASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLK 897
            A+AGV  +++
Sbjct: 861 AALAGVKGWVE 871


>gi|307261112|ref|ZP_07542790.1| Alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 12
           str. 1096]
 gi|306869194|gb|EFN00993.1| Alanyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 12
           str. 1096]
          Length = 874

 Score =  927 bits (2395), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/912 (41%), Positives = 543/912 (59%), Gaps = 56/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   S IR +FL+FF   GH ++PSSSL+P NDPTL+FTN+GM  FK++F G EK  Y  
Sbjct: 1   MKTTSEIRQSFLDFFHSKGHTVVPSSSLVPENDPTLLFTNAGMNQFKDVFLGLEKRPYTR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEM+GNFSFG YFK  AIQ  W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKHDAIQFGWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +LY+TVY+ D+EA+ +W KI G+  D IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLYVTVYETDDEAYDIWNKIVGVPTDHIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D GE   GGLPGS  E+G+RYIE+WN+VFMQF +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGETFWGGLPGSPEEDGDRYIEVWNIVFMQFNRLADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ERM  V+Q   +NY+ D+F+ LI+    +  +     +  + RV+ DH+R+ S+LIADG+
Sbjct: 241 ERMTAVMQHVNSNYETDIFQTLIKEVAGLLNVSD--LDNKSLRVVADHIRACSYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NE RGYVLRRI+RRA+ +  LLG  E     L+P L T MG A   L Q +  I++T
Sbjct: 299 VPSNESRGYVLRRIIRRAVRHGNLLGAKEAFFYKLVPTLATVMGHAGEVLTQKQAHIQKT 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           L++E+E+F +TL+RGL LL+  L+ +  +  L+G+VAFKLYDT+G PLD+  D+   R L
Sbjct: 359 LKAEEEQFARTLERGLALLEDALTKVE-NNTLSGEVAFKLYDTYGFPLDLTADVCREREL 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F   +  QR RA+A S           + ++ +  G T FIGYD L       
Sbjct: 418 T-IDEAGFEAEMTAQRERAKASSNFG------TDYNNVIKVEGQTDFIGYDNLE------ 464

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + +  +   G+ V+   SG+   ++ DQTPFYAE GGQ+GD
Sbjct: 465 -----------------AQATIVGLFSNGKAVDTIQSGESAVIILDQTPFYAEMGGQVGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G    +     + D QK    +F H   +  G L     +  T+D   R  ++ NHSAT
Sbjct: 508 SGLISTEICNFAVNDTQKYG-QVFGHIGQLTSGSLSIGDKVTATVDATRRVAITANHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++ + LRFD +  + I+ ++L+ IE  VN  I +N+ V 
Sbjct: 567 HLLHSALREVLGDHVAQKGSLVSENILRFDFSQPEAISKSQLEEIERIVNRKIRENIQVT 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
              M+ E A   GA AL G KY D VRVV +        S  LCGGTHV  TG+I L  +
Sbjct: 627 IETMDIESAKKKGAMALFGEKYGDVVRVVGMTE-----FSIELCGGTHVQRTGDIGLFKL 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           VSE ++ AGIRR+EA+T + A   L  Q + L+  A FLK    ++V +++++ ++ ++ 
Sbjct: 682 VSEGAVAAGIRRVEAVTAETAIEWLHNQQKVLQQSAEFLKADSNSLVEKIQQLQDKAKRT 741

Query: 771 QLIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +    + K +L  +  S      +KI  VN +   +  V+ K L++++D L+ +++S I+
Sbjct: 742 EKELQQLKDKLAAQAGSELVKQANKINGVNVVVQKLENVEVKSLRTMVDDLKNQLESAIV 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +  G   ++K ++++ VT+DL  + NA +L    A+ + GG GGGR  MA +GG      
Sbjct: 802 V-FGTVADEKVNLIVGVTKDLSSKVNAGELVGAMAQQV-GGKGGGRADMAMAGGSEPQNL 859

Query: 886 DQAIAGVASFLK 897
           D A+     +++
Sbjct: 860 DNALKFAEEWIQ 871


>gi|145636626|ref|ZP_01792293.1| alanyl-tRNA synthetase [Haemophilus influenzae PittHH]
 gi|145270152|gb|EDK10088.1| alanyl-tRNA synthetase [Haemophilus influenzae PittHH]
          Length = 874

 Score =  927 bits (2395), Expect = 0.0,   Method: Composition-based stats.
 Identities = 386/913 (42%), Positives = 549/913 (60%), Gaps = 56/913 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAINFAWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDDEAYNIWNKDVGVPAERIIRIGDNKGSPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LP+ S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNVVFMQFNRLADGTMEKLPRPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+FK LI  + ++ G         + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFKTLIAKTAEIVGATD--LTNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  ++   +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKESFFYKLVPTLIEVMAEAGKDVKAKQTNVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  L+ +  D +L+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LRLEEEQFARTLERGLSLLDEALAQVK-DGVLSGEVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID  +F++ +E QR+RA+A S           + S+    G T+F GY  +       
Sbjct: 418 T-IDEQAFDREMEAQRTRAQAASQFG------VDYNSVIRVDGETKFEGYTEVES----- 465

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + + A+   G+ VE   +GQ   V+ + TPFYAE+GGQ+GD
Sbjct: 466 ------------------QAKITALFYDGKSVESIEAGQSAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G     G+   + D QK    +F H   + +G L+   S+   +D + R   S+NHSAT
Sbjct: 508 SGYLSAQGVTFNVKDTQKYG-QVFGHIGELTQGSLKVGQSVNAIVDAKRRHNTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  ILG HV Q GS ++   LRFD    + IT  +L  IE  VN  I  N PV 
Sbjct: 567 HLLHAALRQILGLHVVQKGSLVSDKALRFDFAQPEAITKEQLSEIETLVNQKIRANFPVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM+ + A A GA AL G KY D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMDIDSAKAKGAMALFGEKYGDKVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           ++E+++ AGIRRIEA+TGQ A   L  Q   L   A  LK     +V +++++ ++ +K+
Sbjct: 682 ITENAVAAGIRRIEAVTGQNAIDWLHNQQRILTQSADLLKSDVNTLVEKIQQLQDKTKKV 741

Query: 771 QLIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI DV+ ++  +  +++K L+ ++D L+ ++ SG+I
Sbjct: 742 EKELQGLKEKAAMQTGSDFVKSAVKINDVSVIAQQLDGIETKSLRVMVDDLKNQLGSGVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
               I  ++K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 AFASIL-DEKVNLVVGVTNDLTAKIKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQPENV 859

Query: 886 DQAIAGVASFLKK 898
            QAI     +L K
Sbjct: 860 AQAIKVAQDWLNK 872


>gi|23016227|ref|ZP_00055985.1| COG0013: Alanyl-tRNA synthetase [Magnetospirillum magnetotacticum
           MS-1]
          Length = 877

 Score =  927 bits (2395), Expect = 0.0,   Method: Composition-based stats.
 Identities = 443/902 (49%), Positives = 594/902 (65%), Gaps = 36/902 (3%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR TFL+FF+KNGH ++ SS L+P NDPTLMFTN+GMV FKN+FTG EK  Y  
Sbjct: 4   MQTANEIRRTFLDFFEKNGHTVVNSSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRDYVR 63

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             T QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK++AI+ AW+L+TK+F +
Sbjct: 64  AATSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKDQAIEHAWNLITKDFGI 123

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
           D+ RL +TVY +D++A   WKKI+GL   +IIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 124 DKNRLLVTVYHDDDQAADAWKKIAGLPESRIIRIPTSDNFWAMGDTGPCGPCSEIFYDHG 183

Query: 181 ECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + IPGG P    ++G+R+IEIWNLVFMQFEQ +K+ R  LPK SIDTGMGLER+A +LQ 
Sbjct: 184 DHIPGGPPGSPDQDGDRFIEIWNLVFMQFEQVDKETRVPLPKPSIDTGMGLERLAALLQG 243

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           K +NYD+DL + LI+AS + +    +G + V+HRV+ DHLRSSSFLIADG+LP+NEGRGY
Sbjct: 244 KHDNYDVDLLRALIEASAESSNTDADGPHKVSHRVVADHLRSSSFLIADGVLPSNEGRGY 303

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A L+G +EPL+  L+PAL  +MG AYPEL++A  LI ETL+ E+ RF 
Sbjct: 304 VLRRIMRRAMRHAHLMGCSEPLLWKLVPALTRQMGEAYPELVRANALITETLKLEETRFK 363

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
            TLD+GL LLD  ++ +G    L G+VAFKLYDT+G PLD+ QD L A+G  G+D   F 
Sbjct: 364 VTLDKGLKLLDDEITRIGSAGKLAGEVAFKLYDTYGFPLDLTQDALKAKG-IGVDTDGFA 422

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E QR+ AR    G G   TE +WF L+EK GA++F+GYD                  
Sbjct: 423 SAMERQRAEARKAWAGSGDTATETVWFELREKLGASEFLGYD------------------ 464

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAI--GD 537
                       + A+V+ G++VE    G  V V+ +QTPFY E+GGQ+GDTG     G 
Sbjct: 465 -----AEQAEGKIVALVENGKVVEAVHPGHSVAVIANQTPFYGESGGQMGDTGIITVAGG 519

Query: 538 GIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHAL 597
              + +TD QKK   + VH   VE G +         +D   R     +HSATHLLH  L
Sbjct: 520 KATITVTDTQKKLGDLVVHFGTVEGGPVAVGEDAHFAVDSSRRDATRGHHSATHLLHAVL 579

Query: 598 STILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNRE 657
             ILG HV+Q GS + PD LRFD  H+K ++  E +++E  VN  I  N  V T +M  +
Sbjct: 580 RGILGDHVTQKGSQVGPDRLRFDFAHTKALSPEESRAVEAEVNRRIRVNAEVATTVMTPD 639

Query: 658 DAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIR 717
           DAI +GA AL G KY + VRVVS+     G  S+ LCGGTH   TG+I    IV+ES++ 
Sbjct: 640 DAIKAGAMALFGEKYGEEVRVVSM-----GDLSTELCGGTHARRTGDIGGFKIVAESAVA 694

Query: 718 AGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKR 777
           +G+RRIEA+TG    +    Q++ L   A  LK +  ++  R+  + +E RKL+   A+ 
Sbjct: 695 SGVRRIEAVTGPAFLAWAQAQEDLLARAADTLKAAPTDLPARIAGLMDERRKLERELAEV 754

Query: 778 KLQLNV---EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEK 834
           + QL     +  +   +  + +   +++ V  K+LK + D ++K+I SG+I+LV    + 
Sbjct: 755 RKQLATGGGQGAATKTVNGITYAGKVLNGVPPKDLKGMADEIKKQIGSGVIVLVS-DADG 813

Query: 835 KASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVAS 894
           KAS+++ VTEDL  +++AVDL R+ ++ LGG GGGGRP MAQ+GGP+ + A  A+  +  
Sbjct: 814 KASIVVCVTEDLTAKYSAVDLVRIGSEALGGKGGGGRPDMAQAGGPDASAAQAAVDKIEQ 873

Query: 895 FL 896
            L
Sbjct: 874 AL 875


>gi|68249409|ref|YP_248521.1| alanyl-tRNA synthetase [Haemophilus influenzae 86-028NP]
 gi|81336165|sp|Q4QM86|SYA_HAEI8 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|68057608|gb|AAX87861.1| alanyl-tRNA synthetase [Haemophilus influenzae 86-028NP]
          Length = 874

 Score =  927 bits (2395), Expect = 0.0,   Method: Composition-based stats.
 Identities = 387/913 (42%), Positives = 547/913 (59%), Gaps = 56/913 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAINFAWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDDEAYNIWNKDVGVPAERIIRIGDNKGSPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LP+ S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNVVFMQFNRLADGTMEKLPRPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+FK LI  + ++ G         + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFKTLIAKTAEIVGATD--LTNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  ++   +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKESFFYKLVPTLIEVMAEAGKDVKAKQTNVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  LS +  D IL+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LRLEEEQFARTLERGLSLLDEALSQVK-DGILSGEVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID  +F++ +E QR+RA+A S           + S+    G T+F GY  +       
Sbjct: 418 T-IDEQAFDREMEAQRTRAQAASQFG------VDYNSVIRVDGETKFEGYTEVES----- 465

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + + A+   G+ VE    GQ   V+ + TPFYAE+GGQ+GD
Sbjct: 466 ------------------QAKITALFYDGKSVESIEVGQSAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G     G+   + D QK    +F H   + +G L+   S+   +D + R   S+NHSAT
Sbjct: 508 SGYLSTQGVTFNVKDTQKYG-QVFGHIGELTQGSLKVGQSVNAIVDAKRRHNTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  ILG HV Q GS ++   LRFD    + IT  +L  IE  VN  I  N PV 
Sbjct: 567 HLLHAALRQILGLHVVQKGSLVSDKALRFDFAQPEAITKEQLSEIETLVNQKIRANFPVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM+ + A A GA AL G KY D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMDIDSAKAKGAMALFGEKYGDKVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           ++E+++ AGIRRIEA+TGQ A   L  Q   L   A  LK     +V +++++ ++ +K+
Sbjct: 682 ITENAVAAGIRRIEAVTGQNAIDWLHNQQRILTQSADLLKSDVNTLVEKIQQLQDKTKKV 741

Query: 771 QLIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI  V+ ++  +  +++K L+ ++D L+ ++ SG+I
Sbjct: 742 EKELQGLKEKAAMQAGSDFVKSAVKINGVSVIAQQLDGIETKSLRVMVDDLKNQLGSGVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
               I  ++K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 AFASIL-DEKVNLVVGVTNDLTAKIKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQPENV 859

Query: 886 DQAIAGVASFLKK 898
            QAI     +L K
Sbjct: 860 AQAIKVAQDWLNK 872


>gi|319775253|ref|YP_004137741.1| alanyl-tRNA synthetase [Haemophilus influenzae F3047]
 gi|317449844|emb|CBY86053.1| alanyl-tRNA synthetase [Haemophilus influenzae F3047]
          Length = 874

 Score =  927 bits (2395), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/913 (42%), Positives = 545/913 (59%), Gaps = 56/913 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAINFAWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDDEAYNIWNKDVGVPAERIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G  I GG PGS  E+G+RYIEIWN+VFMQF +        LP+ S+DTGMGL
Sbjct: 181 CTEIFYDHGNHIWGGPPGSPEEDGDRYIEIWNVVFMQFNRLADGTMEKLPRPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+FK LI  + ++ G         + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFKTLIAKTAEIVGATD--LTNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  ++   +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKESFFYKLVPTLIDVMAEAGKDVKAKQTNVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  LS +  D IL+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LRLEEEQFARTLERGLSLLDEALSQVK-DGILSGEVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID  +F++ +E QR+RA++ S           + S+    G T+F GY  +       
Sbjct: 418 T-IDEQAFDRKMEAQRTRAQSASQFG------VDYNSVIRVDGETKFEGYTEVES----- 465

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + + A+   G+ VE   +GQ   V+ + TPFYAE+GGQ+GD
Sbjct: 466 ------------------QAKITALFYDGKSVESIEAGQSAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G      +   + D QK    +F H   + +G L+   S+   +D + R   S+NHSAT
Sbjct: 508 SGYLSTQSVTFNVKDTQKYG-QVFGHIGELTQGSLKVGQSVNAIVDAKRRHNTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  ILG HV Q GS ++   LRFD    + IT  +L  IE  VN  I  N PV 
Sbjct: 567 HLLHAALRQILGLHVVQKGSLVSDKALRFDFAQPEAITKEQLSEIETLVNQKIRANFPVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM+ + A A GA AL G KY D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMDIDSAKAKGAMALFGEKYGDKVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           ++E+++ AGIRRIEA+TGQ A   L  Q   L   A  LK     +  +++++ ++ +K+
Sbjct: 682 ITENAVAAGIRRIEAVTGQNAIDWLHNQQRILTQSADLLKSDVNTLAEKIQQLQDKAKKV 741

Query: 771 QLIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI  V+ ++  +  +++K L+ ++D L+ ++ SG+I
Sbjct: 742 EKELQGLKEKAAMQAGSDFVKSAVKINGVSVIAQQLDGIETKSLRVMVDDLKNQLGSGVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
               I  ++K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 AFASIL-DEKVNLVVGVTNDLTAKIKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQPENV 859

Query: 886 DQAIAGVASFLKK 898
            QAI     +L K
Sbjct: 860 AQAIKVAQDWLNK 872


>gi|329122821|ref|ZP_08251393.1| alanine--tRNA ligase [Haemophilus aegyptius ATCC 11116]
 gi|327472085|gb|EGF17523.1| alanine--tRNA ligase [Haemophilus aegyptius ATCC 11116]
          Length = 874

 Score =  927 bits (2395), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/913 (42%), Positives = 545/913 (59%), Gaps = 56/913 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKNDAINFAWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDDEAYNIWNKDVGVPAERIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LP+ S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNVVFMQFNRLADGTMEKLPRPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+FK LI  + ++ G         + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFKTLIAKTAEIVGATD--LTNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  ++   +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKESFFYKLVPTLIDVMAEAGKDVKAKQTNVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  LS +  D IL+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LRLEEEQFARTLERGLSLLDEALSQVK-DGILSGEVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             I+  +F++ +E QR+RA+A S           + S+    G T+F GY  +       
Sbjct: 418 T-INEQAFDRKMEAQRTRAQAASQFG------VDYNSVIRVDGETKFEGYTEVES----- 465

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + + A+   G+ VE   +GQ   V+ + TPFYAE+GGQ+GD
Sbjct: 466 ------------------QAKITALFYDGKSVESIEAGQSAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G      +   + D QK    +F H   + +G L+   S+   +D + R   S+NHSAT
Sbjct: 508 SGYLSTQSVTFNVKDTQKYG-QVFGHIGELTQGSLKVGQSVNAIVDAKRRHNTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  ILG HV Q GS ++   LRFD    + IT  +L  IE  VN  I  N PV 
Sbjct: 567 HLLHAALRQILGLHVVQKGSLVSDKALRFDFAQPEAITKEQLSEIETLVNQKIRANFPVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM+ + A A GA AL G KY D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMDIDSAKAKGAMALFGEKYGDKVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           ++E+++ AGIRRIEA+TGQ A   L  Q   L   A  LK     +  +++++ ++ +K+
Sbjct: 682 ITENAVAAGIRRIEAVTGQNAIDWLHNQQRILTQSADLLKSDVNTLAEKIQQLQDKAKKV 741

Query: 771 QLIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI  V+ ++  +  +++K L+ ++D L+ ++ SG+I
Sbjct: 742 EKELQGLKEKAAMQAGSDFVKSAVKINGVSVIAQQLDGIETKSLRVMVDDLKNQLGSGVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
               I  ++K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 AFASIL-DEKVNLVVGVTNDLTAKIKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQPENV 859

Query: 886 DQAIAGVASFLKK 898
            QAI     +L K
Sbjct: 860 AQAIKVAQDWLNK 872


>gi|293390902|ref|ZP_06635236.1| alanyl-tRNA synthetase [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290951436|gb|EFE01555.1| alanyl-tRNA synthetase [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 874

 Score =  927 bits (2395), Expect = 0.0,   Method: Composition-based stats.
 Identities = 386/912 (42%), Positives = 555/912 (60%), Gaps = 56/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR ++L+FF   GH+++ SSSL+P NDPTL+FTN+GM  FKN+F G EK  Y  
Sbjct: 1   MKTTAQIRQSYLDFFHSKGHQVVASSSLVPENDPTLLFTNAGMNQFKNVFLGLEKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI   W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAIHFGWEFLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + RL++TVY+ DEEA+K+W    G++A++IIRI  N       DNFW M +TGPCGP
Sbjct: 121 GLPKERLWVTVYETDEEAYKIWHDEIGIAAERIIRIGDNKGAPYASDNFWQMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRHADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NYDID+F+ LI  + ++TG K       + RVI DH+RS ++LI DG+
Sbjct: 241 ERISAVLQHVNSNYDIDIFQKLIAKTAELTGEKD--LTNKSLRVIADHIRSCAYLIVDGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG TE     L+P L   M  A  E+ + +  +E+ 
Sbjct: 299 VPSNEGRGYVLRRIIRRAVRHGHLLGATEAFFYKLVPTLIEVMAQAGEEVKKHQATVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  L+ +   ++L+G+VAFKLYDT+G PLD+  D+   RG+
Sbjct: 359 LRLEEEQFARTLERGLTLLDEALAEVK-GKVLSGEVAFKLYDTYGFPLDLTADVCRERGI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F + +E QR RA++ S           + ++    G T+F GY          
Sbjct: 418 T-IDEAGFEREMENQRLRAQSASQFGM------DYNNVIHVDGITRFEGYTESETL---- 466

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + V A+   G+ V+   +GQ   V+ D TPFYAE+GGQ+GD
Sbjct: 467 -------------------AKVTALFHDGKPVDTISAGQSAVVILDNTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
            G   G+G    + D QK    +F H   + +G L    S+   +D   R+ +S+NHSAT
Sbjct: 508 IGRLEGNGFNFDVKDTQKYG-QVFGHIGELTQGSLSVGQSVNAVVDEVRRQHISLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++   LRFD    +PI+ A+L  +E  VN  +  N P+ 
Sbjct: 567 HLLHAALRQVLGEHVAQKGSLVSDALLRFDFAQHEPISKAQLAEVERIVNQQVRANNPIK 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM  E A A GA AL G KY+D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMELEAAKAKGAMALFGEKYSDQVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           V+E+++ AGIRRIEAITG+ A   L  Q   L   A  LK    ++  ++  + ++++K+
Sbjct: 682 VTETAVAAGIRRIEAITGETAIEWLQNQQSLLNQSAELLKSDVNSITDKISLLQDKFKKV 741

Query: 771 QLIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI  V+ ++  +  +++K L+S++D+L+ ++ S +I
Sbjct: 742 EKELQTLKEKAALQAGNDLAQSAVKINGVSVIAQQLDGIEAKSLRSMVDSLKNQLGSAVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +   +  ++K ++++ VT+DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 IFASV-IDEKVNLIVGVTQDLTGKVKAGELVNLMAQQV-GGKGGGRPDMAMAGGTQPENV 859

Query: 886 DQAIAGVASFLK 897
           ++A++  + +LK
Sbjct: 860 NKALSVCSDWLK 871


>gi|145634774|ref|ZP_01790482.1| alanyl-tRNA synthetase [Haemophilus influenzae PittAA]
 gi|145267940|gb|EDK07936.1| alanyl-tRNA synthetase [Haemophilus influenzae PittAA]
          Length = 874

 Score =  926 bits (2394), Expect = 0.0,   Method: Composition-based stats.
 Identities = 388/913 (42%), Positives = 548/913 (60%), Gaps = 56/913 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAINFAWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDDEAYNIWNKDVGVPAERIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LP+ S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNVVFMQFNRLADGTMEKLPRPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+FK LI  + ++ G         + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFKTLIAKTAEIVGATD--LTNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  ++   +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKESFFYKLVPTLIDVMAEAGKDVKAKQTNVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  LS +  D IL+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LRLEEEQFARTLERGLSLLDEALSQVK-DGILSGEVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID  +F++ +E QR+RA+A S           + S+    G T+F GY  +       
Sbjct: 418 T-IDEQAFDREMESQRTRAQAASQFG------VDYNSVIRVDGETKFEGYTEVES----- 465

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + + A+   G+ VE   +GQ   V+ + TPFYAE+GGQ+GD
Sbjct: 466 ------------------QAKITALFYDGKSVESIEAGQSAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G   G G+   + D QK    +F H   + +G L+   S+   +D + R   S+NHSAT
Sbjct: 508 SGYLSGQGVTFNVKDTQKYG-QVFGHIGELTQGSLKVGQSVNAIVDAKRRHNTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  ILG HV Q GS ++   LRFD    + IT  +L  IE  VN  I  N PV 
Sbjct: 567 HLLHAALRQILGLHVVQKGSLVSDKALRFDFAQPEAITKEQLSEIETLVNQKIRANFPVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM+ + A A GA AL G KY D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMDIDSAKAKGAMALFGEKYGDKVRVLTM-----GDFSIELCGGIHAKHTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           ++E+++ AGIRRIEA+TGQ A   L  Q   L   A  LK     +V +++++ ++ +K+
Sbjct: 682 ITENAVAAGIRRIEAVTGQNAIDWLHNQQRILTQSADLLKSDVNTLVEKIQQLQDKTKKV 741

Query: 771 QLIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
                  K +  ++       S  KI  V+ ++  +  +++K L+ ++D L+ ++ SG+I
Sbjct: 742 DKELQALKEKAAMQAGSDFVKSAVKINGVSVIAQQLDGIETKSLRVMVDDLKNQLGSGVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
               I  ++K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 AFASIL-DEKVNLVVGVTNDLTAKIKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQPENV 859

Query: 886 DQAIAGVASFLKK 898
            QAI     +L K
Sbjct: 860 AQAIKVAQDWLNK 872


>gi|186476371|ref|YP_001857841.1| alanyl-tRNA synthetase [Burkholderia phymatum STM815]
 gi|205830006|sp|B2JK72|SYA_BURP8 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|184192830|gb|ACC70795.1| alanyl-tRNA synthetase [Burkholderia phymatum STM815]
          Length = 874

 Score =  926 bits (2394), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/911 (41%), Positives = 530/911 (58%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAESRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTGVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+ A++IIRI  N       DNFW MA+TGPCGPCSE
Sbjct: 121 KEKLWVTVYQEDDEAYDIWAKEVGVPAERIIRIGDNKGARYASDNFWQMADTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTPLPKQCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+A+ + T +    NN  + +V+ DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQALIKAAARETNIDDLSNN--SLKVVADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  +MG AYPEL  A+  +   LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGSFFHKLVADLVAQMGGAYPELKDAEQRVTHVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+G L+ L     + L+G+VAFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEGALADLDSKGGKTLDGEVAFKLHDTYGFPLDLTADVCRERGVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F++A+  QR +ARA      +   +            T F GY+ +        
Sbjct: 419 -VDEPAFDEAMARQREQARAAGKFKMAQGLD-------YTGAKTTFHGYEEIVFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V E   GQ+  VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------ARVTALYVDGASVNEVTKGQQAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G      IR  + D  K    +  HH  +E+G L+    +   ID   R + + NHSATH
Sbjct: 509 GVLANASIRFGVVDTLKVQADVVGHHGTLEQGTLKVGDVVKAEIDAVRRARTARNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG HV Q GS +  D  RFD  H+ P+T  +++ +E+ VN  +  N P + 
Sbjct: 569 LMHKALREVLGGHVQQKGSLVDADKTRFDFAHNAPMTDEQIRRVEEIVNAEVLANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHV+ TG+I L  IV
Sbjct: 629 RVMAYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVNRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A   +   D ++ + A+ LK     +  R+  + ++ + L+
Sbjct: 683 MEGGVAAGIRRVEAITGDNAVRFVQELDARIHAAAAALKAQPSELTQRISMVQDQVKALE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L              ++ V  ++  +   D K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSKLASSQGDELASQAIDVSGVQVLAATLEGADVKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LASV-EGGKVSLIAGVTADTSKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLK 897
            A+AGV  +++
Sbjct: 861 AALAGVKGWVE 871


>gi|294012144|ref|YP_003545604.1| alanyl-tRNA synthetase [Sphingobium japonicum UT26S]
 gi|292675474|dbj|BAI96992.1| alanyl-tRNA synthetase [Sphingobium japonicum UT26S]
          Length = 884

 Score =  926 bits (2393), Expect = 0.0,   Method: Composition-based stats.
 Identities = 436/904 (48%), Positives = 593/904 (65%), Gaps = 33/904 (3%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M++ + IR +FL++F  NGH ++PS+ L+P NDPTLMF N+GMVPFKN+FTG E   Y  
Sbjct: 1   MTSTNDIRRSFLDYFGANGHTIVPSAPLVPHNDPTLMFVNAGMVPFKNVFTGLESRPYST 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            T+ QK VRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE+AI  AW LLTKE+ L
Sbjct: 61  ATSSQKSVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEQAITHAWTLLTKEWGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
              +L  TVY  D+EAF LWKKI+GL  ++IIRI T DNFW+M ++GPCGPCSEIF+D G
Sbjct: 121 PAEKLTATVYHTDDEAFDLWKKIAGLPEERIIRIPTKDNFWAMGDSGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R++EIWNLVFMQ+EQ+  +    LPK SIDTGMGLER+A VLQ 
Sbjct: 181 DHIWGGPPGSPEEDGDRFVEIWNLVFMQYEQEANEIVSELPKPSIDTGMGLERIAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NYD D F+ LI+ S  +T    EG    +HRVI DHLRS+SFLIADG+LPANEGRGY
Sbjct: 241 VHDNYDTDTFRALIEESGALTKTATEGEFKASHRVIADHLRSTSFLIADGVLPANEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A ++G  EPLM  L+ +L +EMG AY EL++A+ LIEETL  E+ RF 
Sbjct: 301 VLRRIMRRAMRHAHIIGAKEPLMHRLVGSLVSEMGGAYQELVRAQPLIEETLLREETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           +TL++GL LLD     L +   L G+ AFKLYDT+G P D+ +D L +RGL G+D   F+
Sbjct: 361 QTLEKGLKLLDEATGDLSEGGTLPGETAFKLYDTYGFPYDLTEDALRSRGL-GVDREGFD 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
           +A+ EQ++ ARA   G G   +++IWF + EK G T+FIGY    G              
Sbjct: 420 KAMAEQKAAARAAWKGSGEKASDEIWFDIAEKTGNTEFIGYSSTEG-------------- 465

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                       V AIV+ G   + A +G+ V +V +QTPFY E+GGQ+GD G       
Sbjct: 466 ---------EGEVVAIVKDGVNFDSAAAGETVLIVTNQTPFYGESGGQMGDAGTISSQSG 516

Query: 540 RL-QITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALS 598
            +  + D  K    +  H A +  G ++   ++ L++D   R ++  NHSATHLLH AL 
Sbjct: 517 LVADVEDTAKPLGRLHAHRAKIGAGSVKVGDTVHLSVDVNRRDRIRANHSATHLLHAALR 576

Query: 599 TILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNRED 658
             LG+HV+Q GS + PD LRFD +H + +T  ++ +IE +VN+ +  N  V TR+M  +D
Sbjct: 577 NRLGAHVTQKGSLVAPDRLRFDFSHPEALTHGQIAAIEADVNEQVRHNEAVTTRLMTPDD 636

Query: 659 AIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRA 718
           AI +GA AL G KY D VRV+S+   D   +S  LCGGTHV +TG+I +  I+SES++ +
Sbjct: 637 AIQAGAMALFGEKYGDEVRVLSMGKGDAHSYSVELCGGTHVRATGDIAIFKIISESAVSS 696

Query: 719 GIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRK 778
           G+RRIEA+TG+ AR  L  ++++L+  A+ LK +   V  R+  + E+ RKL+   A+ K
Sbjct: 697 GVRRIEALTGEAARLWLSDREDRLRQSAAALKTTPEEVPARIAALVEQSRKLERELAEAK 756

Query: 779 LQLNVEDLSC------HKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISK 832
             L +            KI  VNF+  +I  +D KEL+ ++D  +  + SG+  ++ +  
Sbjct: 757 KALALGGGGSAQAAGPEKIGAVNFIGQVIEGLDPKELRGLVDQNKATLGSGVSAILAVV- 815

Query: 833 EKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGV 892
           + +A++ + VT+DL+   +AVDL R   + LGG GGGGRP MAQ GGP+G+KA+ A+  V
Sbjct: 816 DGRATIAVGVTDDLVGSISAVDLVRAGVEALGGKGGGGRPDMAQGGGPDGDKAEAALEAV 875

Query: 893 ASFL 896
            + L
Sbjct: 876 KAAL 879


>gi|330428621|gb|AEC19955.1| alanyl-tRNA synthetase [Pusillimonas sp. T7-7]
          Length = 873

 Score =  926 bits (2392), Expect = 0.0,   Method: Composition-based stats.
 Identities = 394/911 (43%), Positives = 542/911 (59%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              S IR  FL FF+  GH+++PSSSL+P NDPTL+FTNSGMV FK++FTG+E   Y   
Sbjct: 1   MKTSEIRQKFLSFFESKGHQVVPSSSLVPGNDPTLLFTNSGMVQFKDVFTGKETRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  + L 
Sbjct: 61  TSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIQNAWELLTTVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY ED+EA+ +W K  G+ A++I+RI  N       DNFW MA+TGPCGPCSE
Sbjct: 121 AEKLWVTVYQEDDEAYDIWAKEIGVPAERIVRIGDNKGARYASDNFWQMADTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQFE+       +LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPGVWGGPPGSPEEDGDRYIEIWNLVFMQFERDAAGNMPLLPKPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+A+ + TG+    NN  + +VI DH+R+ SFLI DG++P+
Sbjct: 241 AAVLQHVHSNYEIDLFQSLIKAAARETGISDLANN--SLKVIADHIRACSFLIVDGVIPS 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG +      L+  L  EMG AYPEL+  +  IE+ L+ 
Sbjct: 299 NEGRGYVLRRIVRRALRHGHKLGQSGVFFHRLVKDLVAEMGQAYPELVAQQARIEQVLKQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGI 413
           E+ERF +TL+ G+ +LD  L+ + +  +L+G   F LYDT+G P+D+  DI   R    +
Sbjct: 359 EEERFSETLENGMKILDAALAAVPEKGMLDGQTLFTLYDTYGFPVDLTADICRER-EVQV 417

Query: 414 DIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDR 473
           D+  F  A+  QR +ARA      +         L      T+F GYD L+         
Sbjct: 418 DMDGFEVAMNHQREQARAAGKFKAAEG-------LSYSGVETRFDGYDQLQS-------- 462

Query: 474 KVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGC 533
                             V A+   G  VE   +GQ+  VV D TPFYAE+GGQ+GD G 
Sbjct: 463 ---------------QGTVTALYIDGTQVESVSAGQQAIVVLDATPFYAESGGQVGDAGI 507

Query: 534 AIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLL 593
              +G R  + D QK    +F HH  +  G+L    ++   +D   R +   NHSATHL+
Sbjct: 508 LQANGARFAVADTQKIQNSVFGHHGEMLEGVLAVGDTVDAQVDKARRARTVRNHSATHLM 567

Query: 594 HHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRI 653
           H AL  +LGSHV Q GS + PD  RFD  H  P+T+ ++  +E  VN  +  N     ++
Sbjct: 568 HKALRQVLGSHVQQRGSLVDPDKTRFDFAHDAPMTADQIAQVERIVNAEVLNNHATQAQL 627

Query: 654 MNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSE 713
           M+ +DA+  GA AL G KY D VRV+ +        S  LCGGTHV+ TG+I L  IVSE
Sbjct: 628 MSYDDAVQGGAMALFGEKYGDTVRVLDIG------FSRELCGGTHVARTGDIGLFKIVSE 681

Query: 714 SSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLI 773
             + AG+RR+EAITG  A + +   ++ L   A  LK    ++V RV  +  + + L+  
Sbjct: 682 GGVAAGVRRVEAITGDNAVAWVQQINDTLVQAAGLLKTQPADLVERVALMQTQAKALERD 741

Query: 774 HAKRKLQLNVE---DLSCHKI---ADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
             + K +L      DL+   I    D   +   +S VD K L+ ++D L+ K++S +++L
Sbjct: 742 LDRLKSKLAASAGNDLASQAIVLRGDAKLLVASLSGVDPKALRGMIDQLKDKLKSAVVLL 801

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQ 887
             ++ + K S+   VT DL  +  A DL  + A  + GG GGGRP MA  GG +      
Sbjct: 802 AAVA-DDKISLAAGVTGDLASQVKAGDLVGMVAAQV-GGKGGGRPDMAMGGGTDVGALPA 859

Query: 888 AIAGVASFLKK 898
           A AGV +++++
Sbjct: 860 ATAGVEAWVRE 870


>gi|134282822|ref|ZP_01769525.1| alanyl-tRNA synthetase [Burkholderia pseudomallei 305]
 gi|134245908|gb|EBA45999.1| alanyl-tRNA synthetase [Burkholderia pseudomallei 305]
          Length = 874

 Score =  926 bits (2392), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/911 (42%), Positives = 538/911 (59%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTSVYKLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY +D+EA+ +W K  G+ A++IIRI  N       DNFW M +TGPCGPCSE
Sbjct: 121 ADKLWVTVYHDDDEAYDIWAKEVGVPAERIIRIGDNKGARYASDNFWQMGDTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+AS + TG+    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQQLIKASARETGVADLANN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG   P    L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKAPFFHKLVADLVAEMGAAYPELKEAEPRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ L     + L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALAELDAAGGKTLDGELAFKLHDTYGFPLDLTADVCRERGVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYTGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+  +G  V E  +G+   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVEGASVGEVKAGESAVVVLDHTPFYAESGGQVGDR 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    +   ID   R + + NHSATH
Sbjct: 509 GVLANAATRFAVGDTLKVQADVIGHHGELEQGTLKVGDVVRAEIDAARRARTARNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD  H+ P+T  E++ +E  VN+ +  N P + 
Sbjct: 569 LMHKALRDVLGSHVQQKGSLVDADKTRFDFAHNAPLTDDEIRRVEAIVNEQVLANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  +DA+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 629 RVMPYDDAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           +E  + AGIRR+EAITG  A  ++   D ++ + A+ LK     ++ R+ ++ ++ + L+
Sbjct: 683 AEGGVAAGIRRVEAITGDNAVRYVQALDARVNAAAAALKAQPSELLQRIGQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             ++  V+ ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSKLASSQGDELAQQAVEVGGVHVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +    K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG    K  
Sbjct: 803 LAAVD-GGKVSLIAGVTADASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPAKLP 860

Query: 887 QAIAGVASFLK 897
            A+AGV  +++
Sbjct: 861 AALAGVKGWVE 871


>gi|53719621|ref|YP_108607.1| alanyl-tRNA synthetase [Burkholderia pseudomallei K96243]
 gi|76812235|ref|YP_333216.1| alanyl-tRNA synthetase [Burkholderia pseudomallei 1710b]
 gi|121601160|ref|YP_992755.1| alanyl-tRNA synthetase [Burkholderia mallei SAVP1]
 gi|124386422|ref|YP_001026453.1| alanyl-tRNA synthetase [Burkholderia mallei NCTC 10229]
 gi|126449388|ref|YP_001080272.1| alanyl-tRNA synthetase [Burkholderia mallei NCTC 10247]
 gi|126451905|ref|YP_001065931.1| alanyl-tRNA synthetase [Burkholderia pseudomallei 1106a]
 gi|167001586|ref|ZP_02267381.1| alanine--tRNA ligase [Burkholderia mallei PRL-20]
 gi|167738941|ref|ZP_02411715.1| alanyl-tRNA synthetase [Burkholderia pseudomallei 14]
 gi|167816161|ref|ZP_02447841.1| alanyl-tRNA synthetase [Burkholderia pseudomallei 91]
 gi|167824533|ref|ZP_02456004.1| alanyl-tRNA synthetase [Burkholderia pseudomallei 9]
 gi|167846068|ref|ZP_02471576.1| alanyl-tRNA synthetase [Burkholderia pseudomallei B7210]
 gi|167894639|ref|ZP_02482041.1| alanyl-tRNA synthetase [Burkholderia pseudomallei 7894]
 gi|167903047|ref|ZP_02490252.1| alanyl-tRNA synthetase [Burkholderia pseudomallei NCTC 13177]
 gi|167911280|ref|ZP_02498371.1| alanyl-tRNA synthetase [Burkholderia pseudomallei 112]
 gi|167919300|ref|ZP_02506391.1| alanyl-tRNA synthetase [Burkholderia pseudomallei BCC215]
 gi|217423601|ref|ZP_03455102.1| alanine--tRNA ligase [Burkholderia pseudomallei 576]
 gi|226192959|ref|ZP_03788571.1| alanine--tRNA ligase [Burkholderia pseudomallei Pakistan 9]
 gi|242315165|ref|ZP_04814181.1| alanine--tRNA ligase [Burkholderia pseudomallei 1106b]
 gi|254180068|ref|ZP_04886667.1| alanyl-tRNA synthetase [Burkholderia pseudomallei 1655]
 gi|254188523|ref|ZP_04895034.1| alanyl-tRNA synthetase [Burkholderia pseudomallei Pasteur 52237]
 gi|254198350|ref|ZP_04904772.1| alanyl-tRNA synthetase [Burkholderia pseudomallei S13]
 gi|254261778|ref|ZP_04952832.1| alanine--tRNA ligase [Burkholderia pseudomallei 1710a]
 gi|254297905|ref|ZP_04965358.1| alanyl-tRNA synthetase [Burkholderia pseudomallei 406e]
 gi|254358720|ref|ZP_04974993.1| alanyl-tRNA synthetase [Burkholderia mallei 2002721280]
 gi|59798504|sp|Q63TF9|SYA_BURPS RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|123599400|sp|Q3JT87|SYA_BURP1 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|205830001|sp|A3MJ36|SYA_BURM7 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|205830002|sp|A2S3D4|SYA_BURM9 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|205830003|sp|A1V3F2|SYA_BURMS RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|205830004|sp|A3NUB0|SYA_BURP0 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|52210035|emb|CAH36008.1| alanyl-tRNA synthetase [Burkholderia pseudomallei K96243]
 gi|76581688|gb|ABA51163.1| alanyl-tRNA synthetase [Burkholderia pseudomallei 1710b]
 gi|121229970|gb|ABM52488.1| alanyl-tRNA synthetase [Burkholderia mallei SAVP1]
 gi|124294442|gb|ABN03711.1| alanine--tRNA ligase [Burkholderia mallei NCTC 10229]
 gi|126225547|gb|ABN89087.1| alanyl-tRNA synthetase [Burkholderia pseudomallei 1106a]
 gi|126242258|gb|ABO05351.1| alanine--tRNA ligase [Burkholderia mallei NCTC 10247]
 gi|148027847|gb|EDK85868.1| alanyl-tRNA synthetase [Burkholderia mallei 2002721280]
 gi|157807006|gb|EDO84176.1| alanyl-tRNA synthetase [Burkholderia pseudomallei 406e]
 gi|157936202|gb|EDO91872.1| alanyl-tRNA synthetase [Burkholderia pseudomallei Pasteur 52237]
 gi|169655091|gb|EDS87784.1| alanyl-tRNA synthetase [Burkholderia pseudomallei S13]
 gi|184210608|gb|EDU07651.1| alanyl-tRNA synthetase [Burkholderia pseudomallei 1655]
 gi|217393459|gb|EEC33480.1| alanine--tRNA ligase [Burkholderia pseudomallei 576]
 gi|225935049|gb|EEH31024.1| alanine--tRNA ligase [Burkholderia pseudomallei Pakistan 9]
 gi|242138404|gb|EES24806.1| alanine--tRNA ligase [Burkholderia pseudomallei 1106b]
 gi|243062691|gb|EES44877.1| alanine--tRNA ligase [Burkholderia mallei PRL-20]
 gi|254220467|gb|EET09851.1| alanine--tRNA ligase [Burkholderia pseudomallei 1710a]
          Length = 874

 Score =  926 bits (2392), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/911 (42%), Positives = 538/911 (59%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTSVYKLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY +D+EA+ +W K  G+ A++IIRI  N       DNFW M +TGPCGPCSE
Sbjct: 121 ADKLWVTVYHDDDEAYDIWAKEVGVPAERIIRIGDNKGARYASDNFWQMGDTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+AS + TG+    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQQLIKASARETGVADLANN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG   P    L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKAPFFHKLVADLVAEMGAAYPELKEAEPRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ L     + L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALAELDAAGGKTLDGELAFKLHDTYGFPLDLTADVCRERGVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYTGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+  +G  V E  +G+   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVEGASVGEVKAGESAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    +   ID   R + + NHSATH
Sbjct: 509 GVLANAATRFAVGDTLKVQADVIGHHGELEQGTLKVGDVVRAEIDAARRARTARNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD  H+ P+T  E++ +E  VN+ +  N P + 
Sbjct: 569 LMHKALRDVLGSHVQQKGSLVDADKTRFDFAHNAPLTDDEIRRVEAIVNEQVLANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  +DA+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 629 RVMPYDDAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           +E  + AGIRR+EAITG  A  ++   D ++ + A+ LK     ++ R+ ++ ++ + L+
Sbjct: 683 AEGGVAAGIRRVEAITGDNAVRYVQALDARVNAAAAALKAQPSELLQRIGQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             ++  V+ ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSKLASSQGDELAQQAVEVGGVHVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +    K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG    K  
Sbjct: 803 LAAVD-GGKVSLIAGVTADASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPAKLP 860

Query: 887 QAIAGVASFLK 897
            A+AGV  +++
Sbjct: 861 AALAGVKGWVE 871


>gi|154253021|ref|YP_001413845.1| alanyl-tRNA synthetase [Parvibaculum lavamentivorans DS-1]
 gi|154156971|gb|ABS64188.1| alanyl-tRNA synthetase [Parvibaculum lavamentivorans DS-1]
          Length = 913

 Score =  926 bits (2392), Expect = 0.0,   Method: Composition-based stats.
 Identities = 443/911 (48%), Positives = 604/911 (66%), Gaps = 37/911 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M+ V+ IR+ +LEFF+  GHE++ S  L+P NDPTL+FTN+GMVPFKN+FTGQE   Y+ 
Sbjct: 22  MAGVNEIRSKYLEFFRAQGHEVVASGPLVPNNDPTLLFTNAGMVPFKNVFTGQETRPYKR 81

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             + QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG Y+K  AI+ AWDL+TKE  L
Sbjct: 82  AASSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYYKAEAIEFAWDLITKELAL 141

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + RL +T+Y++D+EA  LWKKI+GLS DKI+R+    NFW M +TGPCGP SEIF+D G
Sbjct: 142 PESRLMVTIYEDDDEAHGLWKKITGLSDDKIVRLGAKSNFWQMGDTGPCGPNSEIFYDHG 201

Query: 181 ECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + IPGG P    E+G+R+IEIWNLVFMQ+EQ     R  LPK SIDTGMGLER+A VLQ 
Sbjct: 202 DKIPGGPPGSPDEDGDRFIEIWNLVFMQYEQHEDGSRTRLPKPSIDTGMGLERIAAVLQG 261

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NY  DL + LI AS + +    +G + V+HRVI DHLRSSSFL+ADG++P+NEGRGY
Sbjct: 262 THDNYSTDLMRSLIVASAEASKSDPDGPHAVSHRVIADHLRSSSFLLADGVMPSNEGRGY 321

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+L+G  EPLM  L+PAL  +MG AYPEL +A+ L+ ETLR E+ RF 
Sbjct: 322 VLRRIMRRAMRHAQLVGVAEPLMWRLVPALVRQMGDAYPELRRAEALVTETLRLEETRFR 381

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           +TL RGL LLD  +  LG   +L G+VAFKLYDT+G PLD+ QD L +RG++ +D   F+
Sbjct: 382 ETLTRGLKLLDEEIESLGGKGVLAGEVAFKLYDTYGFPLDLTQDALRSRGMS-VDQTGFD 440

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
           +A+ +QR  ARA   G G   TE +WF L++K GAT+F+GY+                  
Sbjct: 441 EAMAKQRQDARAAWSGSGEKATEAVWFELRDKVGATEFLGYE------------------ 482

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                +      V A++  G+ V++  +G    ++ +QTPFYAE+GGQ+GDTG       
Sbjct: 483 -----SEIAEGKVVALLVDGQPVDKVEAGTDAALITNQTPFYAESGGQVGDTGIVFSADG 537

Query: 540 -RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALS 598
               + D  KK   + VH   + RG L+    + + +D   R     NHSATHLLH AL 
Sbjct: 538 AEFPVIDTMKKLGALHVHIGKLARGTLKLGDIVEMKVDKSLRDATRANHSATHLLHEALR 597

Query: 599 TILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNRED 658
            +LG HV+Q GS + P+ LRFD +H KP+T  E+  +E  VN +I QN  V TR+M  ED
Sbjct: 598 RVLGDHVTQKGSMVGPERLRFDFSHPKPMTPEEISEVETIVNRVIRQNAEVTTRLMTPED 657

Query: 659 AIASGAAALLGTKYNDRVRVVSVEYED---GGVHSSALCGGTHVSSTGEIMLLYIVSESS 715
           AIA+GA AL G KY + VRV+++  +D    G +S  LCGGTHV   G+I +  IVSES+
Sbjct: 658 AIAAGALALFGEKYGEEVRVLAMGLDDENPNGTYSVELCGGTHVRRVGDIAIFKIVSESA 717

Query: 716 IRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHA 775
           + +GIRRIEA+TG+ AR++L+ QD   K  AS L++S  ++  RV  + EE ++L+   A
Sbjct: 718 VASGIRRIEALTGEGARAYLVAQDRIAKEAASALRISTEDLPARVVSLMEERKRLERELA 777

Query: 776 KRKLQLNV--------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
           + K QL +        ++    +   V  ++  +  V+ K+L+ ++D  +K++ SG+++L
Sbjct: 778 QAKKQLAMSGGGGSGGQESPVQEFGGVKLIARKLEGVNPKDLRGLIDESKKQLGSGVVVL 837

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQ 887
           V IS++ K ++ + VT+DL  R+NAV+L +  A  +GG GGGGRP MAQ+GGP   KAD 
Sbjct: 838 VAISEDGKGAIAVGVTDDLTSRYNAVELVKAGAAAMGGKGGGGRPDMAQAGGPEAEKADA 897

Query: 888 AIAGVASFLKK 898
           A+  V + + +
Sbjct: 898 ALDAVKAAVGE 908


>gi|205830263|sp|A7HWA5|SYA_PARL1 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
          Length = 892

 Score =  925 bits (2391), Expect = 0.0,   Method: Composition-based stats.
 Identities = 443/911 (48%), Positives = 604/911 (66%), Gaps = 37/911 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M+ V+ IR+ +LEFF+  GHE++ S  L+P NDPTL+FTN+GMVPFKN+FTGQE   Y+ 
Sbjct: 1   MAGVNEIRSKYLEFFRAQGHEVVASGPLVPNNDPTLLFTNAGMVPFKNVFTGQETRPYKR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             + QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG Y+K  AI+ AWDL+TKE  L
Sbjct: 61  AASSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYYKAEAIEFAWDLITKELAL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + RL +T+Y++D+EA  LWKKI+GLS DKI+R+    NFW M +TGPCGP SEIF+D G
Sbjct: 121 PESRLMVTIYEDDDEAHGLWKKITGLSDDKIVRLGAKSNFWQMGDTGPCGPNSEIFYDHG 180

Query: 181 ECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + IPGG P    E+G+R+IEIWNLVFMQ+EQ     R  LPK SIDTGMGLER+A VLQ 
Sbjct: 181 DKIPGGPPGSPDEDGDRFIEIWNLVFMQYEQHEDGSRTRLPKPSIDTGMGLERIAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NY  DL + LI AS + +    +G + V+HRVI DHLRSSSFL+ADG++P+NEGRGY
Sbjct: 241 THDNYSTDLMRSLIVASAEASKSDPDGPHAVSHRVIADHLRSSSFLLADGVMPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+L+G  EPLM  L+PAL  +MG AYPEL +A+ L+ ETLR E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLVGVAEPLMWRLVPALVRQMGDAYPELRRAEALVTETLRLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           +TL RGL LLD  +  LG   +L G+VAFKLYDT+G PLD+ QD L +RG++ +D   F+
Sbjct: 361 ETLTRGLKLLDEEIESLGGKGVLAGEVAFKLYDTYGFPLDLTQDALRSRGMS-VDQTGFD 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
           +A+ +QR  ARA   G G   TE +WF L++K GAT+F+GY+                  
Sbjct: 420 EAMAKQRQDARAAWSGSGEKATEAVWFELRDKVGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                +      V A++  G+ V++  +G    ++ +QTPFYAE+GGQ+GDTG       
Sbjct: 462 -----SEIAEGKVVALLVDGQPVDKVEAGTDAALITNQTPFYAESGGQVGDTGIVFSADG 516

Query: 540 -RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALS 598
               + D  KK   + VH   + RG L+    + + +D   R     NHSATHLLH AL 
Sbjct: 517 AEFPVIDTMKKLGALHVHIGKLARGTLKLGDIVEMKVDKSLRDATRANHSATHLLHEALR 576

Query: 599 TILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNRED 658
            +LG HV+Q GS + P+ LRFD +H KP+T  E+  +E  VN +I QN  V TR+M  ED
Sbjct: 577 RVLGDHVTQKGSMVGPERLRFDFSHPKPMTPEEISEVETIVNRVIRQNAEVTTRLMTPED 636

Query: 659 AIASGAAALLGTKYNDRVRVVSVEYED---GGVHSSALCGGTHVSSTGEIMLLYIVSESS 715
           AIA+GA AL G KY + VRV+++  +D    G +S  LCGGTHV   G+I +  IVSES+
Sbjct: 637 AIAAGALALFGEKYGEEVRVLAMGLDDENPNGTYSVELCGGTHVRRVGDIAIFKIVSESA 696

Query: 716 IRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHA 775
           + +GIRRIEA+TG+ AR++L+ QD   K  AS L++S  ++  RV  + EE ++L+   A
Sbjct: 697 VASGIRRIEALTGEGARAYLVAQDRIAKEAASALRISTEDLPARVVSLMEERKRLERELA 756

Query: 776 KRKLQLNV--------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
           + K QL +        ++    +   V  ++  +  V+ K+L+ ++D  +K++ SG+++L
Sbjct: 757 QAKKQLAMSGGGGSGGQESPVQEFGGVKLIARKLEGVNPKDLRGLIDESKKQLGSGVVVL 816

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQ 887
           V IS++ K ++ + VT+DL  R+NAV+L +  A  +GG GGGGRP MAQ+GGP   KAD 
Sbjct: 817 VAISEDGKGAIAVGVTDDLTSRYNAVELVKAGAAAMGGKGGGGRPDMAQAGGPEAEKADA 876

Query: 888 AIAGVASFLKK 898
           A+  V + + +
Sbjct: 877 ALDAVKAAVGE 887


>gi|163759600|ref|ZP_02166685.1| alanyl-tRNA synthetase [Hoeflea phototrophica DFL-43]
 gi|162283197|gb|EDQ33483.1| alanyl-tRNA synthetase [Hoeflea phototrophica DFL-43]
          Length = 884

 Score =  925 bits (2391), Expect = 0.0,   Method: Composition-based stats.
 Identities = 477/895 (53%), Positives = 628/895 (70%), Gaps = 35/895 (3%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+ FL++F+KN HE++ SS L+P NDPTLMFTN+GMV FKN+FTG E   Y  
Sbjct: 1   MSGVNEIRSAFLDYFKKNEHEVVASSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRPYTT 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             T QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE+AI+LAW+LLT+EF +
Sbjct: 61  AATSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEQAIELAWNLLTREFGI 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
           ++ RL +TVY  D++AF LW+KI+G+   +IIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 121 NKERLLVTVYHTDDDAFDLWRKIAGVPESRIIRIPTSDNFWAMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGS-SEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R+IEIWNLVFMQFEQ    ER  LP+ SIDTGMGLER+A +LQ 
Sbjct: 181 DHIWGGPPGSADEDGDRFIEIWNLVFMQFEQLTVDERVDLPRPSIDTGMGLERIAALLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           + +NYDIDLF+ LI ASE++TG+  EG+   +HRVI DHLRSS+FLIADG+LP+NEGRGY
Sbjct: 241 QHDNYDIDLFRRLIMASEELTGVSAEGDRRASHRVIADHLRSSAFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  LLP L  EMG AYPEL +A+ LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAQEPLMYKLLPTLVAEMGRAYPELTRAEALISETLKLEETRFS 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LLD   + LG+ + L G+ AFKLYDT+G PLD+ QD L  RG   +D   F 
Sbjct: 361 KTLERGLSLLDEASADLGEGDRLGGETAFKLYDTYGFPLDLTQDALRQRG-IEVDTDGFK 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E Q++ ARAH  G G   TE +W+ +K++ GAT F+GYD                  
Sbjct: 420 AAMERQKAEARAHWSGSGDKATETVWYEIKDRVGATDFLGYD------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +++A+V+ G  V  A +G+ V+VV +QTPFY E+GGQ+GD G   G+G 
Sbjct: 462 -----TEIAEGVIQAMVRDGAEVAAAKAGESVDVVVNQTPFYGESGGQMGDQGIISGEGY 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           RL+++D QK+ EG+FVH A+V  G ++      L + +  R ++  NHSATHLLH AL  
Sbjct: 517 RLEVSDTQKRGEGLFVHRAVVAEGEVKAGAVAQLDVAHSRRAKIRANHSATHLLHEALRE 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG+HV+Q GS + P+ LRFDV+H KP+T+ EL  +E   N+II QN PV TR+M  +DA
Sbjct: 577 VLGTHVAQKGSLVAPERLRFDVSHPKPMTAEELSEVETMANEIILQNSPVTTRLMAVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSVEYEDGGV-----HSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+     GV     +S  LCGGTHV++TGEI L+ ++S+S
Sbjct: 637 IAEGAMALFGEKYGDEVRVVSMGTGVRGVKANRPYSVELCGGTHVAATGEIGLVRVLSDS 696

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
           ++ AG+RRIEA+TG+ AR HL  QDEKL+  AS LKV  G+VV R+E + +E +K++   
Sbjct: 697 AVSAGVRRIEAVTGEAARQHLSEQDEKLRQAASLLKVQPGDVVSRIEALMDERKKMEREL 756

Query: 775 AKRK-----LQLNVEDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVG 829
            + +                 I  V F+  +++ V  K+LK ++DA +  + SG+   V 
Sbjct: 757 TEARKKLALGGGGAGGDESRDIGGVKFLGKVVNGVQPKDLKGLVDAAKTSLGSGVAAFVA 816

Query: 830 ISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNK 884
           IS++ KASV++ VTEDL  + +AVDL R++++ +GG GGGGRP MAQ+GGP+G K
Sbjct: 817 ISEDGKASVVVGVTEDLTSKLSAVDLVRVASQAIGGKGGGGRPDMAQAGGPDGAK 871


>gi|260579906|ref|ZP_05847736.1| alanyl-tRNA synthetase [Haemophilus influenzae RdAW]
 gi|260093190|gb|EEW77123.1| alanyl-tRNA synthetase [Haemophilus influenzae RdAW]
          Length = 874

 Score =  925 bits (2391), Expect = 0.0,   Method: Composition-based stats.
 Identities = 385/913 (42%), Positives = 546/913 (59%), Gaps = 56/913 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAINFAWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDDEAYNIWNKDVGVPAERIIRIGDNKGSPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LP+ S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNVVFMQFNRLADGTMEKLPRPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+FK LI  + ++ G         + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFKTLIAKTAEIVGATD--LTNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  ++   +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKESFFYKLVPTLIDVMAEAGKDVKAKQTNVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  LS +  D IL+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LRLEEEQFARTLERGLSLLDEALSQVK-DGILSGEVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID  +F++ +E QR+RA+A S           + S+    G T+F GY  +       
Sbjct: 418 T-IDEQAFDRKMEAQRTRAQAASQFG------VDYNSVIRVDGETKFEGYTEVES----- 465

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + + A+   G+ VE   +GQ   V+ + TPFYAE+GGQ+GD
Sbjct: 466 ------------------QAKITALFYDGKSVESIEAGQSAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G      +   + D QK    +F H   + +G L+   S+   +D + R   S+NHSAT
Sbjct: 508 SGYLSTQSVTFNVKDTQKYG-QVFGHIGELTQGSLKVGQSVNAIVDAKRRHNTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  ILG HV Q GS ++   LRFD    + IT  +L  IE  VN  I  N PV 
Sbjct: 567 HLLHAALRQILGLHVVQKGSLVSDKALRFDFAQPEAITKEQLSEIETLVNQKIRANFPVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM+ + A A GA AL G KY D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMDIDSAKAKGAMALFGEKYGDKVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           ++E+++ AGIRRIEA+TGQ A   L  Q   L   A  LK     +  +++++ ++ +K+
Sbjct: 682 ITENAVAAGIRRIEAVTGQNAIDWLHNQQRILTQSADLLKSDVNTLAEKIQQLQDKAKKV 741

Query: 771 QLIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI  V+ ++  +  +++K L+ ++D L+ ++ SG+I
Sbjct: 742 EKELQGLKEKAAMQAGSYFVKSAVKINGVSVIAQQLDGIETKSLRVMVDDLKNQLGSGVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
               I  ++K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 AFASIL-DEKVNLVVGVTNDLTAKIKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQLENV 859

Query: 886 DQAIAGVASFLKK 898
            QAI     +L K
Sbjct: 860 TQAIKVAQDWLNK 872


>gi|90412109|ref|ZP_01220116.1| alanyl-tRNA synthetase [Photobacterium profundum 3TCK]
 gi|90327087|gb|EAS43466.1| alanyl-tRNA synthetase [Photobacterium profundum 3TCK]
          Length = 873

 Score =  925 bits (2390), Expect = 0.0,   Method: Composition-based stats.
 Identities = 380/910 (41%), Positives = 531/910 (58%), Gaps = 54/910 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            +   IR  FL FF+  GH+++ SSSL+P NDPTL+FTN+GM  FK+ F G EK  Y   
Sbjct: 3   MSTDEIRRAFLAFFESKGHQIVESSSLVPANDPTLLFTNAGMNQFKDTFLGIEKRSYTRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI+ AW+ LT    L 
Sbjct: 63  TTAQRCVRAGGKHNDLENVGFTARHHTFFEMLGNFSFGDYFKQDAIKYAWEFLTDVLGLP 122

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           Q RL +T+Y+ D+EAF +W K  G+ AD+I+RI  N       DNFW M +TGPCGPC+E
Sbjct: 123 QDRLLVTIYETDDEAFDIWNKEMGIPADRIVRIGDNKGAPYASDNFWQMGDTGPCGPCTE 182

Query: 175 IFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D GE I GG P    E+G+R+IEIWN VFMQF +Q       LPK S+DTGMG+ER+
Sbjct: 183 IFYDHGEHIWGGRPGTPEEDGDRFIEIWNNVFMQFNRQADGTMEPLPKPSVDTGMGIERI 242

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A ++Q   +NY+ID+F+ LI+ S +V G  YE  +  + RV+ DH+RS +FLI DG++P+
Sbjct: 243 AAIMQGVHSNYEIDIFQTLIKKSAEVIG--YEDLSNQSLRVVADHIRSCAFLIVDGVMPS 300

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG T      L   L   MG+A  EL + + L+E+ L+ 
Sbjct: 301 NEGRGYVLRRIIRRAVRHGNKLGATGAFFYKLAGPLAEIMGTAGEELKKQQALVEKVLKI 360

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGI 413
           E++ FG+TLDRGL +L+  L +L   E L+G+  FKLYDT+G P D+  D+   R    I
Sbjct: 361 EEDNFGRTLDRGLTILNDALDNLSGKE-LDGETVFKLYDTYGFPADLTNDVARERDFT-I 418

Query: 414 DIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDR 473
           D   FN A+E QR RAR        G     +    +    T+F GY             
Sbjct: 419 DEEGFNNAMEAQRQRAREA------GKFGVDYNESIKVDVNTEFCGYT------------ 460

Query: 474 KVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGC 533
                           S + A+ + GE V+  ++G+   ++ D TPFYAE+GGQ GD G 
Sbjct: 461 -----------GTAAQSRIIALYRDGEAVDSILAGEDALIILDNTPFYAESGGQCGDAGV 509

Query: 534 AIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLL 593
              +     +TD QK       H   + +G L     L   +D   R  +++NHSATHLL
Sbjct: 510 LTAESTMFNVTDTQKFGA-AIGHQGSLVQGALNIGDKLEAQVDVARRAAITLNHSATHLL 568

Query: 594 HHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRI 653
           H AL  +LG HV+Q GS +  D LRFD ++ + +   +L+ IE  VN+ I  N  + T I
Sbjct: 569 HSALRNLLGEHVAQKGSLVKADALRFDFSNLEAVKPEQLREIERVVNEQIRLNHSIDTNI 628

Query: 654 MNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSE 713
           M+ E A   GA AL G KY+D VRV+S+     G  S+ LCGG H  +TG+I L  I SE
Sbjct: 629 MDIESAKQKGAMALFGEKYDDEVRVLSM-----GEFSTELCGGIHAKNTGDIGLFKITSE 683

Query: 714 SSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLI 773
             I AGIRRIEA+TG  A   L  Q+  L   AS +K    +V  +V  +    ++L+  
Sbjct: 684 GGIAAGIRRIEAVTGAAAIDALHAQEALLSETASIVKSDAASVATKVSALLAHSKQLEKD 743

Query: 774 HAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
             + + +L  ++ +       +I  V  +   +   D+K L+ ++D ++ K+ SGI++L 
Sbjct: 744 IQQLQDKLAAQESAGLLDQAKEINGVKVLITQLDGADNKALRGMLDEIKNKLGSGIVVLG 803

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQA 888
            +S + K  +++ VT+DL  +  A +L  + A+ + GG GGGRP MAQ+GG +      A
Sbjct: 804 NVSGD-KVGLIVGVTKDLTGKVKAGELVNMVAQQV-GGKGGGRPDMAQAGGTDAAALPAA 861

Query: 889 IAGVASFLKK 898
           +  V  +L +
Sbjct: 862 LESVTPWLTE 871


>gi|237811944|ref|YP_002896395.1| alanine--tRNA ligase [Burkholderia pseudomallei MSHR346]
 gi|237502943|gb|ACQ95261.1| alanine--tRNA ligase [Burkholderia pseudomallei MSHR346]
          Length = 874

 Score =  925 bits (2390), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/911 (42%), Positives = 538/911 (59%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTSVYKLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY +D+EA+ +W K  G+ A++IIRI  N       DNFW M +TGPCGPCSE
Sbjct: 121 ADKLWVTVYHDDDEAYDIWAKEVGVPAERIIRIGDNKGARYASDNFWQMGDTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+AS + TG+    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQQLIKASARETGVADLANN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG   P    L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKAPFFHKLVADLVAEMGAAYPELKEAEPRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ L     + L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALAELDAAGGKTLDGELAFKLHDTYGFPLDLTADVCRERGVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYTGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+  +G  V E  +G+   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVEGASVGEVKAGESAVVVLDHTPFYAESGGQVGDR 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    +   ID   R + + NHSATH
Sbjct: 509 GVLANAATRFAVGDTLKVQADVIGHHGELEQGTLKVGDVVRAEIDAARRARTARNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD  H+ P+T  E++ +E  VN+ +  N P + 
Sbjct: 569 LMHKALRDVLGSHVQQKGSLVDADKTRFDFAHNAPLTDDEIRRVEAIVNEQVLANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  +DA+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 629 RVMPYDDAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           +E  + AGIRR+EAITG  A  ++   D ++ + A+ LK     ++ R+ ++ ++ + L+
Sbjct: 683 AEGGVAAGIRRVEAITGDNAVRYVQALDARVNAAAAALKAQPSELLQRIGQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             ++  V+ ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSRLASSQGDELAQQAVEVGGVHVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +    K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG    K  
Sbjct: 803 LAAVD-GGKVSLIAGVTADASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPAKLP 860

Query: 887 QAIAGVASFLK 897
            A+AGV  +++
Sbjct: 861 AALAGVKGWVE 871


>gi|126441822|ref|YP_001058678.1| alanyl-tRNA synthetase [Burkholderia pseudomallei 668]
 gi|205830005|sp|A3N8K7|SYA_BURP6 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|126221315|gb|ABN84821.1| alanine--tRNA ligase [Burkholderia pseudomallei 668]
          Length = 874

 Score =  924 bits (2389), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/911 (42%), Positives = 538/911 (59%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTSVYKLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY +D+EA+ +W K  G+ A++IIRI  N       DNFW M +TGPCGPCSE
Sbjct: 121 ADKLWVTVYHDDDEAYDIWAKEVGVPAERIIRIGDNKGARYASDNFWQMGDTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+AS + TG+    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQQLIKASARETGVADLANN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG   P    L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKAPFFHKLVADLVAEMGAAYPELKEAEPRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ L     + L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALAELDAAGGKTLDGELAFKLHDTYGFPLDLTADVCRERGVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYTGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+  +G  V E  +G+   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVEGASVGEVKAGESAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    +   ID   R + + NHSATH
Sbjct: 509 GVLANAATRFAVGDTLKVQADVIGHHGELEQGTLKVGDVVRAEIDAARRARTARNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD  H+ P+T  E++ +E  VN+ +  N P + 
Sbjct: 569 LMHKALRDVLGSHVQQKGSLVDADKTRFDFAHNAPLTDDEIRRVEAIVNEQVLANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  +DA+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 629 RVMPYDDAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           +E  + AGIRR+EAITG  A  ++   D ++ + A+ LK     ++ R+ ++ ++ + L+
Sbjct: 683 AEGGVAAGIRRVEAITGDNAVRYVQALDARVNAAAAALKAQPSELLQRIGQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             ++  V+ ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSRLASSQGDELAQQAVEVGGVHVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +    K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG    K  
Sbjct: 803 LAAVD-GGKVSLIAGVTADASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPAKLP 860

Query: 887 QAIAGVASFLK 897
            A+AGV  +++
Sbjct: 861 AALAGVKGWVE 871


>gi|167719939|ref|ZP_02403175.1| alanyl-tRNA synthetase [Burkholderia pseudomallei DM98]
          Length = 874

 Score =  924 bits (2388), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/911 (42%), Positives = 538/911 (59%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTSVYKLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY +D+EA+ +W K  G+ A++IIRI  N       DNFW M +TGPCGPCSE
Sbjct: 121 ADKLWVTVYHDDDEAYGIWAKEVGVPAERIIRIGDNKGARYASDNFWQMGDTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+AS + TG+    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQQLIKASARETGVADLANN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG   P    L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKAPFFHKLVADLVAEMGAAYPELKEAEPRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ L     + L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALAELDAAGGKTLDGELAFKLHDTYGFPLDLTADVCRERGVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYTGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+  +G  V E  +G+   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVEGASVGEVKAGESAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    +   ID   R + + NHSATH
Sbjct: 509 GVLANAATRFAVGDTLKVQADVIGHHGELEQGTLKVGDVVRAEIDAARRARTARNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD  H+ P+T  E++ +E  VN+ +  N P + 
Sbjct: 569 LMHKALRDVLGSHVQQKGSLVDADKTRFDFAHNAPLTDDEIRRVEAIVNEQVLANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  +DA+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 629 RVMPYDDAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           +E  + AGIRR+EAITG  A  ++   D ++ + A+ LK     ++ R+ ++ ++ + L+
Sbjct: 683 AEGGVAAGIRRVEAITGDNAVRYVQALDARVNAAAAALKAQPSELLQRIGQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             ++  V+ ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSKLASSQGDELAQQAVEVGGVHVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +    K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG    K  
Sbjct: 803 LAAVD-GGKVSLIAGVTADASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPAKLP 860

Query: 887 QAIAGVASFLK 897
            A+AGV  +++
Sbjct: 861 AALAGVKGWVE 871


>gi|294634755|ref|ZP_06713284.1| alanine--tRNA ligase [Edwardsiella tarda ATCC 23685]
 gi|291091814|gb|EFE24375.1| alanine--tRNA ligase [Edwardsiella tarda ATCC 23685]
          Length = 875

 Score =  924 bits (2388), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/910 (42%), Positives = 562/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+F+   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFYHSKGHQVVDSSSLVPNNDPTLLFTNAGMNQFKDVFLGIDKRSYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + F+
Sbjct: 63  TTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIKFAWELLTGAQWFN 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L Q +L++TVY+ D+EA+ +W    G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPQEKLWVTVYESDDEAYNIWANEVGVPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G  I GG P    E+G+RYIEIWN+VFMQF +Q+      LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGAHIAGGPPGSPDEDGDRYIEIWNIVFMQFNRQSDGTLLPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LI  + +V G+     +  + RVI DH+RS +FL++DG+L
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIAETARVIGVDD--LSSKSLRVIADHIRSCAFLVSDGVL 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NEGRGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  EL + + ++E+ L
Sbjct: 301 PSNEGRGYVLRRIIRRAVRHGHMLGAKESFFYKLVAPLIQVMGSAADELARQQAMVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G PLD+  D+   R L 
Sbjct: 361 KTEEEQFARTLERGLALLDDELAQLD-GDTLDGETAFRLYDTYGFPLDLTADVCRERNLK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D + F +A+E QR RAR       S      + SL    G+T F GY   +       
Sbjct: 420 -VDEVGFEKAMEAQRRRARE------SSGFGADYNSLIRVEGSTDFTGYQRQQQM----- 467

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + + A+ + G+ V+   +G++  VV DQTPFYAE+GGQ+GD 
Sbjct: 468 ------------------ATITALFRNGQAVDALQAGEEGVVVLDQTPFYAESGGQVGDR 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G     G+   + D QK  +    H   V +G L+   SL  +ID   R ++ ++HSATH
Sbjct: 510 GELSASGVSFVVDDTQKYGQ-AIGHLGKVVQGHLQVGASLQASIDVARRDRIRLSHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL ++LG+HV+Q GS +    LRFD +H + +   +++ +E+ VN  I +NLP+ T
Sbjct: 569 LMHAALRSVLGTHVAQKGSLVNDGYLRFDFSHPEAMKPQQIRQVEEIVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           + M  E+A A GA AL G KY+ +VRV+S+     G  S+ LCGGTH   TG+I L  IV
Sbjct: 629 QEMGLEEAKAKGAMALFGEKYDAQVRVLSM-----GEFSTELCGGTHAERTGDIGLFRIV 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG++A   +  + + L+  AS +K    +V  ++  + E+ R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEQALQAMHQESDMLREAASLVKGDTQSVAEKIRGLMEKSRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++         ++  V  +   +  V+ K L++++D L+ ++ S I++
Sbjct: 744 KALQQLKDQQAAQESASLSAQAVEVNGVKLLVSQLHGVEPKMLRTMVDDLKNQMGSCIVV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L   ++E K S++  V++DL  +  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LA-TAEEGKVSLIAGVSKDLTAKVKAGELIGMVAQQV-GGKGGGRPDMAQAGGSDVAALP 861

Query: 887 QAIAGVASFL 896
           QA+A V+ ++
Sbjct: 862 QALASVSDWV 871


>gi|290476264|ref|YP_003469168.1| alanyl-tRNA synthetase [Xenorhabdus bovienii SS-2004]
 gi|289175601|emb|CBJ82404.1| alanyl-tRNA synthetase [Xenorhabdus bovienii SS-2004]
          Length = 887

 Score =  924 bits (2388), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/910 (42%), Positives = 552/910 (60%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++PSSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 15  KSTAEIRQAFLDFFHTKGHQIVPSSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRPYSRA 74

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI+ AW+LLT  + F+
Sbjct: 75  TTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAIKYAWELLTGKEWFN 134

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW M +TGPCGPC
Sbjct: 135 LPKEKLWVTVYETDDEAYDIWHKEVGIPAERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 194

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D GE I GG PGS  E+G+RYIEIWN+VFMQF +        LPK S+DTGMGLE
Sbjct: 195 TEIFYDHGEHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRHVDGTMEPLPKPSVDTGMGLE 254

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+  VLQ   +NYDIDLF  LI +  +VTG         + RVI DH+RS +FL+ DG++
Sbjct: 255 RLTAVLQHVNSNYDIDLFCDLIASVAEVTGATD--LTNKSLRVIADHIRSCAFLVCDGVV 312

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  EL + + L+E+ L
Sbjct: 313 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVAPLIKIMGSAGDELKRQQSLVEQVL 372

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L  L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 373 KTEEEQFARTLERGLQLLDEELEKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 431

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D + F+ A+E QR RAR       S      +    +  G + F GY+          
Sbjct: 432 -VDEVGFDVAMENQRRRARE------SSGFGTDYNEQIKVDGRSDFSGYEH--------- 475

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                         N   + V AI + GE +++  +G++  V+ D+T FYAE+GGQ+GDT
Sbjct: 476 --------------NSQQATVMAIFRHGEAIDQIHAGEEAIVILDKTAFYAESGGQVGDT 521

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G         ++TD QK       H   +  G L    ++   I+   R  + +NHSATH
Sbjct: 522 GNLSNGNGIFEVTDTQKYG-QAIGHIGKLINGTLNVNNTINAEINRVRRDSIRLNHSATH 580

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  ILG HVSQ GS +    LRFD +H + +   +++ +E+ VN+ I +NL +VT
Sbjct: 581 LLHAALRQILGEHVSQKGSLVNDKYLRFDFSHFEAMKLEQIRQVENLVNEEIRKNLSIVT 640

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            +M  E+A   GA AL G KY+++VRV+S+     G  S+ LCGGTH S TG+I L  I 
Sbjct: 641 ELMELEEAKTKGAMALFGEKYDEQVRVLSM-----GDFSTELCGGTHASRTGDIGLFRIS 695

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AGIRRIEAITGQ A + +  Q + L+ +A  +K    ++  +V+   +  ++L+
Sbjct: 696 SESGTAAGIRRIEAITGQTALNSVYQQTDLLQDIAHLVKSDISSLNEKVKTTLDRTKQLE 755

Query: 772 LIHAKRKLQLNVEDLSC-----HKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K Q   ++ S       +I  V  +   + + + K L++++D L+ ++ S II+
Sbjct: 756 KELQHLKSQQAAQESSSLANQTKEIQGVRLLVTQLGDTEPKMLRTMVDELKNQLGSAIIV 815

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ + K ++++ +T+DL  R  A DL    A+ + GG GGGRP +AQ+GG +     
Sbjct: 816 LSTVTGD-KVTLIVGITKDLTARIKAGDLISFVAQQV-GGKGGGRPDLAQAGGTDVAALP 873

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 874 SALASVEEWV 883


>gi|254489976|ref|ZP_05103171.1| alanyl-tRNA synthetase [Methylophaga thiooxidans DMS010]
 gi|224465061|gb|EEF81315.1| alanyl-tRNA synthetase [Methylophaga thiooxydans DMS010]
          Length = 858

 Score =  924 bits (2388), Expect = 0.0,   Method: Composition-based stats.
 Identities = 400/893 (44%), Positives = 535/893 (59%), Gaps = 47/893 (5%)

Query: 10  TFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVTTVQKCVR 69
            FL+FF   GHE++ SS L+P NDPTL+FTN+GMV FK  F GQE   Y    T Q+CVR
Sbjct: 1   MFLDFFASKGHEVVASSPLVPANDPTLLFTNAGMVQFKETFLGQETRKYTRAVTTQRCVR 60

Query: 70  AGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQRRLYITV 129
           AGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+ LT+   L   +L+ITV
Sbjct: 61  AGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIQYAWEFLTETLALPPEKLWITV 120

Query: 130 YDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGECIPGGLP- 188
           ++ED+EA  +W K  G+SAD+  RI   DNFWSM +TGPCGPCSEIF+D GE I GG P 
Sbjct: 121 FEEDDEAADIWLKEIGVSADRFSRIGAKDNFWSMGDTGPCGPCSEIFYDHGEDIAGGPPG 180

Query: 189 GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEKTNNYDIDL 248
              E+G+RYIEIWNLVFMQF++        LPK S+DTGMGLER+A VLQ   NNY+IDL
Sbjct: 181 TPEEDGDRYIEIWNLVFMQFDRSADGTLTPLPKPSVDTGMGLERLAAVLQHVHNNYEIDL 240

Query: 249 FKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYVLRRIMRRA 308
           F+HLI+A + ++G +   ++  + RVI DH+RS SF+IADG+ P+NEGRGYVLRRI+RRA
Sbjct: 241 FQHLIEAIQALSGTED--SSNFSLRVIADHIRSCSFMIADGVHPSNEGRGYVLRRIIRRA 298

Query: 309 MCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGKTLDRGLVL 368
           + +   LG  E     L+  L  EMG A+PEL QA+ L+E+ L  E+ RF  TLD GL +
Sbjct: 299 IRHGHKLGLKEAFFHKLVQPLVNEMGDAFPELKQAQALVEKALLQEENRFADTLDNGLRI 358

Query: 369 LDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQALEEQRSR 428
           LD  +  +G  EI  G+  F LYDT+G P+D+  DI   RGL  IDI  F +A+E QR+R
Sbjct: 359 LDQAIEDMGDKEI-PGETVFLLYDTYGFPIDLTADIARERGLT-IDIAGFERAMEAQRTR 416

Query: 429 ARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKPPIDLTNGV 488
           AR+ S   G  + +          G T F GY   +                        
Sbjct: 417 ARSASQFAGGLSEQ------IAIDGETAFCGYSQTQ-----------------------E 447

Query: 489 SSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIRLQITDVQK 548
           +  + AI+  GE V++  +GQ+  +V D TPFYAE+GGQ+GD G    D     ++D +K
Sbjct: 448 TGTITAIIADGEHVDQLEAGQEGVLVLDHTPFYAESGGQVGDHGEITSDNASFTVSDTRK 507

Query: 549 KAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTILGSHVSQN 608
           + +  F H    E G      S+   ID  NR+  ++NHSATHLLH AL  +LG HV Q 
Sbjct: 508 QGK-AFTHIGRCEHGQFHVGQSVTAQIDESNRQATALNHSATHLLHAALRNVLGDHVMQK 566

Query: 609 GSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAIASGAAALL 668
           GS + P  LRFD +H +P+T  +L  IE  VN  I  N PV T++M  E+A  SGA AL 
Sbjct: 567 GSLVDPQRLRFDFSHFEPVTPDQLHDIERMVNQQIRLNHPVDTKLMAIEEAKKSGAMALF 626

Query: 669 GTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGIRRIEAITG 728
           G KY+D VRV+S+     G  S  LCGGTHV  TG+I LL I +E+ I +G+RRIEA+TG
Sbjct: 627 GEKYDDEVRVLSM-----GDFSIELCGGTHVQHTGDIGLLKITAEAGIASGVRRIEAVTG 681

Query: 729 QRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQLNVEDL-- 786
            +A  ++      L  ++  LK    NV  +   + +  R+L+      K +L       
Sbjct: 682 DKALDYIDTTQSTLNQVSDLLKAKPDNVQDKAALLVQRSRELEKELESLKAKLASSAGDD 741

Query: 787 ---SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKKASVLIVVT 843
              S  +I  +  ++  +   D K L+  +D L+ K+ +  I+L  + K++K +++  VT
Sbjct: 742 LANSVQEINGIKVLASSLEGADGKALREAVDQLKNKLGTAAIVLTAV-KDEKITIIAGVT 800

Query: 844 EDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASFL 896
           +D+ D+  A DL    A  + GG GGGRP MAQ GG        A+A V  ++
Sbjct: 801 KDITDKIRAGDLVGHVASQV-GGKGGGRPDMAQGGGNEPQNLAAALASVTDWV 852


>gi|77359489|ref|YP_339064.1| alanyl-tRNA synthetase [Pseudoalteromonas haloplanktis TAC125]
 gi|123589570|sp|Q3ILF3|SYA_PSEHT RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|76874400|emb|CAI85621.1| alanyl-tRNA synthetase [Pseudoalteromonas haloplanktis TAC125]
          Length = 868

 Score =  924 bits (2388), Expect = 0.0,   Method: Composition-based stats.
 Identities = 391/900 (43%), Positives = 537/900 (59%), Gaps = 48/900 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF    H+++PSSSLIP ND TL+F N+GMV FK++F G E   Y   
Sbjct: 4   MTTAQIRQQFLDFFASKQHQVVPSSSLIPGNDATLLFNNAGMVQFKDVFLGAESRPYTRA 63

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI+ AW  LT+E  L 
Sbjct: 64  TSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAIKFAWQFLTEEVKLP 123

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGE 181
           + +L +T+Y +DEEAF  W    GL AD+IIRI T DNFWSM +TGPCGPCSEIF+D GE
Sbjct: 124 KEKLLVTIYHDDEEAFNYWSNDIGLPADRIIRIATADNFWSMGDTGPCGPCSEIFYDHGE 183

Query: 182 CIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEK 240
            I GG PGS  E+G+R+IEIWNLVFMQ+ +QN      LPK S+DTGMGLER+A +LQ  
Sbjct: 184 HIWGGPPGSPEEDGDRFIEIWNLVFMQYNRQNDGTMLPLPKQSVDTGMGLERIAAILQGV 243

Query: 241 TNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYV 300
            +NY+IDLFK LI A+  VT  +    +  + RV+ DH+RS +FLI+DG++P+NEGRGYV
Sbjct: 244 HSNYEIDLFKGLIAAAASVTNAQDM--DDKSLRVVADHIRSCAFLISDGVMPSNEGRGYV 301

Query: 301 LRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGK 360
           LRRI+RRA+ +   LG        L+ AL  +MG AYPEL + + +IE+ LR E+E+FGK
Sbjct: 302 LRRIIRRAVRHGNKLGAQGAFFYKLVAALIEQMGQAYPELAKQQEIIEKVLRIEEEQFGK 361

Query: 361 TLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQ 420
           TL+RGL +L+  LS L   +++ GD+ FKLYDT+G P D+  D+   R +  ID   F +
Sbjct: 362 TLERGLAILEESLSDLK-GDVIPGDLVFKLYDTYGFPADLTADVARERQMT-IDNKGFEE 419

Query: 421 ALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKP 480
            +  QR  A+        G     +    +    T + GY                    
Sbjct: 420 CMAVQRKTAQQA------GKFGADYNDQLKSDKQTTYKGYTTTSH--------------- 458

Query: 481 PIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIR 540
                   S+ V  +    E V     GQK  V+ D+TPFYAE+GGQ+GDTG     G  
Sbjct: 459 --------SATVVEVFAGSESVSLLEDGQKGIVILDRTPFYAESGGQVGDTGVISVAGGE 510

Query: 541 LQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTI 600
             +T+  K        H  + +G +     +  TID   R ++  NH+ATH+LH  L  +
Sbjct: 511 FTVTNTTKLGNAF--AHHGIVQGRIGLNDKVEATIDDARRERIKKNHTATHILHETLRQL 568

Query: 601 LGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAI 660
           LG HV Q GS +  + LRFD +H + +T  EL+ IE  VND I  N  + T +M  +DA 
Sbjct: 569 LGEHVGQKGSLVQAERLRFDFSHFEAVTKEELREIERVVNDEIRCNFALSTELMAIDDAK 628

Query: 661 ASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGI 720
           A GA AL G KY+D VRVV++     G +S  LCGGTHV   G+I L  IVSES I AG+
Sbjct: 629 AKGAMALFGEKYDDEVRVVTI-----GDYSIELCGGTHVERAGDIGLFKIVSESGIAAGV 683

Query: 721 RRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQ 780
           RRIEA+TG  A +++  Q++KL  +A+ +K    +V+ +V  + ++ ++L+   A+   +
Sbjct: 684 RRIEAVTGADAIAYVSEQEQKLNDVAAVVKADSASVLEKVTALLDKSKQLEKQIAQLNDK 743

Query: 781 LNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKK 835
           L          S  +I  +  +   +   +SK L+ ++D L+ KI SG+I L G++ + K
Sbjct: 744 LASAAGASLLDSVVEINGIKLLIANVKGTESKALRGMVDDLKNKIGSGVIAL-GVASDDK 802

Query: 836 ASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASF 895
            S++  VT+DL  R  A +L    A  + GG GGGRP MAQ+GG        A+  V ++
Sbjct: 803 VSLIAGVTKDLTGRVKAGELVNHMASQV-GGKGGGRPDMAQAGGSEPENLTAALDSVTAW 861


>gi|212709394|ref|ZP_03317522.1| hypothetical protein PROVALCAL_00430 [Providencia alcalifaciens DSM
           30120]
 gi|212688306|gb|EEB47834.1| hypothetical protein PROVALCAL_00430 [Providencia alcalifaciens DSM
           30120]
          Length = 875

 Score =  924 bits (2388), Expect = 0.0,   Method: Composition-based stats.
 Identities = 388/910 (42%), Positives = 549/910 (60%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHTKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRAYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + F+
Sbjct: 63  TTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIRFAWELLTSEQWFN 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY  D+EAF +W K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYATDDEAFDIWNKEIGVPVERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWNLVFMQF +Q+      LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNLVFMQFNRQSDGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R++ VLQ   +NY+ID+F+ LI A+ + TG      +  + RVI DH+RS +FL++DG++
Sbjct: 243 RISAVLQHVNSNYEIDIFRELIAAAAEATGATD--LSNKSLRVIADHIRSCAFLVSDGVI 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NEGRGYVLRRI+RRA+ +  +LG  E     L+  L   MG A  EL + + L+E+ L
Sbjct: 301 PSNEGRGYVLRRIIRRAVRHGYMLGAKETFFYKLVSTLIKVMGPAAEELQRQQALVEKVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L G+ AF+LYDT+G PLD+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLQLLDEELASLK-GDTLEGETAFRLYDTYGFPLDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F +A+E+QR RAR       S      + +L +    ++F GY           
Sbjct: 420 -VDEAGFERAMEDQRRRARE------SSGFGADYNALIKVDKRSEFSGYQHDEQ------ 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + + A+ + G+ V+   +G +  V+ D+T FYAE+GGQ+GDT
Sbjct: 467 -----------------QATIIALYKDGQPVDSLHTGDEGLVILDKTAFYAESGGQVGDT 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G    D  +  +TD QK       H   VE G L     +   ++ + R  + +NHSATH
Sbjct: 510 GVLTNDSAQFTVTDTQKYG-QAIGHVGKVESGSLVVNHRIAAIVNSERRNAIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HVSQ GS +    LRFD +H + +T  +L+ +ED VN  I QN  + T
Sbjct: 569 LLHAALRQVLGEHVSQKGSLVNDKYLRFDFSHFEAMTQQQLRQVEDIVNAQIRQNSEIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            +M+ E A A GA AL G KY +RVRV+S+     G  S  LCGGTH S TG+I L  I+
Sbjct: 629 ELMDLEGAKAKGAMALFGEKYEERVRVLSM-----GDFSIELCGGTHASRTGDIGLFSIL 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA TG  A  HL  Q E+L ++A  LK    ++V +V+   ++ R L+
Sbjct: 684 SESGTAAGVRRIEATTGAAAMEHLHAQSEQLSAIAHLLKGDVNSLVEKVKAALDKSRNLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  +  +   +S+ D K L++++D L+ +++S II+
Sbjct: 744 KEILQLKDQQASQESASLSSKAKDVKGIKLLVSQLSDTDPKLLRTMVDDLKNQLKSAIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L   +   K S+++ VT DL  +  A DL    A+ + GG GGGRP MA +GG + +   
Sbjct: 804 L-STTSGDKVSIIVGVTNDLTAKIKAGDLVSYVAQQV-GGKGGGRPDMAMAGGTDVSALP 861

Query: 887 QAIAGVASFL 896
            A+  V  ++
Sbjct: 862 TAMESVEQWV 871


>gi|187924800|ref|YP_001896442.1| alanyl-tRNA synthetase [Burkholderia phytofirmans PsJN]
 gi|205830007|sp|B2SZN0|SYA_BURPP RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|187715994|gb|ACD17218.1| alanyl-tRNA synthetase [Burkholderia phytofirmans PsJN]
          Length = 874

 Score =  924 bits (2387), Expect = 0.0,   Method: Composition-based stats.
 Identities = 374/911 (41%), Positives = 534/911 (58%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAESRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTGVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA  +W K  G+  ++IIRI  N       DNFW MA+ GPCGPCSE
Sbjct: 121 KDKLWVTVYHEDDEAHDIWAKEVGVPVERIIRIGDNKGARYASDNFWQMADVGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFSRDAQGNMTPLPKQCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+A+ + TG+    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQALIKAAGRETGVSDLTNN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        ++  L  +MG AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGKKGSFFHRMVADLVAQMGDAYPELKEAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ L     + L+G++AFKL+DT+G PLD+  D+   R + 
Sbjct: 359 EEERFFETIEHGMSILESALADLEAKGGKTLDGELAFKLHDTYGFPLDLTADVCREREVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F++A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEAAFDEAMARQREQARAAGKFKMAQG-------LEYSGAKTTFHGYEEIVFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V+E   G++  VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVIALYVDGASVKEVRDGRQAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G      +R  ++D  K    +  HH  +E+G L+    +   ID   R + + NHSATH
Sbjct: 509 GVLANASVRFAVSDTLKVQADVVGHHGTLEQGTLKVGDVVKAEIDAVRRARTARNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD  H+ P+T  +++ +E+ VN  +  N P + 
Sbjct: 569 LMHKALREVLGSHVQQKGSLVDADKTRFDFAHNAPMTDEQIRRVEEIVNAEVLANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 629 RVMPFDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A   +   D ++ + A+ LK     +  R+ ++ ++ + L+
Sbjct: 683 MEGGVAAGIRRVEAITGDNAVRFVQDLDARINAAAAVLKAQPSELTQRITQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
              +  K ++             ++  V+ ++  +   D K L+  +D L+ K++S  I+
Sbjct: 743 KELSALKSKMASSQGDELAGQAIEVGGVHVLAATLEGADVKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LASV-EGGKVSLIAGVTADASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLK 897
            A+AGV  +++
Sbjct: 861 AALAGVKGWVE 871


>gi|329296669|ref|ZP_08254005.1| alanyl-tRNA synthetase [Plautia stali symbiont]
          Length = 875

 Score =  924 bits (2387), Expect = 0.0,   Method: Composition-based stats.
 Identities = 393/910 (43%), Positives = 546/910 (60%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GMV FK++F GQ+K  Y   
Sbjct: 3   KSNAEIRQAFLDFFHSKGHQVVASSSLVPNNDPTLLFTNAGMVQFKDVFLGQDKRDYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  AW+LLT  + F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKKEAIAYAWELLTGEQWFK 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EAF++W    G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYETDDEAFEIWANDIGVPRERIIRIGDNKGGAYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMQPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NY IDLF  LI A  QVTG      N  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVYSNYKIDLFAKLINAVAQVTGATD--LNNKSLRVIADHIRSCAFLIADGVI 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MG+A  +L + +  +E  L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKEAFFYKLVAPLIEVMGAAGEDLKRQQKHVENAL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F KTL+RGL LLD  L+ L   + L+G+  F+LYDT G P D+  D+   R L 
Sbjct: 361 KNEEEQFAKTLERGLALLDDELAKLK-GDTLDGETVFRLYDTFGFPADLTADVCRERNLK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            ID   F  A+E+QR RAR              + ++      TQF GYD L        
Sbjct: 420 -IDEAGFEAAMEQQRQRAREA------SGFGTDYNTVIRFDTPTQFKGYDHL-------- 464

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           + + V+A+   G+ VE+  +GQ   V+ DQTPFY E+GGQ+GDT
Sbjct: 465 ---------------SLEATVQALFVDGQQVEQVAAGQDAVVILDQTPFYGESGGQVGDT 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK  +  F H   + +G LR    L   +D   R ++ +NHSATH
Sbjct: 510 GVLTGQNAEFSVQDTQKYGK-AFGHIGKLRQGQLRVGDRLQAQVDEVRRSRIILNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG HV Q GS      LRFD +H + +   +++++ED VN  I +NLP+ T
Sbjct: 569 LMHEALRKVLGDHVGQKGSLNNDKYLRFDFSHGEAMKPQQIRAVEDIVNAQIRRNLPITT 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            +M+ E+A A GA AL G KY+ RVRVVS+     G +S  LCGGTH + TG+I L  I 
Sbjct: 629 NVMDLEEAKALGATALFGEKYDQRVRVVSM-----GEYSIELCGGTHAARTGDIGLFRIQ 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E+   AGIRRIEA+TG+ A + L  Q ++L  +A  +K +   +  +V  + E  R L+
Sbjct: 684 GEAGTAAGIRRIEAVTGEAAIAQLHAQSDQLTDIAQVVKANHSYLNEKVRGLVENVRALE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + + Q   ++         ++     +   +S V+ K L++++D L+ ++ S +I+
Sbjct: 744 KELQQLRDQQAAQESASLSSKAVEVKGAKLLVSELSNVEPKMLRTMVDDLKNQLGSAVIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  VT+DL DR  A +L    A  + GG GGGRP +AQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVTKDLTDRVKAGELIGELAAQV-GGKGGGRPDLAQAGGTDAQALS 861

Query: 887 QAIAGVASFL 896
            A+  V  ++
Sbjct: 862 GALVSVPEWV 871


>gi|261346225|ref|ZP_05973869.1| alanine--tRNA ligase [Providencia rustigianii DSM 4541]
 gi|282565533|gb|EFB71068.1| alanine--tRNA ligase [Providencia rustigianii DSM 4541]
          Length = 875

 Score =  924 bits (2387), Expect = 0.0,   Method: Composition-based stats.
 Identities = 386/910 (42%), Positives = 549/910 (60%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHTKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRAYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + F+
Sbjct: 63  TTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIRFAWELLTSEQWFN 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY  D+EA+ +W K  G+ A++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYATDDEAYDIWNKEIGVPAERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG P    E+G+RYIEIWNLVFMQF +Q+      LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGTPEEDGDRYIEIWNLVFMQFNRQSDGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R++ VLQ   +NYDID+F+ LI A+ + TG      +  + RVI DH+RS +FLI+DG++
Sbjct: 243 RISAVLQHVNSNYDIDIFRELIAAAAEATGATD--LSNKSLRVIADHIRSCAFLISDGVI 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NEGRGYVLRRI+RRA+ +  +LG  +     L+P L   MG+A  EL + + ++E+ L
Sbjct: 301 PSNEGRGYVLRRIIRRAVRHGYMLGAKDTFFYKLVPTLIKVMGTAADELQRQQAMVEKVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L G+ AF+LYDT+G PLD+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLQLLDDELASLK-GDTLEGETAFRLYDTYGFPLDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F +A+E+QR RAR       S      + +L +    ++F GY           
Sbjct: 420 -VDEEGFERAMEDQRRRARE------SSGFGADYNALIKVDKRSEFSGYQHDEQ------ 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + + A+ + G+ V+   +G++  V+ D+T FYAE+GGQ+GDT
Sbjct: 467 -----------------QATITALYKDGQPVDALNAGEEGLVILDKTAFYAESGGQVGDT 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G    +     + D QK       H   VE G L     +   ++ + R  + +NHSATH
Sbjct: 510 GVLTNESGNFVVLDTQKYG-QAIGHVGKVESGSLVVNHRISARVNSERRNAIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  ILG HVSQ GS +    LRFD +H + +T  +L+ +ED VN  I QN  + T
Sbjct: 569 LLHAALRQILGEHVSQKGSLVNDKYLRFDFSHFEALTQQQLRQVEDIVNAQIRQNSEIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            +M+ E A A GA AL G KY +RVRV+S+     G  S  LCGGTH S TG+I L  I+
Sbjct: 629 ELMDLEGAKAKGAMALFGEKYEERVRVLSM-----GDFSIELCGGTHASRTGDIGLFSIL 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA TG  A  HL  Q E+L ++A  LK    ++V +V+   ++ R L+
Sbjct: 684 SESGTAAGVRRIEATTGATAIEHLHAQSEQLSAIAHLLKGDANSLVEKVKAALDKSRNLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  +  +   +++ D K L++++D L+ +++S II+
Sbjct: 744 KEILQLKDQQASQESASLGSKAKDVKGIKLLVSQLNDTDPKLLRTMVDDLKNQLKSAIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L   +   K S+++ VT DL  +  A DL    A+ + GG GGGRP MA +GG +     
Sbjct: 804 L-STTSGDKVSIIVGVTNDLTAKIKAGDLVSYVAQQV-GGKGGGRPDMAMAGGSDVKALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 TAMASVEQWV 871


>gi|260581631|ref|ZP_05849428.1| alanyl-tRNA synthetase [Haemophilus influenzae NT127]
 gi|260095224|gb|EEW79115.1| alanyl-tRNA synthetase [Haemophilus influenzae NT127]
          Length = 874

 Score =  924 bits (2387), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/913 (41%), Positives = 549/913 (60%), Gaps = 56/913 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAINFAWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDDEAYNIWNKDVGVPAERIIRIGDNKGSPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LP+ S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNVVFMQFNRLADGTMEKLPRPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+FK LI  + ++ G         + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFKTLIAKTAEIVGATD--LTNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P +   M  A  ++   ++ +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKESFFYKLVPTIIDVMAEAGKDVKAKQVNVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  L+ +  D++L+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LRLEEEQFARTLERGLNLLDEALAQVK-DDVLSGEVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID  +F++ +E QR+RA+A S           + S+    G T+F GY  +       
Sbjct: 418 T-IDEQAFDREMEAQRTRAQAASQFG------VDYNSVIRVDGETKFEGYTEVES----- 465

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + + A+   G+ VE   +GQ   V+ + TPFYAE+GGQ+GD
Sbjct: 466 ------------------QAKITALFYDGKSVESIEAGQSAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G     G+   + D QK    +F H   + +G L+   S+   +D + R   S+NHSAT
Sbjct: 508 SGYLSAQGVTFNVKDTQKYG-QVFGHIGELTQGSLKVGQSVNAIVDAKRRHNTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  ILG HV Q GS ++   LRFD    + IT  +L  IE  VN  I  N PV 
Sbjct: 567 HLLHAALRQILGLHVVQKGSLVSDKALRFDFAQPEAITKEQLSEIETLVNQKIRANFPVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM+ + A A GA AL G KY D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMDIDSAKAKGAMALFGEKYGDKVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           ++E+++ AGIRRIEA+T Q A   L  Q   L   A  LK     +V +++++ ++ +K+
Sbjct: 682 ITENAVAAGIRRIEAVTAQNAIDWLHNQQRILTQSADLLKSDVNTLVEKIQQLQDKTKKV 741

Query: 771 QLIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI  V+ ++  +  +++K L+ ++D L+ ++ SG+I
Sbjct: 742 EKELQGLKEKAAMQAGSDFVKSAVKINGVSVIAQQLDGIETKSLRVMVDDLKNQLGSGVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
               I  ++K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 AFASIL-DEKVNLVVGVTNDLTAKIKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQPENV 859

Query: 886 DQAIAGVASFLKK 898
            QAI     +L K
Sbjct: 860 AQAIKVAQDWLNK 872


>gi|268593120|ref|ZP_06127341.1| alanine--tRNA ligase [Providencia rettgeri DSM 1131]
 gi|291311391|gb|EFE51844.1| alanine--tRNA ligase [Providencia rettgeri DSM 1131]
          Length = 875

 Score =  923 bits (2386), Expect = 0.0,   Method: Composition-based stats.
 Identities = 382/911 (41%), Positives = 550/911 (60%), Gaps = 56/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHTKGHQVVSSSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRAYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + F+
Sbjct: 63  TTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIRFAWELLTSEEWFN 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY  D+EA+ +W K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYATDDEAYDIWNKEIGIPVERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWNLVFMQF +Q+      LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNLVFMQFNRQSDGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R++ VLQ   +NY+ID+F+ LI A+ + TG         + RVI DH+RS +FL++DG++
Sbjct: 243 RISAVLQHVNSNYEIDIFRDLIAAAAKATGATD--LENKSLRVIADHIRSCAFLVSDGVI 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NEGRGYVLRRI+RRA+ +  +LG  +     L+  L   MG A  EL + + ++E+ L
Sbjct: 301 PSNEGRGYVLRRIIRRAVRHGYMLGAKDTFFYKLVAPLIKVMGPAADELARQQAMVEKVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLQLLDEELASLK-GDTLDGEAAFRLYDTYGFPIDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F +A+E+QR RAR       S      + SL +    ++F GY           
Sbjct: 420 -VDEEGFERAMEDQRRRARE------SSGFGADYNSLIKVDKRSEFSGYQYDEQ------ 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + + A+ + G+ V+   +G++  V+ D+T FYAE+GGQ+GDT
Sbjct: 467 -----------------QATITALYKDGQPVDSLNAGEEGLVILDKTAFYAESGGQVGDT 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G    D    ++TD QK       H   VE G L     +   +D   R  + +NHSATH
Sbjct: 510 GYLNNDNASFKVTDTQKYG-QAIGHIGKVEAGSLVVNHRITAVVDSARRDAIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HVSQ GS +    LRFD +H + +T  +L+ +ED VN  I +N  + T
Sbjct: 569 LLHAALRQVLGDHVSQKGSLVNDKYLRFDFSHFEAMTQEQLRQVEDIVNAQIRKNSEIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            +M+ E A A GA AL G KY +RVRV+S+     G  S  LCGGTH   TG+I L  I+
Sbjct: 629 ELMDLEGAKAKGAMALFGEKYEERVRVLSM-----GDFSIELCGGTHARRTGDIGLFRIL 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA TG  A   +  Q E+L ++A  +K    ++V +V+   ++ R+L+
Sbjct: 684 SESGTAAGVRRIEATTGSMAIESIHNQSEQLSAIAHLVKGDINSLVEKVKAALDKSRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  +  +   +++ D K L++++D L+ +++S II+
Sbjct: 744 KEIVQLKDQQASQESASLSSKAKDVKGIKLLVTQLADTDPKLLRTMVDDLKNQLKSAIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L   +   K S+++ VT DL  +  A DL    A  + GG GGGRP MAQ+GG + +   
Sbjct: 804 L-STTSGDKVSMIVGVTNDLTAKVKAGDLISYIASQV-GGKGGGRPDMAQAGGTDVSALP 861

Query: 887 QAIAGVASFLK 897
            A+A V  +++
Sbjct: 862 AAMASVEEWVE 872


>gi|309973694|gb|ADO96895.1| Alanyl-tRNA synthetase [Haemophilus influenzae R2846]
          Length = 874

 Score =  923 bits (2386), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/913 (41%), Positives = 547/913 (59%), Gaps = 56/913 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAINFAWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDDEAYDIWNKEVGVPAERIIRIGDNKGSPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGS-SEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LP+ S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSLEEDGDRYIEIWNVVFMQFNRLADGTMEKLPRPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+FK LI  + +V G K    +  +  VI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFKTLIAKTAEVVGTKD--LSNKSLHVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  ++   +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKEAFFYKLVPTLIEVMAEAGKDVKAKQANVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  L+ +  + +L+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LRLEEEQFARTLERGLSLLDEALTQVK-NSVLSGEVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID  +F++ +E QR+RA+A S           + S+    G T+F GY  +       
Sbjct: 418 T-IDEQAFDREMEAQRTRAQAASQFG------VDYNSVIRVDGETKFEGYTEVES----- 465

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + + A+   G+ VE   +GQ   V+ + TPFYAE+GGQ+GD
Sbjct: 466 ------------------QAKITALFYDGKSVESIEAGQSAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G     G+   + D QK    +F H   + +G L+   S+   +D + R   S+NHSAT
Sbjct: 508 SGYLSTQGVTFNVKDTQKYG-QVFGHIGELTQGSLKVGQSVNAIVDAKRRHNTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  ILG HV Q GS ++   LRFD    + IT  +L  IE  VN  I  N PV 
Sbjct: 567 HLLHAALRQILGLHVVQKGSLVSDKVLRFDFAQPEAITKEQLSEIETLVNQKIRANFPVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM+ + A A GA AL G KY D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMDIDSAKAKGAMALFGEKYGDKVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           ++E+++ AG+RRIEA+TG+ A   L  Q   L   A  LK     +  +++++ E+ +K+
Sbjct: 682 ITENAVAAGVRRIEAVTGENAIEWLHNQQRILTQSADLLKSDVNTLAEKIQQLQEKAKKV 741

Query: 771 QLIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI  V+ ++  +  +++K L+ ++D L+ ++ SG+I
Sbjct: 742 EKELQGLKEKAAMQAGSDFVKSAVKINGVSVIAQQLDSIETKSLRVMVDDLKNQLGSGVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
               I  +KK ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 AFASIL-DKKVNLVVGVTNDLTAKIKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQPENV 859

Query: 886 DQAIAGVASFLKK 898
            QA+     +L K
Sbjct: 860 AQAVKVAQDWLNK 872


>gi|16272755|ref|NP_438974.1| alanyl-tRNA synthetase [Haemophilus influenzae Rd KW20]
 gi|1174496|sp|P43815|SYA_HAEIN RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|1573826|gb|AAC22473.1| alanyl-tRNA synthetase (alaS) [Haemophilus influenzae Rd KW20]
          Length = 874

 Score =  923 bits (2386), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/913 (42%), Positives = 545/913 (59%), Gaps = 56/913 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVR GGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRPGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAINFAWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDDEAYNIWNKDVGVPAERIIRIGDNKGSPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LP+ S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNVVFMQFNRLADGTMEKLPRPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+FK LI  + ++ G         + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFKTLIAKTAEIVGATD--LTNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  ++   +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKESFFYKLVPTLIDVMAEAGKDVKAKQTNVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  LS +  D IL+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LRLEEEQFARTLERGLSLLDEALSQVK-DGILSGEVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID  +F++ +E QR+RA+A S           + S+    G T+F GY  +       
Sbjct: 418 T-IDEQAFDRKMEAQRTRAQAASQFG------VDYNSVIRVDGETKFEGYTEVES----- 465

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + + A+   G+ VE   +GQ   V+ + TPFYAE+GGQ+GD
Sbjct: 466 ------------------QAKITALFYDGKSVESIEAGQSAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G      +   + D QK    +F H   + +G L+   S+   +D + R   S+NHSAT
Sbjct: 508 SGYLSTQSVTFNVKDTQKYG-QVFGHIGELTQGSLKVGQSVNAIVDAKRRHNTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  ILG HV Q GS ++   LRFD    + IT  +L  IE  VN  I  N PV 
Sbjct: 567 HLLHAALRQILGLHVVQKGSLVSDKALRFDFAQPEAITKEQLSEIETLVNQKIRANFPVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM+ + A A GA AL G KY D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMDIDSAKAKGAMALFGEKYGDKVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           ++E+++ AGIRRIEA+TGQ A   L  Q   L   A  LK     +  +++++ ++ +K+
Sbjct: 682 ITENAVAAGIRRIEAVTGQNAIDWLHNQQRILTQSADLLKSDVNTLAEKIQQLQDKAKKV 741

Query: 771 QLIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI  V+ ++  +  +++K L+ ++D L+ ++ SG+I
Sbjct: 742 EKELQGLKEKAAMQAGSYFVKSAVKINGVSVIAQQLDGIETKSLRVMVDDLKNQLGSGVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
               I  ++K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 AFASIL-DEKVNLVVGVTNDLTAKIKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQLENV 859

Query: 886 DQAIAGVASFLKK 898
            QAI     +L K
Sbjct: 860 TQAIKVAQDWLNK 872


>gi|15603152|ref|NP_246224.1| alanyl-tRNA synthetase [Pasteurella multocida subsp. multocida str.
           Pm70]
 gi|13431888|sp|P57933|SYA_PASMU RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|12721647|gb|AAK03371.1| AlaS [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 874

 Score =  923 bits (2386), Expect = 0.0,   Method: Composition-based stats.
 Identities = 390/913 (42%), Positives = 548/913 (60%), Gaps = 56/913 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SS+L+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHTKGHQIVASSALVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI   W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKKDAIHFGWEYLTSPRWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L   +L++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPAEKLWVTVYETDDEAYDIWNKEVGVPAERIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D GE I GG PGS  E+G+RYIEIWN+VFMQF +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGEHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRHADGTMEPLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+F+ LI    ++TG K    +  + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFQKLIAKVAELTGEKD--LSNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A   + + +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGNLLGAKEAFFYKLVPTLIDVMAEAGIGVKEKQATVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  L+++ K E L+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LRLEEEQFARTLERGLALLDEALANVKKGE-LSGEVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID + F++ +E QR RA++ S           + ++    G T F GY          
Sbjct: 418 T-IDEVGFDREMEAQRLRAQSASQFGM------DYNNVIRVEGCTTFEGYTASESL---- 466

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + V A+   G+ VE   +GQ   V+ + TPFYAE+GGQ+GD
Sbjct: 467 -------------------AKVTALFADGKPVERIEAGQSAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G   G G   ++ D QK    +F H   +  G L    S+   +D + R   S+NHSAT
Sbjct: 508 SGYLNGQGFSFEVKDTQKYG-QVFGHIGELVSGSLTVGKSVNAVVDVKRRHNTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV Q GS ++   LRFD  H + IT A+L  IE  VN  I  N  + 
Sbjct: 567 HLLHAALRQVLGEHVVQKGSLVSDVALRFDFAHHEAITKAQLVEIECLVNQQIRANHLIQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T +M  E A A GA AL G KY D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TELMELEAAKAKGAMALFGEKYADQVRVLTM-----GDFSIELCGGIHAKRTGDIGLCKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
            +E++I AGIRRIEAITG+ A S L  Q   L   A  LK    ++V +++++ ++ +K 
Sbjct: 682 TTETAIAAGIRRIEAITGENAMSWLHQQQALLAQSADLLKSDVNSIVEKIQQLQDKAKKA 741

Query: 771 QLIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI DV+ +   +  VD+K L+ V+D L+ ++ S +I
Sbjct: 742 EKELQVLKEKSAMQAGSDLARSAVKINDVSVIVQKLDGVDTKSLRVVVDDLKNQLSSAVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +   + +E K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 VFASVVEE-KVNLIVGVTSDLTSKVKAGELVNLLAQQV-GGKGGGRPDMAMAGGTQIENV 859

Query: 886 DQAIAGVASFLKK 898
           D A++   ++LK+
Sbjct: 860 DHALSFATTWLKE 872


>gi|254360816|ref|ZP_04976963.1| alanine--tRNA ligase [Mannheimia haemolytica PHL213]
 gi|261495705|ref|ZP_05992149.1| alanine--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|153092290|gb|EDN73359.1| alanine--tRNA ligase [Mannheimia haemolytica PHL213]
 gi|261308617|gb|EEY09876.1| alanine--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           OVINE]
          Length = 875

 Score =  923 bits (2386), Expect = 0.0,   Method: Composition-based stats.
 Identities = 374/911 (41%), Positives = 545/911 (59%), Gaps = 55/911 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   S IR +FLEFFQ  GH ++PSSSL+P NDPTL+FTN+GM  FK++F G EK  Y  
Sbjct: 1   MKTTSDIRQSFLEFFQTKGHTIVPSSSLVPENDPTLLFTNAGMNQFKDVFLGLEKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEM+GNFSFG YFK+ AI+  W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKQDAIKFGWEFLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +LY+TVY+ D+EA+ +W K  G+ ++ IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLYVTVYETDDEAYDIWHKEVGVPSEHIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G    GGLPGS  E+G+RYIE+WN+VFMQF +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGPEHWGGLPGSPEEDGDRYIEVWNIVFMQFNRLADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ERM  V+Q   +NY+ D+F+ LI+    +  +K    +  + RV+ DH+R+ S+LIADG+
Sbjct: 241 ERMTAVMQHVNSNYETDIFQTLIKEVATLLNVKD--LDNKSLRVVADHIRACSYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           LP+NEGRGYVLRRI+RRA+ +  +LG  E     L+P L T MG A   L Q +  I++T
Sbjct: 299 LPSNEGRGYVLRRIIRRAVRHGNILGAKEAFFYKLVPTLATVMGQAGEVLTQKQAHIQKT 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           L++E+E+F +TL+RGL LL+  L+ +  +  L+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LKAEEEQFARTLERGLNLLEEALAKVE-NNTLSGEVAFKLYDTYGFPLDLTADVCRERDI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   FN  +  QR RA+A      S +    + ++ +    T F GY     +    
Sbjct: 418 K-IDEDGFNAEMTAQRERAKA------SSSFGTDYNNVIKVDSKTCFSGYTETSLND--- 467

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + V  +   G+ VE   SG+   V+ D+TPFYAE GGQ+GD
Sbjct: 468 -------------------ATVIGLFSNGKSVESIQSGENAVVILDKTPFYAEMGGQVGD 508

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G    +    ++ D QK    +F H   +  G L     +   +D + R  +++NHSAT
Sbjct: 509 SGQISAEICNFEVVDTQKYG-QVFGHIGQLTSGSLSVGDKVNTIVDRERRHAITLNHSAT 567

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++ + LRFD++  + IT ++L+ +E  VN  + +N+ V+
Sbjct: 568 HLLHSALRQVLGDHVAQKGSLVSENILRFDISQPEAITKSQLEEVERIVNAKVRENIQVI 627

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
              M+ E A A GA AL G KY + VRVV +        S  LCGGTHV  TG+I L  I
Sbjct: 628 IEEMDIESAKAKGAMALFGEKYGEVVRVVEM-----SDFSIELCGGTHVKQTGDIGLFKI 682

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
            SE ++ AG+RRIEA+TG+ A + L    + ++  A  LK    + V ++ ++ E+ ++ 
Sbjct: 683 TSEGAVAAGVRRIEAVTGENAIAWLHTLQQAVQQSAELLKADSHSFVEKIVQLQEKAKRT 742

Query: 771 QLIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +    + K +L  +  S       +I  VN +   +  V+ K L++++D L+ ++ S ++
Sbjct: 743 EKELQQLKDKLAAQAGSDLAKQATQINGVNVVIQQLENVEPKALRTMVDDLKNQLGSAVV 802

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +    + E K ++++ VT+DL D+ NA  L    A+ + GG GGGRP MA +GG      
Sbjct: 803 V-FATTAEDKVNLIVGVTKDLTDKVNAGQLVGAMAEKV-GGKGGGRPDMAMAGGSEPQHL 860

Query: 886 DQAIAGVASFL 896
            QA++    ++
Sbjct: 861 LQALSLAQEWI 871


>gi|238756253|ref|ZP_04617569.1| Alanyl-tRNA synthetase [Yersinia ruckeri ATCC 29473]
 gi|238705508|gb|EEP97909.1| Alanyl-tRNA synthetase [Yersinia ruckeri ATCC 29473]
          Length = 874

 Score =  923 bits (2385), Expect = 0.0,   Method: Composition-based stats.
 Identities = 390/909 (42%), Positives = 558/909 (61%), Gaps = 55/909 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVSSSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRAYTRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  K F+
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAINFAWELLTSEKWFN 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN------DNFWSMAETGPCGPCS 173
           L + +L++TVY+ D+EA+ +W    G+  ++IIRI         DNFW M +TGPCGPCS
Sbjct: 123 LPKEKLWVTVYETDDEAYDIWANDVGVPRERIIRIGDKGAAFASDNFWQMGDTGPCGPCS 182

Query: 174 EIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLER 232
           EIF+D G+ I GG PGS+ E+G+RYIEIWN+VFMQF +Q+      LPK S+DTGMGLER
Sbjct: 183 EIFYDHGDHIWGGPPGSAEEDGDRYIEIWNIVFMQFNRQSDGTMLPLPKPSVDTGMGLER 242

Query: 233 MATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILP 292
           +A VLQ    NY+IDLF+ LI A   VTG      +  + RVI DH+RS +FLI+DG++P
Sbjct: 243 IAAVLQHVNTNYEIDLFRDLITAVADVTGASD--LSSKSLRVIADHIRSCAFLISDGVIP 300

Query: 293 ANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLR 352
           +NEGRGYVLRRI+RRA+ +  +LG  E     L+  L T MG A  EL Q + ++E+ L+
Sbjct: 301 SNEGRGYVLRRIIRRAIRHGNILGAKETFFYKLVAPLITVMGPAADELKQQQAMVEQVLK 360

Query: 353 SEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAG 412
           +E+E+F +TL+RGL LLD  LS L   + L+G+ AF+LYDT+G P+D+  D+   R L  
Sbjct: 361 TEEEQFARTLERGLALLDEELSQLT-GDTLDGETAFRLYDTYGFPVDLTADVCRERNLK- 418

Query: 413 IDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKED 472
           +D   F QA+E QR RAR       S      + SL     A++F+GYD +         
Sbjct: 419 VDEAGFEQAMEAQRRRARE------SSGFGADYNSLIRVDTASEFLGYDHIEQ------- 465

Query: 473 RKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTG 532
                            + V A+ + GE V+E  +G+   VV +QTPFY E+GGQ+GD G
Sbjct: 466 ----------------QATVIALFRNGEAVDEVHTGEDAVVVLNQTPFYGESGGQVGDEG 509

Query: 533 CAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHL 592
                     ++D QK  +    H   + RGILR   S+   +D   R ++ +NHSATHL
Sbjct: 510 VLKSAMADFIVSDTQKYGQ-AIGHLGQLSRGILRVNDSVDAVVDSMRRNRIRLNHSATHL 568

Query: 593 LHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTR 652
           LH AL   LG HV+Q GS +    LRFD +H + +   +++ +ED VN  I +NLP+ T 
Sbjct: 569 LHAALRKTLGEHVAQKGSLVNDKYLRFDFSHFEAMKPEQIRQVEDLVNAQIRRNLPIQTE 628

Query: 653 IMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVS 712
           +M  ++A   GA AL G KY+D+VRV+++     G  S+ LCGG H + TG+I L  I++
Sbjct: 629 LMELDEAKEKGAMALFGEKYDDQVRVLTM-----GDFSTELCGGIHANRTGDIGLFRILT 683

Query: 713 ESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQL 772
           ES   AGIRRIEA+TG+ A + L  Q + L+++A  +K    N+  ++  + +  + L+ 
Sbjct: 684 ESGTAAGIRRIEAVTGEGAMALLHQQSDLLQNIAHLVKGDSNNLTDKIRTVLDRSKALER 743

Query: 773 IHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
              + K Q   ++      S  ++  V  +   +  V++K L++++D L+ ++ S II+L
Sbjct: 744 ELQQLKDQQAAQESASLSASAKQVNGVKLLVSRLDNVEAKMLRTMVDDLKNQLGSAIIVL 803

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQ 887
              + + K S+++ VT+DL +R  A +L    A+ + GG GGGRP MAQ+GG +      
Sbjct: 804 ATTA-DDKVSLIVGVTKDLTNRVKAGELIADIAQKV-GGKGGGRPDMAQAGGTDVQALPS 861

Query: 888 AIAGVASFL 896
           A+A V +++
Sbjct: 862 ALASVEAWV 870


>gi|292487293|ref|YP_003530165.1| alanyl-tRNA synthetase [Erwinia amylovora CFBP1430]
 gi|292900336|ref|YP_003539705.1| alanyl-tRNA synthetase [Erwinia amylovora ATCC 49946]
 gi|291200184|emb|CBJ47312.1| alanyl-tRNA synthetase [Erwinia amylovora ATCC 49946]
 gi|291552712|emb|CBA19757.1| Alanyl-tRNA synthetase [Erwinia amylovora CFBP1430]
          Length = 876

 Score =  923 bits (2385), Expect = 0.0,   Method: Composition-based stats.
 Identities = 395/910 (43%), Positives = 555/910 (60%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FFQ  GH+++ SSSL+P NDPTL+FTN+GM  FK++F GQ+K  Y   
Sbjct: 3   KSTAEIRQAFLDFFQSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGQDKRNYTRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
            + Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + F 
Sbjct: 63  ASSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHEAIAFAWELLTSSQWFG 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY+ D+EAF +W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKEKLWVTVYETDDEAFNIWEKEIGVPRERIIRIGDNKGSAYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           SEIFFD G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 SEIFFDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMLPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+  VLQ   +NY+IDLF  LIQ+  QVTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RITAVLQHVNSNYEIDLFAQLIQSVAQVTGATD--LSNKSLRVIADHIRSCAFLIADGVI 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG        L+  L   MG+A  +L   +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAEGTFFYKLVAPLIAVMGAAGDDLKSQQSQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           R+E+E+F KTL+RGL LLD  L +L   ++L+G+  F+LYDT G P+D+  D+   R L 
Sbjct: 361 RTEEEQFAKTLERGLALLDEELENLQ-GDMLDGETVFRLYDTFGFPVDLTADVCRERNLK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            ID   F +A+E+QR RAR       +      + ++     A++F GY  L+       
Sbjct: 420 -IDEAGFERAMEQQRQRAR------DASGFGSDYNNVIRIDQASEFKGYQQLQ------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           +++ + AI   G+      +GQ+  +V D TPFYAE+GGQ+GDT
Sbjct: 466 ----------------LNAAISAIFVDGQAANTISAGQEGVIVLDATPFYAESGGQVGDT 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G+     +++ QK A+    H   +  G LR    +   +D   R ++ +NHSATH
Sbjct: 510 GKLQGNSASFIVSNTQKYAQ-AIGHSGKLAIGELRVGDCVAAQVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HVSQ GS +    LRFD +  + +T  E++ +E+ VN  I +NLP+ T
Sbjct: 569 LLHAALRQVLGQHVSQKGSLVNDTYLRFDFSQFEAMTPQEMRQVEEIVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM  E A A GA AL G KY+D VRV+S+     G  S+ LCGGTH S TG+I L  I 
Sbjct: 629 NIMELEAAKAHGAMALFGEKYDDHVRVLSM-----GDFSTELCGGTHASRTGDIGLFRIT 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + L  Q+E+L  +A  +K +  N+  +V  + +  R L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGALALLYSQNEQLVDIAQLVKANHSNLNEKVRALIDHARALE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +     +   +S+V+ K L++++D L+ ++ S II+
Sbjct: 744 KQLQQLKDQQAAQESASLSSKAIAVKGTKLLVSELSDVEPKMLRTMVDDLKNQLGSAIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ + K S++  VT+DL DR  A +L    A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-DGKVSLITGVTKDLTDRIKAGELVGELAQKV-GGKGGGRPDMAQAGGTDAMALP 861

Query: 887 QAIAGVASFL 896
            A+AGV S++
Sbjct: 862 AALAGVESWV 871


>gi|315499502|ref|YP_004088305.1| alanyl-tRNA synthetase [Asticcacaulis excentricus CB 48]
 gi|315417514|gb|ADU14154.1| alanyl-tRNA synthetase [Asticcacaulis excentricus CB 48]
          Length = 880

 Score =  923 bits (2385), Expect = 0.0,   Method: Composition-based stats.
 Identities = 446/904 (49%), Positives = 594/904 (65%), Gaps = 33/904 (3%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M +++ IR TFL++F KN HE++ SSSL+P NDPTLMFTN+GMV FKN+FTG E   Y+ 
Sbjct: 1   MPSLNQIRQTFLDYFAKNDHEIVSSSSLVPHNDPTLMFTNAGMVQFKNVFTGAETRPYKR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QK VRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE+AI  AW+L+TKE+ L
Sbjct: 61  ATTSQKVVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEQAISHAWNLITKEYGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + RL  TVY +D+EAF LWKKI+G S D+IIRI  +DNFWSM +TGPCGPC+EIF+D G
Sbjct: 121 PKDRLLATVYIDDDEAFNLWKKIAGFSDDRIIRIAGSDNFWSMGDTGPCGPCTEIFYDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           E I GG PGS  E+G+R++EIWNLVFMQF+QQ    R  LPK SIDTGMGLER+A VLQ 
Sbjct: 181 EHIWGGPPGSPEEDGDRFVEIWNLVFMQFDQQTDGTRLNLPKPSIDTGMGLERVAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             NNYD+DLFK LI+AS + TG+K EG  + +HRVI DHLRS+SFLIADG+ P+NEGRGY
Sbjct: 241 VHNNYDVDLFKALIRASVEETGVKAEGEALPSHRVIADHLRSTSFLIADGVTPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A LLG  EPLM  L P L  EMG  Y EL +A+  I ETLR E+ERF 
Sbjct: 301 VLRRIMRRAMRHAYLLGANEPLMPRLAPVLVREMGDHYGELKRAEATIIETLRQEEERFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           +TL RG+ LLD   ++L   ++L G+VAFKLYDT+G PLD+ QD + A+GL+ +++  F 
Sbjct: 361 RTLGRGMTLLDEATANLKDGDMLEGEVAFKLYDTYGFPLDLTQDAIRAKGLS-VNVAGFE 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+ EQ+ R RA+  G G  + +  WFS++++ GA++F+GY+ L                
Sbjct: 420 AAMGEQKQRGRANWKGSGETSVQAEWFSIRDQAGASEFVGYEHL---------------- 463

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                     S  + IV+ GE V E + G++++VVFD+T FY E GGQ GDTG     G 
Sbjct: 464 -------STQSHARVIVRDGESVSEGLVGERLQVVFDRTVFYPEGGGQAGDTGTLHWAGG 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
             ++ D QK+A  + VH   +  G+L     + L +D   R+    NHSA HLLH AL  
Sbjct: 517 EGRVLDTQKQAGDLIVHDVEITEGVLAVGDMVHLHVDGAKRQTTKSNHSAAHLLHAALKN 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG HV+Q G  +  + +RFD +H  P++  E++ IE  VN +I QN    T++M   +A
Sbjct: 577 VLGPHVAQKGQLVDAERMRFDFSHGAPVSPEEIERIEAEVNAVILQNEAATTKMMAPAEA 636

Query: 660 IASGAAALLGTKYNDRVRVVSVEYEDGGV---HSSALCGGTHVSSTGEIMLLYIVSESSI 716
           I +GA AL G KY D VRV+S+ +   G    +S  LCGGTHVS TG+I L  I+SES I
Sbjct: 637 IEAGAVALFGEKYGDEVRVLSLGHALDGADKGYSVELCGGTHVSRTGDIALFKIISESGI 696

Query: 717 RAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAK 776
            AG+RRIEA TG+ AR +L+ Q    +SLA   KV    V  RVE +  + ++L+   A 
Sbjct: 697 AAGVRRIEAFTGEAARQYLLEQAGVARSLADQFKVPVAQVSARVEALVNDRKRLEKELAD 756

Query: 777 RKLQLNV----EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISK 832
            K  L V    +      I  V  ++ ++  V  K+L+ + +  +K++ SG++ LVG+  
Sbjct: 757 AKRALAVGGGGKASGPEDINGVKVIARVLDGVGGKDLRPLAEDFKKQVGSGVVALVGVL- 815

Query: 833 EKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGV 892
           + KA+V + VT DL  RFNA +LA+ +   +GG G GG+P  AQ G P+  KA+  +  +
Sbjct: 816 DGKAAVTVAVTPDLTGRFNAAELAKAAVIAMGGQGAGGKPDFAQGGAPDATKAEGGLDAI 875

Query: 893 ASFL 896
            + +
Sbjct: 876 KAAI 879


>gi|284007755|emb|CBA73582.1| alanyl-tRNA synthetase [Arsenophonus nasoniae]
          Length = 899

 Score =  923 bits (2384), Expect = 0.0,   Method: Composition-based stats.
 Identities = 390/911 (42%), Positives = 544/911 (59%), Gaps = 56/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GHE++PSSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 26  KSTAEIRQAFLDFFHTKGHEIVPSSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRAYSRA 85

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI+ AW+LLT  + F+
Sbjct: 86  TTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAIKYAWELLTSEQWFN 145

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY  DE A+K+W++  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 146 LPKERLWVTVYHTDEAAYKIWQQEIGIPIERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 205

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D GE I GG PGS  E+G+RYIEIWN+VFMQF +Q+      LP  S+DTGMGLE
Sbjct: 206 TEIFYDHGEHILGGPPGSPEEDGDRYIEIWNIVFMQFNRQSDGSLKALPTPSVDTGMGLE 265

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NY+IDLF+ LI +  +   +     N  + RVI DH+RSS+FLI DG+ 
Sbjct: 266 RIAAVLQHVNSNYEIDLFRQLIASIAKAVALSD--LNNKSLRVIADHIRSSAFLIGDGVF 323

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           PANEGRGYVLRRI+RRA+ +  +LG  E     L+  L   MG    EL   +  IE+TL
Sbjct: 324 PANEGRGYVLRRIIRRAVRHGYMLGAKETFFYKLVAPLIQVMGDTADELKSHQATIEKTL 383

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL RGL LLD  L+ L   + L G++AF+LYDT+G P D+  D+   R + 
Sbjct: 384 KNEEEQFARTLARGLQLLDDELAQLQ-GDTLAGEIAFRLYDTYGFPFDLTADVCRERNIK 442

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   FN A+E+QR RAR       S      +  + +    + F GY+          
Sbjct: 443 -VDEAGFNAAMEQQRYRARE------SSGFATDYNDVIKVDSHSDFSGYEN--------- 486

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                         N   + V AI   G+ V     G++  ++ D+T FYAE+GGQ+GD+
Sbjct: 487 --------------NNQQATVIAIFHHGKSVNVLNQGEEGIIILDKTSFYAESGGQVGDS 532

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       +  ++D QK A     H   V  G +    S+   ID + R  + +NHSATH
Sbjct: 533 GILSNSHGQFAVSDTQKYA-QAIGHLGKVITGSITVNNSVEAKIDIERRNAIRLNHSATH 591

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HVSQ GS +    LRFD +H   +T  +++ IED VN  I +N P++T
Sbjct: 592 LLHAALRDVLGEHVSQKGSLVNEKYLRFDFSHFAAMTPKQIRQIEDIVNCQIRKNDPIIT 651

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            +M+ + A   GA AL G KY+ +VRV+S+     G  S  LCGGTH + TG+I L  I 
Sbjct: 652 TLMDLDAAKEKGAMALFGEKYDAKVRVLSI-----GDFSIELCGGTHANRTGDIGLFRIK 706

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AGIRRIEAITGQ A   L  Q + L  +   +K    +++ +++   ++ + L+
Sbjct: 707 SESGTAAGIRRIEAITGQAAIDDLHLQSQLLAEIGQLMKGDADSLMEKIKATLDKVKLLE 766

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++         KI  VN +   ++  + K+L+ ++D L+ +++S II+
Sbjct: 767 RSLNQLKGQQAAQESVSLSQKVKKINGVNLLVTQLNNTEPKQLRIIVDDLKNQLKSAIIV 826

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  IS + K S+++ VT DL  +  A DL    A+ + GG GGGRP MAQ+GG N     
Sbjct: 827 LSTISND-KVSLIVGVTNDLTAKIKAGDLISFVAQQV-GGKGGGRPDMAQAGGSNITALP 884

Query: 887 QAIAGVASFLK 897
            A+A V  ++ 
Sbjct: 885 AALASVEEWVN 895


>gi|261492574|ref|ZP_05989127.1| alanine--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261311733|gb|EEY12883.1| alanine--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 875

 Score =  923 bits (2384), Expect = 0.0,   Method: Composition-based stats.
 Identities = 374/911 (41%), Positives = 545/911 (59%), Gaps = 55/911 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   S IR +FLEFFQ  GH ++PSSSL+P NDPTL+FTN+GM  FK++F G EK  Y  
Sbjct: 1   MKTTSDIRQSFLEFFQTKGHTIVPSSSLVPENDPTLLFTNAGMNQFKDVFLGLEKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEM+GNFSFG YFK+ AI+  W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKQDAIKFGWEFLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +LY+TVY+ D+EA+ +W K  G+ ++ IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLYVTVYETDDEAYDIWHKEVGVPSEHIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G    GGLPGS  E+G+RYIE+WN+VFMQF +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGPEHWGGLPGSPEEDGDRYIEVWNIVFMQFNRLADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ERM  V+Q   +NY+ D+F+ LI+    +  +K    +  + RV+ DH+R+ S+LIADG+
Sbjct: 241 ERMTAVMQHVNSNYETDIFQTLIKEVATLLNVKD--LDNKSLRVVADHIRACSYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           LP+NEGRGYVLRRI+RRA+ +  +LG  E     L+P L T MG A   L Q +  I++T
Sbjct: 299 LPSNEGRGYVLRRIIRRAVRHGNILGTKEAFFYKLVPTLATVMGQAGEVLTQKQAHIQKT 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           L++E+E+F +TL+RGL LL+  L+ +  +  L+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LKAEEEQFARTLERGLNLLEEALAKVE-NNTLSGEVAFKLYDTYGFPLDLTADVCRERDI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   FN  +  QR RA+A      S +    + ++ +    T F GY     +    
Sbjct: 418 K-IDEDGFNAEMTAQRERAKA------SSSFGTDYNNVIKVDSKTCFSGYTETSLND--- 467

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + V  +   G+ VE   SG+   V+ D+TPFYAE GGQ+GD
Sbjct: 468 -------------------ATVIGLFSNGKSVESIQSGENAVVILDKTPFYAEMGGQVGD 508

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G    +    ++ D QK    +F H   +  G L     +   +D + R  +++NHSAT
Sbjct: 509 SGQISAEICNFEVVDTQKYG-QVFGHIGQLTSGSLSVGDKVNTIVDRERRHAITLNHSAT 567

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++ + LRFD++  + IT ++L+ +E  VN  + +N+ V+
Sbjct: 568 HLLHSALRQVLGDHVAQKGSLVSENILRFDISQPEAITKSQLEEVERIVNAKVRENIQVI 627

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
              M+ E A A GA AL G KY + VRVV +        S  LCGGTHV  TG+I L  I
Sbjct: 628 IEEMDIESAKAKGAMALFGEKYGEVVRVVEM-----SDFSIELCGGTHVKQTGDIGLFKI 682

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
            SE ++ AG+RRIEA+TG+ A + L    + ++  A  LK    + V ++ ++ E+ ++ 
Sbjct: 683 TSEGAVAAGVRRIEAVTGENAIAWLHTLQQAVQQSAELLKADSHSFVEKIVQLQEKAKRT 742

Query: 771 QLIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +    + K +L  +  S       +I  VN +   +  V+ K L++++D L+ ++ S ++
Sbjct: 743 EKELQQLKDKLAAQAGSDLAKQATQINGVNVVIQQLENVEPKALRTMVDDLKNQLGSAVV 802

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +    + E K ++++ VT+DL D+ NA  L    A+ + GG GGGRP MA +GG      
Sbjct: 803 V-FATTAEDKVNLIVGVTKDLTDKVNAGQLVGAMAEKV-GGKGGGRPDMAMAGGSEPQHL 860

Query: 886 DQAIAGVASFL 896
            QA++    ++
Sbjct: 861 LQALSLAQEWI 871


>gi|75675479|ref|YP_317900.1| alanyl-tRNA synthetase [Nitrobacter winogradskyi Nb-255]
 gi|123613615|sp|Q3ST43|SYA_NITWN RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|74420349|gb|ABA04548.1| alanyl-tRNA synthetase [Nitrobacter winogradskyi Nb-255]
          Length = 891

 Score =  923 bits (2384), Expect = 0.0,   Method: Composition-based stats.
 Identities = 464/901 (51%), Positives = 613/901 (68%), Gaps = 41/901 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+ FL +F  NGH+++PSS L+P NDPTLMFTN+GMV FKN+FTG EK  YQ 
Sbjct: 1   MSGVNDIRSAFLNYFAANGHQIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRPYQR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK+RAI+LAW L+T+EF L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKDRAIELAWKLVTQEFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + RL  TVY +D+ AF LWKKI+GL   +IIRI  +DNFW M +TGPCGPCSEIF+D G
Sbjct: 121 PKDRLTATVYIDDDGAFDLWKKIAGLPESRIIRIAGSDNFWQMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSSE-EGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + IPGG PGS E +G+R++EIWNLVFMQ+E+     R  LPK SIDTG GLER+A VLQ 
Sbjct: 181 DRIPGGPPGSPEQDGDRFVEIWNLVFMQYEKLPDGSRPNLPKPSIDTGAGLERVAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           K +NYDIDLF  LI+A+  +TG   +G    + RVI DHLR+SSFLIADG+LP+NEGRGY
Sbjct: 241 KHDNYDIDLFVALIRAAADLTGADPQGPMKASLRVIADHLRASSFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  L+  L  EMG A+PEL +A+ LIEETLR E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAREPLMWRLVGVLVREMGEAFPELQRARPLIEETLRLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL +LD   + L + ++ +G+ AF LYDT+G PLD+ QD L ARG  G+D+ SF 
Sbjct: 361 KTLERGLSILDEKSASLKQGDMFDGETAFTLYDTYGFPLDLTQDALRARG-IGVDLASFT 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E+Q+++ARA   G G    E IWF L+EK GAT+F+GY+                  
Sbjct: 420 DAMEQQKAKARASWSGSGEAAAESIWFPLREKLGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +V A+V+ GE  +   +G+   +V +QTPFY E+GGQ+GDTG  I DG+
Sbjct: 462 -----TEAAEGVVAALVKDGEEADTLKAGESGAIVLNQTPFYGESGGQVGDTGFLIADGV 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           R ++TD QKKA  +FVH   VE+G+L   M+L L +D+  R  +  NHSATHLLH AL  
Sbjct: 517 RFRVTDTQKKAGDLFVHLGTVEQGVLAPGMALALEVDHDRRSAIRANHSATHLLHEALRQ 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG H++Q GS + P+ LRFD  H+KPI++ EL+ IED  ND++ +N  V TR+M  +DA
Sbjct: 577 VLGDHIAQRGSLVAPERLRFDFAHNKPISADELRCIEDIANDVVLENGEVTTRLMAVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSVEYEDGG-------VHSSALCGGTHVSSTGEIMLLYIVS 712
             +GA AL G KY D VRVVS+   D           S  LCGGTHV  TG+I L+ +V 
Sbjct: 637 REAGARALFGEKYGDEVRVVSMGGTDRHGAASNALGWSVELCGGTHVKRTGDIGLISVVG 696

Query: 713 ESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQL 772
           ES++ +G+RRIEA+TG +AR H     +  K+ A  L+ S  ++  R+  + EE +KL+ 
Sbjct: 697 ESAVASGVRRIEALTGHQARHHANHAIQLAKTAAGELRTSLDDMPARIASLMEERKKLER 756

Query: 773 IHAKRKLQLNV---------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSG 823
             ++ + +L +                +  +  M+  +  ++ K+LKS+ D  +K++ SG
Sbjct: 757 ELSEARKKLAMGGAASASSGATTGVRDVGGIKLMARSVEGIEIKDLKSLADQGKKQLGSG 816

Query: 824 IIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGN 883
           ++ LV  S + KASV++ VT DL+ RF+AVDL R +++VLGG GGGG+P MAQ+GGP+G 
Sbjct: 817 VVALVATSGDGKASVVVGVTPDLVTRFSAVDLVRKASEVLGGKGGGGKPDMAQAGGPDGA 876

Query: 884 K 884
           K
Sbjct: 877 K 877


>gi|259909418|ref|YP_002649774.1| Alanyl-tRNA synthetase [Erwinia pyrifoliae Ep1/96]
 gi|224965040|emb|CAX56571.1| Alanyl-tRNA synthetase [Erwinia pyrifoliae Ep1/96]
 gi|283479495|emb|CAY75411.1| alaS [Erwinia pyrifoliae DSM 12163]
          Length = 876

 Score =  923 bits (2384), Expect = 0.0,   Method: Composition-based stats.
 Identities = 391/910 (42%), Positives = 556/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FFQ  GH+++ SSSL+P NDPTL+FTN+GM  FK++F GQ+K  Y   
Sbjct: 3   KSTAEIRQAFLDFFQSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGQDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           T+ Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + F 
Sbjct: 63  TSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIAFAWELLTSSQWFG 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY+ D+EAF +W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKEKLWVTVYETDDEAFDIWEKEIGVPRERIIRIGDNKGSAYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           SEIFFD G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 SEIFFDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQPDGTMLPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+  VLQ   +NY+IDLF  LI++  Q+TG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RITAVLQHVNSNYEIDLFAQLIKSVAQLTGATD--LSNKSLRVIADHIRSCAFLIADGVI 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG        L+  L   MG+A  +L   +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAEGTFFYKLVAPLIAVMGAAGDDLKSQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F KTL+RGL LLD  L +L   + L+G+  F+LYDT G P D+  D+   R L 
Sbjct: 361 KTEEEQFAKTLERGLALLDEELENLQ-SDTLDGETVFRLYDTFGFPADLTADVCRERNLK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            ID   F +A+E+QR RAR  S           + ++     A++F GY  L+       
Sbjct: 420 -IDEAGFERAMEQQRQRARDASGFGC------DYNNVIHIDQASEFKGYQQLQ------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           +++ + AI   G+  +   +G++  +V D TPFYAE+GGQ+GDT
Sbjct: 466 ----------------LNAAITAIFVDGQAADTISAGREGVIVLDATPFYAESGGQVGDT 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G+   L +++ QK A+    H   +  G LR    +   +D   R ++ +NHSATH
Sbjct: 510 GELQGNSASLIVSNTQKYAQ-AIGHSGKLATGELRVGERVAAQVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HVSQ GS +    LRFD +H + +T  E++ +E+ VN  I +NLP+ T
Sbjct: 569 LLHAALRQVLGQHVSQKGSLVNDKYLRFDFSHFEAMTQQEIRQVEEIVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM  E A A GA AL G KY+D VRV+S+     G  S+ LCGGTH + TG+I L  I 
Sbjct: 629 NIMELEAAKAHGAMALFGEKYDDHVRVLSM-----GDFSTELCGGTHATRTGDIGLFRIT 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + L  Q+++L  ++  +K +  N+  +V  + +  R L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGALAQLYSQNQQLADISHLVKANHSNLSEKVRALIDHARALE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +     +   +S+V+ K L++++D L+ ++ S II+
Sbjct: 744 KQLQQLKDQQAAQESASLSSKAIAVKGTKLLVSELSDVEPKMLRTMVDDLKNQLGSAIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ + K S++  VT+DL DR  A +L    A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-DGKVSLIAGVTKDLTDRIKAGELVGELAQKV-GGKGGGRPDMAQAGGTDAMALP 861

Query: 887 QAIAGVASFL 896
            A+AGV  ++
Sbjct: 862 AALAGVELWV 871


>gi|330446966|ref|ZP_08310617.1| alanyl-tRNA synthetase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491157|dbj|GAA05114.1| alanyl-tRNA synthetase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 874

 Score =  922 bits (2383), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/909 (41%), Positives = 536/909 (58%), Gaps = 55/909 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            +   IR  +L FF+  GH+++ SSSL+P NDPTL+FTN+GM  FK++F G EK  Y   
Sbjct: 3   MSTDEIRRAYLAFFESKGHQIVESSSLVPANDPTLLFTNAGMNQFKDVFLGLEKRSYTRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+ LT    L 
Sbjct: 63  TTAQRCVRAGGKHNDLENVGFTARHHTFFEMLGNFSFGDYFKHDAIAYAWEFLTSVLKLP 122

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN--------DNFWSMAETGPCGPCS 173
             RL +TVY+ D+EAF +W K  G+ AD+I+RI           DNFW M +TGPCGPC+
Sbjct: 123 ADRLVVTVYETDDEAFDIWNKEVGIPADRIVRIGDKKGGKPFESDNFWQMGDTGPCGPCT 182

Query: 174 EIFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLER 232
           EIF+D G+ I GG P    E+G+R+IEIWN VFMQF +Q       LPK S+DTGMG+ER
Sbjct: 183 EIFYDHGDHIWGGRPGTPEEDGDRFIEIWNNVFMQFNRQADGTMEPLPKPSVDTGMGIER 242

Query: 233 MATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILP 292
           +A ++Q   +NY+ID+F+ LI+ + +V G      +  + RV+ DH+RS ++LI+DG++P
Sbjct: 243 IAAIMQGVHSNYEIDIFQTLIKEAAKVIGFDD--LSNQSLRVVADHIRSCAYLISDGVMP 300

Query: 293 ANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLR 352
           +NEGRGYVLRRI+RRA+ +   LG        L+  L   MG+A  EL   + L+E+ L+
Sbjct: 301 SNEGRGYVLRRIIRRAVRHGNKLGAQGAFFYKLVGPLAEIMGTAGEELKAQQELVEKVLK 360

Query: 353 SEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAG 412
            E++ FG+TLDRGL +L+  L +L   ++L+G+  FKLYDT+G P D+  D+   RG + 
Sbjct: 361 IEEDNFGRTLDRGLTILNEALDNLD-GKVLDGETVFKLYDTYGFPADLTNDVARERGFS- 418

Query: 413 IDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKED 472
           ID   F  A+EEQR RAR       +G     +    +    T+F GY    G       
Sbjct: 419 IDEEGFEAAMEEQRQRAR------DAGNFGVDYNDAIKVDAETEFCGYSATDG------- 465

Query: 473 RKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTG 532
                              + A+ + G  V+   +G+   VV   TPFYAE+GGQ GD+G
Sbjct: 466 ----------------EGEIVALYRDGVAVDSVNAGEDALVVLTNTPFYAESGGQCGDSG 509

Query: 533 CAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHL 592
               +G+   + D QK       H   V  G L     L  ++D   R  +S+NHSATHL
Sbjct: 510 ILTAEGVLFNVADTQKFGA-AIGHKGQVAEGTLTVGQKLTASVDSARRAAISLNHSATHL 568

Query: 593 LHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTR 652
           +H AL  ILG HV+Q GS +  DGLRFD ++ + +   +L+++E  VND I  N  + T 
Sbjct: 569 MHAALRNILGEHVAQKGSLVKADGLRFDFSNLEAVKPEQLRAVEIMVNDQIRDNHAIETN 628

Query: 653 IMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVS 712
           IM+ E A A GA AL G KY+D VRV+S+     G  S+ LCGG H + TG+I L  I+S
Sbjct: 629 IMDIEAAKAKGAMALFGEKYDDEVRVLSM-----GEFSTELCGGIHATRTGDIGLFKILS 683

Query: 713 ESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQL 772
           ES I AGIRRIEA+TG  A   +  +D  L   A  +K    +VV +VE +    ++L+ 
Sbjct: 684 ESGIAAGIRRIEAVTGAAAIEAMHTEDAMLAKTARLVKSDSASVVSKVEALVSHSKQLEK 743

Query: 773 IHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
              + K +L  ++ +       +I  V  +   ++  D+K L+ ++D L+ ++ SG+++L
Sbjct: 744 EIQQLKDKLAAQEGANLINQAQEINGVKVLIAKLNGADNKALRGMVDELKNQLGSGVVLL 803

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQ 887
             +S + K  ++  VT+DL+ +  A +L  L A+ + GG GGGRP MAQ+GG +      
Sbjct: 804 GNVS-DDKVGLIAGVTKDLVGKVKAGELVNLVAQQV-GGKGGGRPDMAQAGGTDAAALPA 861

Query: 888 AIAGVASFL 896
           A+  VA +L
Sbjct: 862 ALETVAPWL 870


>gi|197104453|ref|YP_002129830.1| alanyl-tRNA synthetase [Phenylobacterium zucineum HLK1]
 gi|196477873|gb|ACG77401.1| alanyl-tRNA synthetase [Phenylobacterium zucineum HLK1]
          Length = 880

 Score =  922 bits (2383), Expect = 0.0,   Method: Composition-based stats.
 Identities = 437/904 (48%), Positives = 582/904 (64%), Gaps = 34/904 (3%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M++++ IRT FL+FFQ+  H ++PS+ L+P NDPTL+F N+GMVPFKN FTG E   +  
Sbjct: 1   MASLNEIRTHFLDFFQRKEHAVVPSAPLVPQNDPTLLFVNAGMVPFKNYFTGAEASPWPR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             + QK VRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKERAI  AW+LLTKE+ L
Sbjct: 61  AASSQKSVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKERAISHAWELLTKEWAL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
              +L +TVY  D+EA  LWKKI+GL   KI+RI T+DNFWSM +TGPCGPCSEIF+D G
Sbjct: 121 PVEKLMVTVYHTDDEAAALWKKIAGLPDHKIVRIPTSDNFWSMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           E IPGG P    E+G+R++EIWNLVFMQFEQ     R  LPK SIDTGMGLER+A VLQ 
Sbjct: 181 EHIPGGPPGSPDEDGDRFVEIWNLVFMQFEQFADGTRADLPKPSIDTGMGLERIAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NYD+DLFK LI  S +        +   +HRVI DHLRSSSFLIADG+LP+NEGRGY
Sbjct: 241 VHDNYDVDLFKDLIA-STKAQLRAEGSDTTPSHRVIADHLRSSSFLIADGVLPSNEGRGY 299

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A LLG  EPLM  + P L   MG AYPEL +A+  I ETLR E+ERF 
Sbjct: 300 VLRRIMRRAMRHAHLLGADEPLMHRVAPTLVNLMGEAYPELRRAEPAIVETLRQEEERFR 359

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           +TL RG+ LL+   + L   ++L+G+ AFKLYDT+G PLD+ QD + A+GL  +++  F 
Sbjct: 360 RTLGRGMTLLEEATAGLKDGDVLSGETAFKLYDTYGFPLDLTQDAVRAKGLT-VNLDEFE 418

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
           QA+  QR  AR + +G G       WFS++++ G + F GYD                  
Sbjct: 419 QAMARQREMARENWVGSGQVAAAAEWFSIRDRLGPSDFTGYDNTE--------------- 463

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                    +  +  +V +G+ +E A +GQ+V+ +FD+TPFYAE+GGQ GD G     G 
Sbjct: 464 --------ATGELLVLVSEGQEIERAGAGQRVQALFDRTPFYAESGGQAGDQGEVEWQGG 515

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           R ++TDVQK+A  + VH   +  G L     + L +D + R     NHSATHLLH AL  
Sbjct: 516 RARVTDVQKQAGDLHVHDLEILEGELVPGARVRLAVDAERRASTRSNHSATHLLHAALRN 575

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG HV+Q G  +  + +RFD +H +P+T+ E++ IE  VN ++ QNLP  T+ M  ++A
Sbjct: 576 VLGKHVTQKGQMVDGERIRFDFSHGQPLTAEEIERIEAEVNAVVRQNLPAQTKNMRPQEA 635

Query: 660 IASGAAALLGTKYNDRVRVVSVEYEDG--GVHSSALCGGTHVSSTGEIMLLYIVSESSIR 717
           I +GA AL G KY D VRV+++       G +S  LCGGTHV+ TG+I L  IVSE  + 
Sbjct: 636 IDAGAMALFGEKYGDSVRVLTLGRALDGEGDYSVELCGGTHVARTGDIALFKIVSEQGVA 695

Query: 718 AGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKR 777
           AG+RRIEA+TG+ AR +L+ Q    KSLA   KV    V  R+E +  + RKL+   A  
Sbjct: 696 AGVRRIEALTGEAARRYLLEQASVAKSLAEQFKVPVSEVSARIEALQAQARKLEKELADA 755

Query: 778 KLQLNVEDLSC-----HKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISK 832
           K QL +           +I  V  M+ ++  V  K+L+ + +  +K++  G+I LVG++ 
Sbjct: 756 KRQLAMGGGGGAAAGPEEIGGVKVMARVMEGVGGKDLRPIAEEFKKQLPDGVIALVGVA- 814

Query: 833 EKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGV 892
           + KA+V + VT     +FNA +LA+ +   +GG G GGRP  AQ G P+ +KA + +A V
Sbjct: 815 DGKAAVTVAVTGSATAKFNAAELAKAAVLAMGGQGAGGRPDFAQGGAPDASKAAEGLAAV 874

Query: 893 ASFL 896
            + L
Sbjct: 875 KALL 878


>gi|114320637|ref|YP_742320.1| alanyl-tRNA synthetase [Alkalilimnicola ehrlichii MLHE-1]
 gi|122311690|sp|Q0A8K7|SYA_ALHEH RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|114227031|gb|ABI56830.1| alanyl-tRNA synthetase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 869

 Score =  922 bits (2383), Expect = 0.0,   Method: Composition-based stats.
 Identities = 374/903 (41%), Positives = 526/903 (58%), Gaps = 46/903 (5%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M + + IR  FLEFF+  GH ++PSS L+P NDPTL+FTN+GMVPFK++F G+E+  Y  
Sbjct: 1   MKSSAEIRNAFLEFFEHRGHTVVPSSPLVPANDPTLLFTNAGMVPFKDVFLGKEQRGYTR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             + Q+CVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK  AI+ AW+ LT+   L
Sbjct: 61  ACSSQRCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKREAIEYAWEFLTRTIGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQ- 179
              RL++TVY+ED+EA  +W    G+  ++  RI   DNFWSM +TGPCGPCSEIF+D  
Sbjct: 121 PAERLWVTVYEEDDEAADIWLNEIGVDPERFGRIGAADNFWSMGDTGPCGPCSEIFYDHG 180

Query: 180 GECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
            E   G      E+G+RY+EIWNLVFMQ+++  +     LP   +DTGMGLER+A V+Q 
Sbjct: 181 PEVPGGPPGSPEEDGDRYVEIWNLVFMQYDRDAEGRLAPLPMPCVDTGMGLERLAAVVQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +N++IDLF+ LI A+  + G+  E ++  + +VI DH+R+ +FLI DG++PAN+GRGY
Sbjct: 241 VHSNFEIDLFRRLIGAAAALAGLP-EDSDNASLKVIADHIRACAFLITDGVVPANDGRGY 299

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRI+RRA+ +   LG  EP    L+  L  EMG A+PEL + + L+E  L  E++RF 
Sbjct: 300 VLRRIIRRAVRHGYKLGIDEPFFHRLVQPLADEMGGAFPELPERQALVERLLLQEEQRFR 359

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           +TL++GL LL+  L  L   EI  G+  FKL DT+G P+D+  DI   R L  +D+  F 
Sbjct: 360 ETLEQGLKLLEEDLRQLTGAEI-PGETVFKLADTYGFPVDLTADIARERDLT-LDMAGFE 417

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
             +  QR RARAHS         + +       G + FIGYD L G              
Sbjct: 418 ACMAAQRERARAHSQFKVQHGEGEQF------EGESHFIGYDQLEGH------------- 458

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                       V A+ + G  V+   +G++  V+ DQTPFYAE+GGQ+GD G     G 
Sbjct: 459 ----------GEVLALFRDGRSVQTLSAGEEGMVILDQTPFYAESGGQVGDQGVLETAGG 508

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
            +       K      H   +  G +     L   +D + R   ++NHSATHLLH AL  
Sbjct: 509 EVFEVRDTLKQGEGHGHLGRLREGRIHVGDRLRAQVDAETRWATALNHSATHLLHAALRG 568

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG+HV Q GS + PD LRFD  H +  ++ +L+ IE  VND I  N       M  +DA
Sbjct: 569 VLGTHVQQKGSLVAPDRLRFDFAHYEAPSTEQLEQIERIVNDEIRANRAADIEHMAYDDA 628

Query: 660 IASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAG 719
           I +GA AL G KY D+VRV+       G  S  LCGGTHV  TG+I L  ++SE  +  G
Sbjct: 629 IETGAMALFGEKYGDQVRVLRF-----GEFSIELCGGTHVERTGDIGLCKLISEGGVAGG 683

Query: 720 IRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKL 779
           +RRIEA+TG RA   +   +++L  +A  +K S  N   RV ++ +  +  +    + K 
Sbjct: 684 VRRIEAVTGDRAVMWVQRTEQRLVQVAETVKASPDNAAVRVAQLVDRLKGQEKELERLKQ 743

Query: 780 QLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEK 834
           +L  +  S        I  V  ++  + + D+K L+  +D L+ K+ + +I+L  ++ + 
Sbjct: 744 KLASQAGSDLAGQAVDIGGVKVVAARV-DADNKALRDTVDQLRNKLGTAVIVLGAVAGD- 801

Query: 835 KASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVAS 894
           K  ++  V++D  DR  A DL R  A+ + GG GGGRP  AQ+GG      + A+A V S
Sbjct: 802 KVRLVAGVSKDCTDRIKAGDLVRQVAEQV-GGKGGGRPDFAQAGGEQPEHLETALASVES 860

Query: 895 FLK 897
            ++
Sbjct: 861 LVR 863


>gi|170765841|ref|ZP_02900652.1| alanyl-tRNA synthetase [Escherichia albertii TW07627]
 gi|170124987|gb|EDS93918.1| alanyl-tRNA synthetase [Escherichia albertii TW07627]
          Length = 876

 Score =  922 bits (2382), Expect = 0.0,   Method: Composition-based stats.
 Identities = 398/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFG 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + + L+E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQALVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           +S  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LSGKVTALFVDGKAVDVINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L    ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLNVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLGEIAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|310766672|gb|ADP11622.1| Alanyl-tRNA synthetase [Erwinia sp. Ejp617]
          Length = 876

 Score =  922 bits (2382), Expect = 0.0,   Method: Composition-based stats.
 Identities = 389/910 (42%), Positives = 554/910 (60%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FFQ  GH+++ SSSL+P NDPTL+FTN+GM  FK++F GQ+K  Y   
Sbjct: 3   KSTAEIRQAFLDFFQSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGQDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           T+ Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + F 
Sbjct: 63  TSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIAFAWELLTSSQWFG 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY+ D+EA  +W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKEKLWVTVYETDDEALDIWEKEIGVPRERIIRIGDNKGSAYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           SEIFFD G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 SEIFFDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQPDGTMLPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+  VLQ   +NY+IDLF  LI++  Q+TG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RITAVLQHVNSNYEIDLFAQLIKSVAQLTGATD--LSNKSLRVIADHIRSCAFLIADGVI 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG        L+  L   MG+A  +L   +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAEGTFFYKLVAPLIAVMGAAGDDLKSQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F KTL+RGL LLD  L +L   + L+G+  F+LYDT G P D+  D+   R L 
Sbjct: 361 KTEEEQFAKTLERGLALLDEELENLQ-SDTLDGETVFRLYDTFGFPADLTADVCRERNLK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            ID   F +A+E+QR RAR  S           + ++     A++F GY  L+       
Sbjct: 420 -IDEAGFERAMEQQRQRARDASGFGC------DYNNVIHIDQASEFKGYQQLQ------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           +++ + AI   G+  +   +G++  +V D TPFYAE+GGQ+GDT
Sbjct: 466 ----------------LNAAITAIFVDGQAADTISAGREGVIVLDATPFYAESGGQVGDT 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G+     +++ QK A+    H   +  G LR    +   +D   R ++ +NHSATH
Sbjct: 510 GELQGNSASFIVSNTQKYAQ-AIGHSGKLATGELRVGDRVAAQVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HVSQ GS +    LRFD +H + +T  E++ +E+ VN  I +NLP+ T
Sbjct: 569 LLHAALRQVLGQHVSQKGSLVNDKYLRFDFSHFEAMTQQEIRQVEEIVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM  E A A GA AL G KY+D VRV+S+     G  S+ LCGGTH + TG+I L  I 
Sbjct: 629 NIMELEAAKAHGAMALFGEKYDDHVRVLSM-----GDFSTELCGGTHATRTGDIGLFRIT 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + L  Q+++L  ++  +K +  N+  +V  + +  R L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGALAQLYSQNQQLADISHLVKANHSNLSEKVRALIDHARALE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +     +   +S+V+ K L++++D L+ ++ S II+
Sbjct: 744 KQLQQLKDQQAAQESASLSSKAIAVKGTKLLVSELSDVEPKMLRTMVDDLKNQLGSAIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ + K S++  VT+DL DR  A +L    A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-DGKVSLIAGVTKDLTDRIKAGELVGELAQKV-GGKGGGRPDMAQAGGTDAMALP 861

Query: 887 QAIAGVASFL 896
            A+AGV  ++
Sbjct: 862 AALAGVELWV 871


>gi|260913378|ref|ZP_05919859.1| alanine-tRNA ligase [Pasteurella dagmatis ATCC 43325]
 gi|260632609|gb|EEX50779.1| alanine-tRNA ligase [Pasteurella dagmatis ATCC 43325]
          Length = 874

 Score =  922 bits (2382), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/912 (42%), Positives = 541/912 (59%), Gaps = 56/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHTKGHQIVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI   W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKKDAIHFGWEYLTSPRWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D+EA+ +W K  G+ A++I+RI  N       DNFW M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDDEAYNIWNKEVGVPAERIVRIGDNKGAPYASDNFWQMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D GE I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGEHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+F+ LI    ++TG K       + RV+ DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFQKLIAKVAELTGEKD--LTNKSLRVVADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M SA  ++ + +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGNLLGAKEAFFYKLVPTLIEAMASAGIQVKEKQANVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  L+ +  +E L+G VAFKLYDT+G P D+  D+   R +
Sbjct: 359 LRLEEEQFARTLERGLTLLDEALNQVKDNE-LSGKVAFKLYDTYGFPFDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F + +E QR RA++ S           + ++    G T F GY          
Sbjct: 418 T-IDEAGFEREMEAQRLRAQSASQFGM------DYNNVIRMDGVTVFEGYTESETL---- 466

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + V A+  +G+ VE   +GQ   ++ D TPFYAE+GGQ+GD
Sbjct: 467 -------------------AKVTALFCEGKPVERVEAGQSAVIILDNTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
            G   G     ++ D QK    +F H   V  G L     +   +D + R + S+NHSAT
Sbjct: 508 AGRLDGQDFAFEVEDTQKYGR-VFGHIGKVTIGSLAIGQLVNAVVDVERRHRTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG+HV Q GS ++   LRFD  H + IT  +L  IE  VN  I  N  + 
Sbjct: 567 HLLHAALRQVLGTHVVQKGSLVSDVALRFDFAHPEAITKEQLIEIERVVNQQIRANHVIQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM+ E A A GA AL G KY D+VRV+++     G  S  LCGG H   TG+I L  +
Sbjct: 627 TEIMDLEAAKAKGAMALFGEKYADQVRVLTM-----GDFSIELCGGIHAKRTGDIGLCKV 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           ++E++I AG+RRIEAITG+ A + L  Q   L   A  LK    ++V ++ +  E+ +K 
Sbjct: 682 IAETAIAAGVRRIEAITGENAITWLQEQQALLAQSAELLKSDVNSIVDKINQQQEKLKKT 741

Query: 771 QLIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K ++ V+  S        I  V+ +   ++ VDSK L+ ++D L+ ++ S +I
Sbjct: 742 EKELLSLKEKVAVQAGSDLAKNAININGVSVIIQQLNGVDSKSLRVMVDDLKNQLGSAVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
               +  E K ++++ V+ DL  +  A +L  + A+ + GG GGGRP MA +GG    K 
Sbjct: 802 AFASV-IEGKVNLIVGVSNDLTAKVKAGELVNVLAQEV-GGKGGGRPDMAMAGGTQVEKV 859

Query: 886 DQAIAGVASFLK 897
            QA+   + +LK
Sbjct: 860 SQALLVGSEWLK 871


>gi|307292727|ref|ZP_07572573.1| alanyl-tRNA synthetase [Sphingobium chlorophenolicum L-1]
 gi|306880793|gb|EFN12009.1| alanyl-tRNA synthetase [Sphingobium chlorophenolicum L-1]
          Length = 884

 Score =  922 bits (2382), Expect = 0.0,   Method: Composition-based stats.
 Identities = 438/904 (48%), Positives = 596/904 (65%), Gaps = 33/904 (3%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M++ + IR +FL++F  NGH ++PS+ L+P NDPTLMF N+GMVPFKN+FTG E   Y  
Sbjct: 1   MTSTNDIRRSFLDYFGANGHTIVPSAPLVPHNDPTLMFVNAGMVPFKNVFTGLESRPYST 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            T+ QK VRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE+AI  AW LLTKE+ L
Sbjct: 61  ATSSQKSVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEQAITHAWTLLTKEWGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
              +L  TVY  D+EAF LWKKI+GL  ++IIRI T DNFW+M ++GPCGPCSEIF+D G
Sbjct: 121 PAEKLTATVYHTDDEAFDLWKKIAGLPEERIIRIPTKDNFWAMGDSGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R++EIWNLVFMQ+EQ+  +    LPK SIDTGMGLER+A VLQ 
Sbjct: 181 DHIWGGPPGSPEEDGDRFVEIWNLVFMQYEQEANEIVSELPKPSIDTGMGLERIAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             NNYD D FK LI+ S  +T    +G +  +HRVI DHLRS+SFLIADG+LPANEGRGY
Sbjct: 241 VHNNYDTDTFKALIEESGALTKTATDGEHQASHRVIADHLRSTSFLIADGVLPANEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A ++G  EPLM  L+P+L +EMG AY EL++A+ LIEETL  E+ RF 
Sbjct: 301 VLRRIMRRAMRHAHIIGSKEPLMHRLVPSLVSEMGGAYQELVRAQPLIEETLLREETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           +TL++GL LLD     L +   L G+ AFKLYDT+G P D+ +D L +RGL G+D   F+
Sbjct: 361 QTLEKGLKLLDEATGDLSEGGTLPGETAFKLYDTYGFPYDLTEDALRSRGL-GVDREGFD 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
           +A+ EQ++ ARA   G G   +++IWF + EK G T+FIGY   +G              
Sbjct: 420 KAMAEQKAAARAAWKGSGEKASDEIWFDIAEKTGNTEFIGYSSTQG-------------- 465

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                       V AIV+ G   + A +G+ V +V +QTPFY E+GGQ+GD G       
Sbjct: 466 ---------EGEVVAIVKDGVNFDSAAAGETVLIVTNQTPFYGESGGQMGDAGTISSQSG 516

Query: 540 RL-QITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALS 598
            +  + D  K    +  H A +  G ++   ++ L++D   R ++  NHSATHLLH AL 
Sbjct: 517 LVADVEDTAKPLGRLHAHRAKIGAGSIKVGDTVHLSVDVNRRDRIRANHSATHLLHAALR 576

Query: 599 TILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNRED 658
             LG+HV+Q GS + PD LRFD +H + +T +++ +IE +VN+ +  N  V TR+M  +D
Sbjct: 577 NRLGAHVTQKGSLVAPDRLRFDFSHPEALTHSQIAAIEADVNEQVRHNEAVTTRLMTPDD 636

Query: 659 AIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRA 718
           AI +GA AL G KY D VRV+S+   D   +S  LCGGTHV +TG+I +  I+SES++ +
Sbjct: 637 AIQAGAMALFGEKYGDEVRVLSMGKGDAHSYSVELCGGTHVRATGDIAIFKIISESAVSS 696

Query: 719 GIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRK 778
           G+RRIEA+TG+ AR  L  ++++L+  A+ LK +   V  R+  + E+ R+L+   A+ K
Sbjct: 697 GVRRIEALTGEAARLWLSDREDRLRQSAAALKTTPEEVPARIAALVEQSRRLERELAEAK 756

Query: 779 LQLNVEDLSC------HKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISK 832
             L +            K+  VNF+  +I  +D KEL+ ++D  +  + SG+  ++ +  
Sbjct: 757 KALALGGGGSAQAAGPEKVGAVNFIGQVIEGLDPKELRGLVDQNKATLGSGVSAVLAVV- 815

Query: 833 EKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGV 892
           E +A++ + VT+DL+   +AVDL R   + LGG GGGGRP MAQ GGP G+KA+ AI  V
Sbjct: 816 EGRATIAVGVTDDLVGTISAVDLVRAGVEALGGKGGGGRPDMAQGGGPEGDKAEAAIEAV 875

Query: 893 ASFL 896
            + L
Sbjct: 876 KAAL 879


>gi|53725058|ref|YP_102626.1| alanyl-tRNA synthetase [Burkholderia mallei ATCC 23344]
 gi|67639261|ref|ZP_00438139.1| alanine--tRNA ligase [Burkholderia mallei GB8 horse 4]
 gi|254177470|ref|ZP_04884125.1| alanyl-tRNA synthetase [Burkholderia mallei ATCC 10399]
 gi|254199562|ref|ZP_04905928.1| alanyl-tRNA synthetase [Burkholderia mallei FMH]
 gi|254205880|ref|ZP_04912232.1| alanyl-tRNA synthetase [Burkholderia mallei JHU]
 gi|59798500|sp|Q62KZ3|SYA_BURMA RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|52428481|gb|AAU49074.1| alanyl-tRNA synthetase [Burkholderia mallei ATCC 23344]
 gi|147749158|gb|EDK56232.1| alanyl-tRNA synthetase [Burkholderia mallei FMH]
 gi|147753323|gb|EDK60388.1| alanyl-tRNA synthetase [Burkholderia mallei JHU]
 gi|160698509|gb|EDP88479.1| alanyl-tRNA synthetase [Burkholderia mallei ATCC 10399]
 gi|238519796|gb|EEP83263.1| alanine--tRNA ligase [Burkholderia mallei GB8 horse 4]
          Length = 874

 Score =  922 bits (2382), Expect = 0.0,   Method: Composition-based stats.
 Identities = 382/911 (41%), Positives = 537/911 (58%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTSVYKLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY +D+EA+ +W K  G+ A++IIRI  N       DNFW M +TGPCGPCSE
Sbjct: 121 ADKLWVTVYHDDDEAYDIWAKEVGVPAERIIRIGDNKGARYASDNFWQMGDTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+AS + TG+    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQQLIKASARETGVADLANN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG   P    L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKAPFFHKLVADLVAEMGAAYPELKEAEPRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ L     + L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALAELDAAGGKTLDGELAFKLHDTYGFPLDLTADVCRERGVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYTGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+  +G  V E  +G+   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVEGASVGEVKAGESAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    +   ID   R + + NHSATH
Sbjct: 509 GVLANAATRFAVGDTLKVQADVIGHHGELEQGTLKVGDVVRAEIDAARRARTARNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD  H+ P+T  E++ +E  VN+ +  N P + 
Sbjct: 569 LMHKALRDVLGSHVQQKGSLVDADKTRFDFAHNAPLTDDEIRRVEAIVNEQVLANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  +DA+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 629 RVMPYDDAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           +E  + AGIRR+EAITG  A  ++   D ++ + A+ LK     ++ R+ ++ ++ + L+
Sbjct: 683 AEGGVAAGIRRVEAITGDNAVRYVQALDARVNAAAAALKAQPSELLQRIGQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             ++  V+ ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSKLASSQGDELAQQAVEVGGVHVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +    K S++  VT D   +  A +L    A+ + GG GGGR  MAQ+GG    K  
Sbjct: 803 LAAVD-GGKVSLIAGVTADASKKVKAGELVNFVAQQV-GGKGGGRSDMAQAGGTEPAKLP 860

Query: 887 QAIAGVASFLK 897
            A+AGV  +++
Sbjct: 861 AALAGVKGWVE 871


>gi|301155669|emb|CBW15137.1| alanyl-tRNA synthetase [Haemophilus parainfluenzae T3T1]
          Length = 874

 Score =  922 bits (2382), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/911 (42%), Positives = 547/911 (60%), Gaps = 56/911 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVASSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAINFAWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDNEAYDIWHKEVGVPAERIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LP+ S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNVVFMQFNRQADGTMEKLPRPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+F+ LI  + +V G         + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFQKLIAKTAEVVGTTD--LTNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  E+ + +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKEAFFYKLVPTLIEVMAEAGKEVKEKQANVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  L+ +  D +L+G+VAFKLYDT+G PLD+  D+   R  
Sbjct: 359 LRLEEEQFARTLERGLSLLDDALAQVK-DGVLSGEVAFKLYDTYGFPLDLTADVCRERD- 416

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F + +E QR RA++ S           + ++    G T+F GY          
Sbjct: 417 IAIDEAGFEREMEAQRLRAQSASQFGM------DYNNVIRVEGETKFEGYTESESL---- 466

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + V A+   G+ V+   +GQ   V+ + TPFYAE+GGQ+GD
Sbjct: 467 -------------------AKVTALFHDGKSVDSITAGQSAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G     GI+  + D QK    +F H   +E+G L+   ++   +D   R Q S+NHSAT
Sbjct: 508 SGYLTSQGIQFNVKDTQKYG-QVFGHIGELEQGTLKVGQTVNAVVDAARRHQTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV Q GS ++   LRFD  H + IT A+L  IE  VN  + +N  V 
Sbjct: 567 HLLHAALRQVLGHHVVQKGSLVSDTALRFDFAHPEAITKAQLNEIETLVNQKVRENFVVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T +M+ E A A GA AL G KY+D VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDVMDIEAAKAKGAMALFGEKYSDVVRVLTM-----GDFSVELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           V+E+++ AG+RRIEA+TG+ A + L  Q   L   A   K     +V +++++ ++ +K 
Sbjct: 682 VAETAVAAGVRRIEAVTGENAINWLHNQQRILTQSADLFKSDVNTLVEKIQQLQDKAKKA 741

Query: 771 QLIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI DV+ + H +  +++K L+ ++D L+ ++ SG+I
Sbjct: 742 EKELQGLKEKAAMQAGSDLVKSAVKINDVSVIVHQLDGIETKSLRVMVDDLKNQLGSGVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +   I  + K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 VFASIL-DDKVNLVVGVTSDLTTKVKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQPENV 859

Query: 886 DQAIAGVASFL 896
           + A+    ++L
Sbjct: 860 NLALTVAQNWL 870


>gi|94498454|ref|ZP_01305011.1| alanyl-tRNA synthetase [Sphingomonas sp. SKA58]
 gi|94422102|gb|EAT07146.1| alanyl-tRNA synthetase [Sphingomonas sp. SKA58]
          Length = 884

 Score =  921 bits (2381), Expect = 0.0,   Method: Composition-based stats.
 Identities = 443/904 (49%), Positives = 598/904 (66%), Gaps = 33/904 (3%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M++ + IR +FL++F  NGH ++PS+ L+P NDPTLMF N+GMVPFKN+FTG E   Y+ 
Sbjct: 1   MTSTNDIRRSFLDYFGGNGHTIVPSAPLVPHNDPTLMFVNAGMVPFKNVFTGLETRPYKT 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            T+ QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE+AI  AW LLTKE+ L
Sbjct: 61  ATSSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEQAITHAWTLLTKEWGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
              RL  TVY  D+EAF LWKKI+GL  ++IIRI T DNFW+M ++GPCGPCSEIF+D G
Sbjct: 121 PADRLTATVYHTDDEAFDLWKKIAGLPEERIIRIATKDNFWAMGDSGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R++EIWNLVFMQ+EQ+  +    LP+ SIDTGMGLER+A V+Q 
Sbjct: 181 DHIWGGPPGSPEEDGDRFVEIWNLVFMQYEQEANEIVSELPRPSIDTGMGLERVAAVMQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
            T+NYD D FK LI  S  ++    +G +  +HRVI DHLRS+ FLIADG+LPANEGRGY
Sbjct: 241 VTDNYDTDTFKALIAESGALSRTATDGAHKASHRVIADHLRSTGFLIADGVLPANEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A ++G  EPLM  L+ +L +EMG AYPEL++A+ LIEETL  E+ RF 
Sbjct: 301 VLRRIMRRAMRHAHIIGAKEPLMYRLVSSLVSEMGGAYPELVRAQPLIEETLLREETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+ GL LLD     L +   L G+ AFKLYDT+G P D+ +D L +RGL  +D   F+
Sbjct: 361 KTLENGLKLLDEATGDLAEGGTLAGETAFKLYDTYGFPYDLTEDALRSRGLT-VDRAGFD 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+ EQ++ ARA   G G   +++IWF + EK G T+FIGY                   
Sbjct: 420 AAMAEQKAAARAAWKGSGEKASDEIWFDIAEKAGNTEFIGY------------------- 460

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T      V AIV+ G   + A +G  V +V +QTPFY E+GGQ+GD G     G 
Sbjct: 461 ----ATTQGEGEVLAIVKDGVNFDSAAAGDTVTIVTNQTPFYGESGGQMGDAGRITTQGG 516

Query: 540 RLQITDVQKKA-EGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALS 598
            + + D   K    +  HHA +E G ++   ++ L++D   R ++  NHSATHLLH AL 
Sbjct: 517 FVALVDDTAKPLGRVHAHHATIEAGSIKVGDTVHLSVDVDRRDRIRANHSATHLLHAALR 576

Query: 599 TILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNRED 658
             LG+HV+Q GS +  D LRFD +H + +T A++ +IE +VN  +  N  V TR+M  +D
Sbjct: 577 KELGAHVTQKGSLVAADRLRFDFSHPEALTHAQIAAIEADVNAQVRHNEEVTTRLMTPDD 636

Query: 659 AIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRA 718
           A+A+GA AL G KY D VRV+S+   D   +S  LCGGTHV +TG+I L  IVSES++ +
Sbjct: 637 AVAAGAMALFGEKYGDEVRVLSMGRGDDAHYSVELCGGTHVRATGDIALFKIVSESAVSS 696

Query: 719 GIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRK 778
           G+RRIEA+TG+ AR  L+ +D+KL+  A+ LK +  +V  R+  + E+ RKL+   A+ K
Sbjct: 697 GVRRIEALTGEAARLWLVERDDKLRQTAAALKTTPEDVPTRIAALVEQSRKLERELAEAK 756

Query: 779 LQLNVEDLSC------HKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISK 832
             L +   S        KI +++F+  +I  +D KEL+ ++D  +  + SG+  ++ +  
Sbjct: 757 KALALGGGSAAQTAGPEKIGNIDFLGQVIEGLDPKELRGIVDQNKATLGSGVSAVLAVV- 815

Query: 833 EKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGV 892
           + +AS+ + VT+DL  + +AVDL R   + LGG GGGGRP MAQ GGP+G+KA  A+  V
Sbjct: 816 DGRASIAVGVTDDLKGQISAVDLVRAGVEALGGKGGGGRPDMAQGGGPDGDKATAALDAV 875

Query: 893 ASFL 896
            + L
Sbjct: 876 KTAL 879


>gi|161525078|ref|YP_001580090.1| alanyl-tRNA synthetase [Burkholderia multivorans ATCC 17616]
 gi|189350179|ref|YP_001945807.1| alanyl-tRNA synthetase [Burkholderia multivorans ATCC 17616]
 gi|205830000|sp|A9AC16|SYA_BURM1 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|160342507|gb|ABX15593.1| alanyl-tRNA synthetase [Burkholderia multivorans ATCC 17616]
 gi|189334201|dbj|BAG43271.1| alanyl-tRNA synthetase [Burkholderia multivorans ATCC 17616]
          Length = 874

 Score =  921 bits (2381), Expect = 0.0,   Method: Composition-based stats.
 Identities = 382/911 (41%), Positives = 539/911 (59%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTLMFTNSGMV FK++F G ++  Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDRRPYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIRFAWELLTTVYMLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW+M +TGPCGPC+E
Sbjct: 121 KDKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWTMGDTGPCGPCTE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPEVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKPCVDTGMGLERL 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ +VT +     N  + +VI DH+R+ +FLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIKAAARVTEVSD--LNNNSLKVIADHIRACAFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGAFFHKLVADLVAEMGAAYPELKEAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ L     ++L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILESALADLEAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKAAQG-------LEYTGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVDGSAVTEVKAGQDAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    L   ID Q R +   NHSATH
Sbjct: 509 GVLANASTRFAVADTLKVQADVIGHHGTLEQGTLKVGDVLRAEIDAQRRARTQRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD  H+ P+T  E++ +E  VND I  N P + 
Sbjct: 569 LMHKALREVLGSHVQQKGSLVDADKTRFDFAHNAPLTDDEIRRVEQIVNDEILANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHVS TG+I L  IV
Sbjct: 629 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVSRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   D ++   A+ LK     +  R+ ++ ++ + L+
Sbjct: 683 MEGGVAAGIRRVEAITGDNAVRYVQELDARVNEAAAALKAQPAELTQRIAQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
              A  K +L             ++  V+ ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELAALKSKLASSQGDELAQQAVEVGGVHVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT +   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LAAV-EGGKVSLIAGVTAEASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLK 897
            A+AGV  +++
Sbjct: 861 AALAGVKGWVE 871


>gi|319897692|ref|YP_004135889.1| alanyl-tRNA synthetase [Haemophilus influenzae F3031]
 gi|317433198|emb|CBY81572.1| alanyl-tRNA synthetase [Haemophilus influenzae F3031]
          Length = 874

 Score =  921 bits (2381), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/913 (41%), Positives = 546/913 (59%), Gaps = 56/913 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+F N+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFANAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAINFAWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D+EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDDEAYNIWNKDVGVPAERIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LP+ S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNVVFMQFNRLADGTMEKLPRPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+FK  I  + ++ G         + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFKTFIAKTAEIVGATD--LTNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  ++   +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKESFFYKLVPTLIEVMAEAGKDVKAKQTNVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  LS +  D IL+G+VAFKLYDT+G PLD+  D+   R +
Sbjct: 359 LRLEEEQFARTLERGLSLLDEALSQVK-DGILSGEVAFKLYDTYGFPLDLTADVCRERNI 417

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID  +F++ +E QR+RA++ S           + S+    G T+F GY  +       
Sbjct: 418 T-IDEQAFDREMEAQRTRAQSASQFG------VDYNSVIRVDGETKFEGYTEVES----- 465

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + + A+   G+ VE   +GQ   V+ + TPFYAE+GGQ+GD
Sbjct: 466 ------------------QAKITALFYDGKSVESIEAGQSAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G     G+   + D QK    +F H   + +G L+   S+   +D + R  +S+NHSAT
Sbjct: 508 SGYLSAQGVTFNVKDTQKYG-QVFGHIGELTQGSLKVGQSVNAIVDAKRRHNISLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  ILG HV Q GS ++   LRFD    + IT  +L  IE  VN  I  N PV 
Sbjct: 567 HLLHAALRQILGLHVVQKGSLVSDKALRFDFAQPEAITKEQLSEIEILVNQKIRANFPVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T IM+ + A A GA AL G KY D+VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDIMDIDSAKAKGAMALFGEKYGDKVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           ++E+++ AGIRRIEA+TGQ A   L  Q   L      LK     +V +++++ ++ +K+
Sbjct: 682 ITENAVAAGIRRIEAVTGQNAIDWLHNQQRILTQSTDLLKSDVNTLVEKIQQLQDKTKKV 741

Query: 771 QLIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI  V+ ++  +  +++K L+ ++D L+ ++ SG+I
Sbjct: 742 EKELQGLKEKAAMQAGSDFVKSAVKINGVSVIAQQLDGIETKSLRVMVDDLKNQLGSGVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
               I  ++K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 AFASIL-DEKVNLVVGVTNDLTAKIKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQPENV 859

Query: 886 DQAIAGVASFLKK 898
            QAI     +L K
Sbjct: 860 AQAIKVAQDWLNK 872


>gi|294141935|ref|YP_003557913.1| alanyl-tRNA synthetase [Shewanella violacea DSS12]
 gi|293328404|dbj|BAJ03135.1| alanyl-tRNA synthetase [Shewanella violacea DSS12]
          Length = 874

 Score =  921 bits (2380), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/909 (42%), Positives = 555/909 (61%), Gaps = 54/909 (5%)

Query: 3   NVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVT 62
             +++RT FLE+F KNGH+++ SSSL+P NDPTL+FTN+GM  FK++F G++K  Y   T
Sbjct: 4   TTAALRTAFLEYFHKNGHQVVDSSSLVPVNDPTLLFTNAGMNQFKDVFLGEDKRNYTRAT 63

Query: 63  TVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQ 122
           + Q+CVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK  AI  AW+ LT+E  + +
Sbjct: 64  SSQRCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKREAITYAWNFLTQELKIPK 123

Query: 123 RRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSEI 175
            RL +T+Y+ D EA+ +W K  G+S D +IRI  N       DNFW M +TGPCGPCSEI
Sbjct: 124 ERLCVTIYETDNEAYDIWTKEIGVSEDNLIRIGDNKGAPYASDNFWQMGDTGPCGPCSEI 183

Query: 176 FFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMA 234
           F+D GE I GG P    E+G+R+IEIWN+VFMQ+ +Q+  +   LPK S+DTGMG+ER+A
Sbjct: 184 FYDHGEHIWGGRPGTPEEDGDRFIEIWNIVFMQYNRQSNGDMLALPKPSVDTGMGIERIA 243

Query: 235 TVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPAN 294
            ++Q   +NY+ID+F+ LI+ + ++  +        + RVI DH+RS +FLIADG++P+N
Sbjct: 244 AIMQGVHSNYEIDIFQALIKKTAEILAVTD--LENKSLRVISDHIRSCAFLIADGVMPSN 301

Query: 295 EGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSE 354
           EGRGYVLRRI+RRA+ +   LG T+     L+P L   MG A   L++ + ++ ++L++E
Sbjct: 302 EGRGYVLRRIIRRAVRHGNKLGATDSFFYKLVPTLILVMGDAAKGLVETQDIVVKSLKAE 361

Query: 355 DERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGID 414
           +E+F +TL+RGL +LDG L+ L   ++L+G+ AFKLYDT+G P+D+  D+   R +  +D
Sbjct: 362 EEQFARTLERGLGILDGALNALT-GKVLDGETAFKLYDTYGFPVDLTADVCREREIT-VD 419

Query: 415 IISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRK 474
              F  A+ EQR RA+A       G     +    +    T+F GY  L           
Sbjct: 420 EAGFELAMSEQRKRAQAA------GQFATDYNDSLKIDEETEFSGYLDLVS--------- 464

Query: 475 VLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCA 534
                         ++ + AI ++GE V E  +G++  VV D TPFY E+GGQ GD+G  
Sbjct: 465 --------------NAKITAIYKEGESVTEINAGEEAVVVLDTTPFYGESGGQSGDSGTL 510

Query: 535 IGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLH 594
              G    + D QK       H   ++ G L    SL  ++D   R++  +NHS THLLH
Sbjct: 511 SAAGFDFIVKDTQKYG-QAIGHIGTLKTGSLSLGQSLEASVDKALRQRTELNHSVTHLLH 569

Query: 595 HALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIM 654
            AL  +LG+HVSQ GS + P+ LRFD +H + +   EL+++ED VN  I  N  +  ++M
Sbjct: 570 AALRQLLGTHVSQKGSLVDPERLRFDFSHFEGVKPEELQAVEDLVNTQIRCNHELTAQVM 629

Query: 655 NREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
             + A   GA AL G KY D VRVV++     G  S  LCGGTHV  TG+I L  I SE+
Sbjct: 630 TIDAAKDKGAMALFGEKYADEVRVVTM-----GDFSIELCGGTHVGRTGDIGLFKITSEA 684

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
            I AGIRRIEA+TG  A +++ GQ  +L   A  LK   G+VV +++   +  ++L+   
Sbjct: 685 GIAAGIRRIEAVTGAAAMAYVAGQKSELDKAAKLLKADAGSVVTKLKAQLDRTKQLEKEL 744

Query: 775 AKRKLQLNVE-----DLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVG 829
           ++ K +L             +I  V  +   +  V+   L+ ++D L++K+ SGI++L G
Sbjct: 745 SQLKDKLAAATSADLAGEAQEINGVKVLIKKLDGVEPGALRGLLDELKQKLGSGIVVL-G 803

Query: 830 ISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAI 889
           I+ + K ++++ VT+DL  +  A +L    A  + GG GGGRP MAQ+GG      D A+
Sbjct: 804 IAGDAKVNLIVGVTKDLTSKVKAGELVANIAAQV-GGKGGGRPDMAQAGGSKPENLDAAL 862

Query: 890 AGVASFLKK 898
             VAS+L++
Sbjct: 863 NQVASWLQE 871


>gi|194290351|ref|YP_002006258.1| alanyl-tRNA synthetase [Cupriavidus taiwanensis LMG 19424]
 gi|193224186|emb|CAQ70195.1| alanyl-tRNA synthetase [Cupriavidus taiwanensis LMG 19424]
          Length = 874

 Score =  921 bits (2380), Expect = 0.0,   Method: Composition-based stats.
 Identities = 390/910 (42%), Positives = 538/910 (59%), Gaps = 55/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
             VS IR+ FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G +K  Y   
Sbjct: 1   MKVSDIRSKFLQFFESKGHTVVRSSSLVPANDPTLLFTNSGMVQFKDVFLGTDKRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLTK + L 
Sbjct: 61  TSAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIQYAWELLTKTYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY ED+EA+ +W K  G+ A++I+RI  N       DNFW MA+TGPCGPCSE
Sbjct: 121 AEKLWVTVYAEDDEAYDIWAKEVGVPAERIVRIGDNKGARYASDNFWQMADTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIE+WNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEVWNLVFMQFNRDEQGNMTPLPKPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+A+ + T +     N  + +VI DH+R+ +FLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQALIKAAARETHID--NLNQNSLKVIADHIRACAFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG   P    L+P L  +MG AYPEL +A+  + E L++
Sbjct: 299 NEGRGYVLRRIIRRAIRHGYKLGQKTPFFHKLVPDLVEQMGQAYPELAEAQSRVTEVLKA 358

Query: 354 EDERFGKTLDRGLVLLDGVLS--HLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +LD  L+   L   + L+G++AFKL+DT G PLD+ QD+   +   
Sbjct: 359 EEERFFETIENGMAILDAALAELKLKGGKTLDGELAFKLHDTFGFPLDLTQDVCREQ-EI 417

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
           G+D  +F+ A+  QR +ARA      +         L+     T F GY+ L        
Sbjct: 418 GVDEAAFDAAMSRQREQARAAGKFKMAAG-------LEYIGDKTVFHGYEKLELP----- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V+    GQ   VV D TPFYAE+GGQ GD 
Sbjct: 466 -----------------QAKVTALYVDGAAVDTMQPGQTGVVVLDNTPFYAESGGQAGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G          + D  K    +F H   ++ G L+   ++   +D   R +   NHSATH
Sbjct: 509 GVLKAGNAVFAVADTTKIQADVFGHQGTLQGGALKVGDAVSAQVDALRRARTVRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD +H+  +T A+++ +E+ VN  I +N     
Sbjct: 569 LMHKALREVLGSHVQQKGSLVDADKTRFDFSHNAALTDAQIRQVEEIVNAEILRNEDTHA 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            +M  +DA+ SGA AL G KY D VRV+S+        S  LCGGTHV  TG+I L  IV
Sbjct: 629 EVMPFDDAVKSGAMALFGEKYADDVRVLSIG------TSKELCGGTHVHRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  +L G D KL   A+ LK     +V R+ ++ E+ R L+
Sbjct: 683 MEGGVAAGIRRVEAITGDNALHYLQGLDAKLNEAAAVLKAQPSELVPRIGQVQEQVRALE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K +L              +  +  ++  +   D K L+  MD L+ K+QS  I+
Sbjct: 743 KELERLKSKLAASQGDELAAQAVDVKGLKVLAAQLDGADVKTLRETMDKLKDKLQSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ + K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG    K  
Sbjct: 803 LGAVA-DGKVSLIAGVTADATGKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPAKLP 860

Query: 887 QAIAGVASFL 896
           QA+AGV+ ++
Sbjct: 861 QALAGVSEWV 870


>gi|257454192|ref|ZP_05619462.1| alanyl-tRNA synthetase [Enhydrobacter aerosaccus SK60]
 gi|257448365|gb|EEV23338.1| alanyl-tRNA synthetase [Enhydrobacter aerosaccus SK60]
          Length = 890

 Score =  921 bits (2380), Expect = 0.0,   Method: Composition-based stats.
 Identities = 367/915 (40%), Positives = 526/915 (57%), Gaps = 52/915 (5%)

Query: 3   NVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVT 62
           + + IR  F+ +F +NGH  + SSSL+P NDPTL+FTN+GM  FK++F G +K  Y+   
Sbjct: 6   SSADIRQAFINYFAENGHTPVASSSLVPHNDPTLLFTNAGMNQFKDVFLGIDKRDYKRAV 65

Query: 63  TVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFDL 120
           + QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK++AI   W+ LT  K   L
Sbjct: 66  SSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKQQAIPFCWEFLTSDKWLGL 125

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCS 173
            + +LY+TVY  D+EAF +W  + GL A++IIRI  N       DNFW+M +TGPCGPC+
Sbjct: 126 PKDKLYVTVYHTDDEAFDIWHNVVGLPAERIIRIGDNKGGQYQSDNFWAMGDTGPCGPCT 185

Query: 174 EIFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLER 232
           E+F+D GE I GGLP    E+G+R++EIWN VFMQF +Q       LP  S+DTGMGLER
Sbjct: 186 EVFYDHGEHIWGGLPGTPEEDGDRFVEIWNNVFMQFNRQKDGTLEKLPAPSVDTGMGLER 245

Query: 233 MATVLQEKTNNYDIDLFKHLIQASEQVT--GMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ++ ++Q   +NY+ID+F HL+Q + QV       +  +  + +V+ DH+RS SFLIADG+
Sbjct: 246 ISAIMQGVHSNYEIDIFTHLMQHAAQVIGLPNDIDLQSEPSLKVLADHIRSVSFLIADGV 305

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           LP+NEGRGYVLRRI+RRA+ +   LG T+     L+  L   MG AYP+L + +  IE+ 
Sbjct: 306 LPSNEGRGYVLRRIIRRAVRHGNKLGATDNFFYKLVAPLAQIMGDAYPQLREQQANIEQA 365

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           +  E+E+F KTL +GL LL   L  L   + L+G   FKLYDT+G P D+  DI+  R  
Sbjct: 366 ILKEEEQFAKTLSQGLKLLSQELDSLKSGDTLSGATVFKLYDTYGFPADLTADIVRERD- 424

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F Q + +QR+RAR        G     +  L +   AT+F+GYD         
Sbjct: 425 ISIDEAGFEQGMAQQRARAREA------GKFGVDYNQLIQVDSATEFLGYDKAEH----- 473

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                             SS +  +  +G+  E+   G +  +V   TPFYAE GGQ G+
Sbjct: 474 ------------------SSTITHLYLEGKSAEQLQEGDEGVIVLSATPFYAEGGGQAGE 515

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
            G    +    ++ D +K  + I   H +V+ G +R   S    +  Q R   + NHSAT
Sbjct: 516 LGDIQTETGVFEVQDTKKSGQAIIH-HGVVKMGSIRQGQSSEARVASQVRAMSAKNHSAT 574

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL   LG+ V+Q GS +  + LRFD ++ K +T  ++ +IE+ VN  I  N P  
Sbjct: 575 HLLHAALREHLGTGVTQKGSLVNSEVLRFDFSYDKALTEQDIITIENIVNQQILANQPAT 634

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVE--YEDGGVHSSALCGGTHVSSTGEIMLL 708
             +++   A   GA AL G KY D VRV+S+    +DG   S  LCGG HV  TG+I L 
Sbjct: 635 VEMLSMTQAQDKGAMALFGEKYGDTVRVLSMGTVDKDGKPFSIELCGGLHVQRTGDIGLF 694

Query: 709 YIVSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYR 768
            IVSE  I AGIRRIEA+TG  A  ++   +++L  LAS LK  +  +  RV ++ ++ R
Sbjct: 695 KIVSEQGIAAGIRRIEAVTGMGAVKYVQQGEKQLNQLASQLKAKRDEIADRVNQMTDKTR 754

Query: 769 KLQLIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSG 823
            L+    + + +L              I     +   +  +D K L+++ D ++ K+  G
Sbjct: 755 DLEKQLERLQQKLASSQAKDLINNVQDINGQKVLIASLPGMDGKALRTIADDMKSKLHDG 814

Query: 824 IIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGN 883
           I++L G++ + K ++   V +DL  +  A D+ +  ++ L GG GGG+P  AQ G  +  
Sbjct: 815 IVVLAGVA-DDKIALTASVGKDLTSKIKAGDIIKHLSEQL-GGKGGGKPDFAQGGATDVA 872

Query: 884 KADQAIAGVASFLKK 898
                +  + ++L +
Sbjct: 873 GLPTVLDALPNWLAE 887


>gi|85715195|ref|ZP_01046179.1| alanyl-tRNA synthetase [Nitrobacter sp. Nb-311A]
 gi|85698110|gb|EAQ35983.1| alanyl-tRNA synthetase [Nitrobacter sp. Nb-311A]
          Length = 892

 Score =  921 bits (2379), Expect = 0.0,   Method: Composition-based stats.
 Identities = 465/902 (51%), Positives = 610/902 (67%), Gaps = 42/902 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+ FL FF  N H+++PSS L+P NDPTLMFTN+GMV FKN+FTG EK  YQ 
Sbjct: 1   MSGVNDIRSAFLNFFAANDHQIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRSYQR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK+RAI+LAW L+T+EF L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKDRAIELAWKLVTQEFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + RL  TVY +D+EAF LWKKI+GL   +IIRI   DNFW M +TGPCGPCSEIF+D G
Sbjct: 121 PKDRLTATVYIDDDEAFDLWKKIAGLPESRIIRIAGADNFWQMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + IPGG P    E+G+R++EIWNLVFMQ+E+ +   R  LPK SIDTG GLER+A VLQ 
Sbjct: 181 DRIPGGPPGSPDEDGDRFVEIWNLVFMQYEKLSDGSRPNLPKPSIDTGAGLERVAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           K +NYDIDLF  LI+A+  +TG   +G    + RVI DHLR+SSFLIADG+LP+NEGRGY
Sbjct: 241 KHDNYDIDLFVALIRAAADLTGADPQGPMKASLRVIADHLRASSFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  L+  L  EMG AYPEL +A+ LIEETLR E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAREPLMWRLVGVLVREMGEAYPELQRARSLIEETLRLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTLDRGL +LD   + L K ++ +G+ AF LYDT+G PLD+ QD L ARG  G+D+ SF 
Sbjct: 361 KTLDRGLSILDEKSASLKKGDMFDGETAFTLYDTYGFPLDLTQDALRARG-IGVDLASFT 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E+Q+++ARA   G G    E IWF L+EK GAT+F+GY+                  
Sbjct: 420 DAMEQQKAKARASWSGSGEAAAESIWFPLREKLGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +V A+VQ G+  +   +G+   +V +QTPFY E+GGQ+GDTG    DG+
Sbjct: 462 -----TESAEGVVVALVQDGKETDILKAGESGAIVLNQTPFYGESGGQVGDTGALTADGV 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
             ++TD QKKA  +FVH  IVE+G+L   M+L L +D+  R  +  NHSATHLLH AL  
Sbjct: 517 CFRVTDTQKKAGDLFVHLGIVEQGVLAPGMALALEVDHDRRAAIRANHSATHLLHEALRQ 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG H++Q GS + P+ LRFD  H+KPI+  EL+ IED  ND++ +N  V TR+M  +DA
Sbjct: 577 VLGDHIAQRGSLVAPERLRFDFAHNKPISGDELRRIEDIANDVVLENGEVTTRLMAVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSVEY-------EDGGVHSSALCGGTHVSSTGEIMLLYIVS 712
             +GA AL G KY D VRVVS+          +    S  LCGGTHV  TG+I L+ ++S
Sbjct: 637 REAGARALFGEKYGDEVRVVSMGGAGRQGAPSNALGWSVELCGGTHVKRTGDIGLISVIS 696

Query: 713 ESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQL 772
           ES++ +G+RRIEA+TG RAR H     +  K+ A  L+ S  ++  R+  + EE +KL+ 
Sbjct: 697 ESAVASGVRRIEALTGHRARHHANDAIQLAKTAAGELRTSLDDMPARIAALVEERKKLER 756

Query: 773 IHAKRKLQLNV----------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQS 822
             ++ + +L +                 +  +  M+  +  ++ K+LKS+ D  +K++ S
Sbjct: 757 ELSEARKKLAMGGGAASASSGAATGVRDVGGIKLMARSVEGIEIKDLKSLADQGKKQLGS 816

Query: 823 GIIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNG 882
           G++ LV  S + KASV++ VT DL+ RF+AVDL R +++VLGG GGGG+P MAQ+GGP+G
Sbjct: 817 GVVALVATSGDGKASVVVGVTPDLVTRFSAVDLVRKASEVLGGKGGGGKPDMAQAGGPDG 876

Query: 883 NK 884
            K
Sbjct: 877 AK 878


>gi|331017460|gb|EGH97516.1| alanyl-tRNA synthetase [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 874

 Score =  921 bits (2379), Expect = 0.0,   Method: Composition-based stats.
 Identities = 389/912 (42%), Positives = 537/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL FF++ GH  +PSSSLIP NDPTL+FTN+GM  FK+ F GQEK  Y   
Sbjct: 1   MKSAEIREAFLGFFEEQGHTRVPSSSLIPGNDPTLLFTNAGMNQFKDCFLGQEKRAYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
            T QKCVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW  LT  K  +
Sbjct: 61  VTSQKCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAITYAWTFLTSEKWLN 120

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY  D+EA+ +W K  G+ A++++RI  N       DNFW+M +TGPCGPC
Sbjct: 121 LPKEKLWVTVYATDDEAYDIWTKEIGVPAERMVRIGDNKGAPYASDNFWTMGDTGPCGPC 180

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           SEIFFD G  I GG PGS  E+G+RYIEIWN VFMQF +        LP  S+DTGMGLE
Sbjct: 181 SEIFFDHGADIWGGPPGSPEEDGDRYIEIWNNVFMQFNRTADGVLHPLPAPSVDTGMGLE 240

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R++ VLQ   +NY+IDLF+ L+ AS    G     +N  + +V+ DH+RS  FLIADG+L
Sbjct: 241 RVSAVLQHVHSNYEIDLFQSLLTASANAIGCS--NDNQASLKVVADHIRSCGFLIADGVL 298

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P++EGRGYVLRRI+RRA  +   LG        ++ AL  EMGSA+PEL+Q +  IE  L
Sbjct: 299 PSSEGRGYVLRRIIRRACRHGNKLGAKGSFFYQIVAALVAEMGSAFPELVQQQSHIERVL 358

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           R E+E+F KTL++GL +++  L+ L    ++ G++ FKLYDT+G P+D+  DI   R L 
Sbjct: 359 RGEEEQFAKTLEQGLKIIEQDLAELK-GTVVPGEIVFKLYDTYGFPMDLTGDIARERNLT 417

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F + +E QR RAR+ S           + SL +   ATQF GY    G      
Sbjct: 418 -LDEEGFEREMEAQRVRARSASSFGM------DYNSLVKVDVATQFTGYSATTG------ 464

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                            S+ V A+ + G+ V     G++  V+ D TPFYAE+GGQ+GD+
Sbjct: 465 -----------------SASVVALYKDGQSVTHLNEGEEGVVILDTTPFYAESGGQIGDS 507

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G  +    R  ++D  K     F+HH +V  G L   + +   +  + R    +NHSATH
Sbjct: 508 GFLLAGDARFDVSDTTKTGG-AFLHHGVVASGSLSVGVQVETQVADEVRDATKLNHSATH 566

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV Q GS +    LRFD +H + I   +L+++ED VN  I +N PVVT
Sbjct: 567 LLHAALRQVLGEHVQQKGSLVDSQRLRFDFSHFESIKPEQLRALEDIVNAEIRKNTPVVT 626

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
              + + A   GA AL G KY D VRV+S+    GG  S  LCGG H S TG+I L  IV
Sbjct: 627 EETDIDTAKKKGAMALFGEKYGDSVRVLSM----GGEFSVELCGGIHASRTGDISLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SE  + AG+RRIEA+TG  A + L   +++LK  A+ +K ++ N++ ++  + E  R L+
Sbjct: 683 SEGGVAAGVRRIEAVTGAAALAWLNSAEDQLKEAATLVKGNRDNLLDKLTAVLERNRLLE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + + +           +   +  V  ++  +   D K L +++D L+ K+   +I+
Sbjct: 743 KQLEQLQAKAASAAGDDLSSAALDVKGVKVLATRLDGQDGKALLALVDQLKNKLGRAVIL 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +  E K  ++  VT+DL  +  A DL + +A  + GG GGGRP MAQ GG +    D
Sbjct: 803 LGSVH-EDKVVLVAGVTKDLTGQLKAGDLMKQAATAV-GGKGGGRPDMAQGGGVDATALD 860

Query: 887 QAIAGVASFLKK 898
            A+A    F+++
Sbjct: 861 SALALAVPFVEQ 872


>gi|28869047|ref|NP_791666.1| alanyl-tRNA synthetase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|37999391|sp|Q885J0|SYA_PSESM RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|28852287|gb|AAO55361.1| alanyl-tRNA synthetase [Pseudomonas syringae pv. tomato str.
           DC3000]
          Length = 874

 Score =  921 bits (2379), Expect = 0.0,   Method: Composition-based stats.
 Identities = 389/912 (42%), Positives = 538/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL FF++ GH  +PSSSLIP NDPTL+FTN+GM  FK+ F GQEK  Y   
Sbjct: 1   MKSAEIREAFLGFFEEQGHTRVPSSSLIPGNDPTLLFTNAGMNQFKDCFLGQEKRAYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
            T QKCVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW  LT  K  +
Sbjct: 61  VTSQKCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAITYAWTFLTSEKWLN 120

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY  D+EA+ +W K  G+ A++++RI  N       DNFW+M +TGPCGPC
Sbjct: 121 LPKEKLWVTVYATDDEAYDIWTKEIGVPAERMVRIGDNKGAPYASDNFWTMGDTGPCGPC 180

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           SEIFFD G  I GG PGS  E+G+RYIEIWN VFMQF +        LP  S+DTGMGLE
Sbjct: 181 SEIFFDHGADIWGGPPGSPEEDGDRYIEIWNNVFMQFNRTADGVLHPLPAPSVDTGMGLE 240

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R++ VLQ   +NY+IDLF+ L+ AS    G     +N  + +V+ DH+RS  FLIADG+L
Sbjct: 241 RVSAVLQHVHSNYEIDLFQSLLTASANAIGCS--NDNQASLKVVADHIRSCGFLIADGVL 298

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P++EGRGYVLRRI+RRA  +   LG        ++ AL  EMGSA+PEL+Q +  IE  L
Sbjct: 299 PSSEGRGYVLRRIIRRACRHGNKLGAKGSFFYQIVAALVAEMGSAFPELVQQQSHIERVL 358

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           R E+E+F KTL++GL +++  L+ L    ++ G++ FKLYDT+G P+D+  DI   R L 
Sbjct: 359 RGEEEQFAKTLEQGLKIIEQDLAELK-GTVVPGEIVFKLYDTYGFPMDLTGDIARERNLT 417

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F + +E QR RAR+ S           + SL +   ATQF GY    G      
Sbjct: 418 -LDEEGFEREMEAQRVRARSASSFGM------DYNSLVKVDVATQFTGYSATTG------ 464

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                            S+ V A+ + G+ V    +G++  V+ D TPFYAE+GGQ+GD+
Sbjct: 465 -----------------SASVVALYKDGQSVTHLNAGEEGVVILDTTPFYAESGGQIGDS 507

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G  +    R  ++D  K     F+HH +V  G L   + +   +  + R    +NHSATH
Sbjct: 508 GFLLAGDARFDVSDTTKTGG-AFLHHGVVASGSLSVGVQVETQVADEVRDATKLNHSATH 566

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV Q GS +    LRFD +H + I   +L+++ED VN  I +N PVVT
Sbjct: 567 LLHAALRQVLGEHVQQKGSLVDSQRLRFDFSHFESIKPEQLRALEDIVNAEIRKNTPVVT 626

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
              + + A   GA AL G KY D VRV+S+    GG  S  LCGG H S TG+I L  IV
Sbjct: 627 EETDIDTAKKKGAMALFGEKYGDSVRVLSM----GGEFSVELCGGIHASRTGDISLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SE  + AG+RRIEA+TG  A + L   +++LK  A+ +K ++ N++ ++  + E  R L+
Sbjct: 683 SEGGVAAGVRRIEAVTGAAALAWLNSAEDQLKEAATLVKGNRDNLLDKLTAVLERNRLLE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + + +           +   +  V  ++  +   D K L +++D L+ K+   +I+
Sbjct: 743 KQLEQLQAKAASAAGDDLSSAALDVKGVKVLATRLDGQDGKALLALVDQLKNKLGRAVIL 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +  E K  ++  VT+DL  +  A DL + +A  + GG GGGRP MAQ GG +    D
Sbjct: 803 LGSVH-EDKVVLVAGVTKDLTGQLKAGDLMKQAATAV-GGKGGGRPDMAQGGGVDATALD 860

Query: 887 QAIAGVASFLKK 898
            A+A    F+++
Sbjct: 861 SALALAVPFVEQ 872


>gi|127512149|ref|YP_001093346.1| alanyl-tRNA synthetase [Shewanella loihica PV-4]
 gi|205830205|sp|A3QC89|SYA_SHELP RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|126637444|gb|ABO23087.1| alanyl-tRNA synthetase [Shewanella loihica PV-4]
          Length = 874

 Score =  920 bits (2378), Expect = 0.0,   Method: Composition-based stats.
 Identities = 385/909 (42%), Positives = 557/909 (61%), Gaps = 54/909 (5%)

Query: 3   NVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVT 62
             +++R+ FLEFF++NGH+++ SSSL+P NDPTL+FTN+GM  FK++F G++K  Y   T
Sbjct: 4   TTAALRSAFLEFFRRNGHQVVDSSSLVPGNDPTLLFTNAGMNQFKDVFLGEDKRDYSRAT 63

Query: 63  TVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQ 122
           T Q+CVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK+ AI+ AW  LT+E  L +
Sbjct: 64  TAQRCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKQDAIRFAWTFLTEELKLPK 123

Query: 123 RRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSEI 175
            RL +TVY+ D+EAF++W K  G++A+ IIRI  N       DNFW M +TGPCGPC+EI
Sbjct: 124 ERLCVTVYETDDEAFEIWNKEIGVAAENIIRIGDNKGAAYASDNFWQMGDTGPCGPCTEI 183

Query: 176 FFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMA 234
           F+D GE I GG P    E+G+R+IEIWN+VFMQ+ +Q       LPK S+DTGMG+ER+A
Sbjct: 184 FYDHGEHIWGGRPGTPEEDGDRFIEIWNIVFMQYNRQADGTMDPLPKPSVDTGMGIERIA 243

Query: 235 TVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPAN 294
            ++Q   +NY+ID+F+ LI+ + ++ G+        + RV+ DH+RS +FL+ADG++P+N
Sbjct: 244 AIMQGVHSNYEIDIFQSLIKKTAEILGVTD--LENKSLRVVADHIRSCAFLVADGVMPSN 301

Query: 295 EGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSE 354
           EGRGYVLRRI+RRA+ +   LG TE     L+P L   MG A  EL+  + ++E+ L++E
Sbjct: 302 EGRGYVLRRIIRRAVRHGNKLGATEAFFYKLVPTLIEVMGDAAKELVATQAIVEKALKAE 361

Query: 355 DERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGID 414
           +E+F +TL+RGL +LD  LS L   E L+G+ AFKLYDT+G P+D+  D+   R +  +D
Sbjct: 362 EEQFARTLERGLGILDNALSQLEGKE-LDGETAFKLYDTYGFPVDLTADVCRERDIT-VD 419

Query: 415 IISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRK 474
              F  A+ EQRSRA+A       G  +  +    +    T+F GY  L G         
Sbjct: 420 EAGFEAAMAEQRSRAQAA------GQFDTDYNDSLKIDAETEFCGYSDLNG--------- 464

Query: 475 VLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCA 534
                          + V  +   G+ V+    G +  VV D TPFY E+GGQ GD G  
Sbjct: 465 --------------EAKVIGLYVDGQAVDALAEGDQGVVVLDSTPFYGESGGQCGDKGLL 510

Query: 535 IGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLH 594
             +G+  ++ D QK       H  +V+ G +    +L   +D + R +  +NHS THLLH
Sbjct: 511 SAEGVEFEVKDTQKYG-QAMGHIGLVKAGSIAMGQTLNAAVDKKLRHRTELNHSVTHLLH 569

Query: 595 HALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIM 654
            AL  +LG+HVSQ GS + P+ LRFD +H + +   ELK +ED VN  I +N  +   +M
Sbjct: 570 AALRQVLGTHVSQKGSLVEPERLRFDFSHFEAVKREELKQVEDLVNTQIRRNHELKAEVM 629

Query: 655 NREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           + + A   GA AL G KY+ +VRVV++     G  S  LCGGTHV  TG+I L  I SE 
Sbjct: 630 DIDQAKEKGAMALFGEKYDSQVRVVTM-----GDFSIELCGGTHVGRTGDIGLFKITSEG 684

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
            I AGIRRIEA+TG  A +++  Q  +L+  AS LK    +VV +++   ++ ++L+   
Sbjct: 685 GIAAGIRRIEAVTGAAAIAYVGEQQAQLEQAASLLKGDSASVVAKLKAQLDKTKQLEKEL 744

Query: 775 AKRKLQLNVE-----DLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVG 829
           ++ K +L             ++A V  +  ++  V++  L+ + D L++K+QSGI++L G
Sbjct: 745 SQLKDKLAAATSADLAGEAQELAGVKVLVKLLEGVEAGALRGLQDELKQKLQSGIVVL-G 803

Query: 830 ISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAI 889
           I+ + K +++  VT+DL  +  A +L  + A  + GG GGGRP MAQ+GG    K   A+
Sbjct: 804 IAGDAKVNLIAGVTKDLTGKVKAGELVAMVAAQV-GGKGGGRPDMAQAGGSEPEKLAGAL 862

Query: 890 AGVASFLKK 898
             V  +L +
Sbjct: 863 DSVIPWLSE 871


>gi|88860236|ref|ZP_01134874.1| alanyl-tRNA synthetase [Pseudoalteromonas tunicata D2]
 gi|88817434|gb|EAR27251.1| alanyl-tRNA synthetase [Pseudoalteromonas tunicata D2]
          Length = 866

 Score =  920 bits (2378), Expect = 0.0,   Method: Composition-based stats.
 Identities = 390/903 (43%), Positives = 531/903 (58%), Gaps = 48/903 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL++F    H+ + SSSL+P NDPTL+FTN+GMV FK++F G +K  Y   
Sbjct: 4   MTTAQIRQAFLDYFSSKQHQAIASSSLVPGNDPTLLFTNAGMVQFKDVFLGADKRPYTRA 63

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFKE AI+ AW+ LT    L 
Sbjct: 64  TSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKEDAIKFAWEFLTTVLKLP 123

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGE 181
             +L +TVY  D+EAF +W K  GL AD+IIRITT DNFWSM +TGPCGPCSEIF+D G+
Sbjct: 124 TEKLLVTVYHTDDEAFDIWHKQVGLPADRIIRITTTDNFWSMGDTGPCGPCSEIFYDHGD 183

Query: 182 CIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEK 240
            I GG PGS+ E+G+R+IEIWNLVFMQF +        LPK S+DTGMGLER++ ++Q  
Sbjct: 184 DIWGGPPGSAEEDGDRFIEIWNLVFMQFNRHADGSMEPLPKQSVDTGMGLERISAIMQGV 243

Query: 241 TNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYV 300
            +NY+ID+F+ LI+A+  VT  +       + RVI DH+RS +FLIADG++P+NEGRGYV
Sbjct: 244 HSNYEIDIFQGLIRAAADVTNAQD--LEDKSLRVIADHIRSCAFLIADGVMPSNEGRGYV 301

Query: 301 LRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGK 360
           LRRI+RRA+ +   LG  +     L+ AL  +MG AY EL + + +IE+ LR E+E+F K
Sbjct: 302 LRRIIRRAVRHGNKLGAKDNFFHKLVGALAEQMGDAYQELYKQREIIEKVLRIEEEQFSK 361

Query: 361 TLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQ 420
           TL+RGL +L+  L  +   +++ GDV FKLYDT+G P D+  D+   R +  ID   F  
Sbjct: 362 TLERGLAILEDGLKDIT-GDVIPGDVVFKLYDTYGFPADLTADVARERFMT-IDEPGFQA 419

Query: 421 ALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKP 480
            +  QR  A+        G     +    +    T F GY+                   
Sbjct: 420 CMAAQRKMAQQA------GKFGTDYNEQLKSDKHTDFKGYEH------------------ 455

Query: 481 PIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIR 540
                   S  V  +  +G+ V     GQK  VV D+TPFYAE+GGQ GD G     G  
Sbjct: 456 -----EHFSGTVIELFFEGQSVNSLADGQKGIVVLDRTPFYAESGGQAGDKGILKIAGGE 510

Query: 541 LQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTI 600
             + +  K        H  V +G +     +   ID   R  +  NH+ATHLLH AL  +
Sbjct: 511 FSVYNTTKLGNAF--AHTGVIQGQIALNDRVDAQIDTTRRDNIRKNHTATHLLHEALRQV 568

Query: 601 LGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAI 660
           LG HV Q GS +  + LRFD +H + +T A+L  IE  VN  I +N+ + T +M  +DA 
Sbjct: 569 LGEHVGQKGSLVESERLRFDFSHFEGVTKAQLIEIELMVNAEIRRNVDLQTELMQIDDAK 628

Query: 661 ASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGI 720
           A GA AL G KY+D VRVVS+     G  S  LCGGTHV   G+I L  IVSES I AGI
Sbjct: 629 AKGAMALFGEKYDDEVRVVSI-----GEFSIELCGGTHVKRLGDIGLFKIVSESGIAAGI 683

Query: 721 RRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQ 780
           RRIEA+TG  A   +  Q E L  +A+ +K    + V +V  + E  + L+    +   +
Sbjct: 684 RRIEAVTGAAAIEVMHHQAEVLNHIAALVKSDANSAVEKVTALVERTKGLEKEINQLNDK 743

Query: 781 LNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKK 835
           L          S  +IA V  +   ++  +SK L+ ++D L+ K+ SG+I L G+++  K
Sbjct: 744 LASAAGAGLLDSVIEIAGVKVLIANVAGTESKALRGMVDDLKNKLGSGVIAL-GVAEGDK 802

Query: 836 ASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASF 895
            S++  VT+DL  +F A +L    A+ + GG GGGRP MAQ+GG        A+  VA++
Sbjct: 803 VSLITGVTKDLTGKFKAGELVNFMAQQV-GGKGGGRPDMAQAGGSEPEHLASALDSVAAW 861

Query: 896 LKK 898
           + +
Sbjct: 862 ISE 864


>gi|90580351|ref|ZP_01236158.1| alanyl-tRNA synthetase [Vibrio angustum S14]
 gi|90438653|gb|EAS63837.1| alanyl-tRNA synthetase [Vibrio angustum S14]
          Length = 874

 Score =  920 bits (2378), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/909 (41%), Positives = 537/909 (59%), Gaps = 55/909 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            +   IR  +L FF+  GH+++ SSSL+P NDPTL+FTN+GM  FK+ F G EK  Y   
Sbjct: 3   MSTDEIRRAYLAFFESKGHQIVESSSLVPANDPTLLFTNAGMNQFKDTFLGLEKRSYTRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+ LT    L 
Sbjct: 63  TTAQRCVRAGGKHNDLENVGFTARHHTFFEMLGNFSFGDYFKHDAIAYAWEFLTSVLKLP 122

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN--------DNFWSMAETGPCGPCS 173
             RL +TVY+ D+EAF++W K  G+ AD+I+RI           DNFW M +TGPCGPC+
Sbjct: 123 ADRLVVTVYETDDEAFEIWNKEVGIPADRIVRIGDKKGGKPFESDNFWQMGDTGPCGPCT 182

Query: 174 EIFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLER 232
           EIF+D G+ I GG P    E+G+R+IEIWN VFMQF +Q       LPK S+DTGMG+ER
Sbjct: 183 EIFYDHGDHIWGGRPGTPEEDGDRFIEIWNNVFMQFNRQADGTMEPLPKPSVDTGMGIER 242

Query: 233 MATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILP 292
           +A ++Q   +NY+ID+F+ LI+ + +V G +    +  + RV+ DH+RS ++LI+DG++P
Sbjct: 243 IAAIMQGVHSNYEIDIFQTLIKEAAKVIGFED--LSNQSLRVVADHIRSCAYLISDGVMP 300

Query: 293 ANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLR 352
           +NEGRGYVLRRI+RRA+ +   LG        L+  L   MG+A  EL   + L+E+ L+
Sbjct: 301 SNEGRGYVLRRIIRRAVRHGNKLGAQGAFFYKLVGPLAEIMGTAGEELKAQQELVEKVLK 360

Query: 353 SEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAG 412
            E++ FG+TLDRGL +L+  L +L   ++L+G+  FKLYDT+G P D+  D+   RG   
Sbjct: 361 IEEDNFGRTLDRGLTILNEALDNLD-GKVLDGETVFKLYDTYGFPADLTNDVARERGFT- 418

Query: 413 IDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKED 472
           ID   F  A+EEQR RAR       +G     +    +    T+F GY    G       
Sbjct: 419 IDEDGFEAAMEEQRQRAR------DAGNFGVDYNDAIKVDAETEFCGYSATDG------- 465

Query: 473 RKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTG 532
                              + A+ + G  V+   +G++  VV   TPFYAE+GGQ GD+G
Sbjct: 466 ----------------EGEIVALYRDGVAVDSVNAGEEALVVLTNTPFYAESGGQCGDSG 509

Query: 533 CAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHL 592
               +G+   + D QK       H   V  G L     L  ++D   R  +S+NHSATHL
Sbjct: 510 ILTAEGVLFNVADTQKFGA-AIGHKGQVAEGTLTVGQKLTASVDSARRAAISLNHSATHL 568

Query: 593 LHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTR 652
           +H AL  ILG HV+Q GS +  DGLRFD ++ + +   +L+++E  VND I  N  + T 
Sbjct: 569 MHAALRNILGEHVAQKGSLVKADGLRFDFSNLEAVKPEQLRAVETMVNDQIRANHAIETN 628

Query: 653 IMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVS 712
           IM+ E A A GA AL G KY+D VRV+S+     G  S+ LCGG H + TG+I L  I+S
Sbjct: 629 IMDIEAAKAKGAMALFGEKYDDEVRVLSM-----GEFSTELCGGIHATRTGDIGLFKILS 683

Query: 713 ESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQL 772
           ES I AGIRRIEA+TG  A   +  +D  L   A  +K    +VV +VE +    ++L+ 
Sbjct: 684 ESGIAAGIRRIEAVTGASAIEAMHTEDAMLAKTARLVKSDSASVVSKVEALVSHSKQLEK 743

Query: 773 IHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
              + K +L  ++ +       +I  V  +   ++  D+K L+ ++D L+ ++ SG+++L
Sbjct: 744 EIQQLKDKLAAQEGANLINQAQEINGVKVLIAKLNGADNKALRGMVDELKNQLGSGVVLL 803

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQ 887
             +S + K  ++  VT+DL+ +  A +L  L A+ + GG GGGRP MAQ+GG +      
Sbjct: 804 GNVS-DDKVGLIAGVTKDLVGKVKAGELVNLVAQQV-GGKGGGRPDMAQAGGTDAAALPA 861

Query: 888 AIAGVASFL 896
           A+  VA +L
Sbjct: 862 ALETVAPWL 870


>gi|327190521|gb|EGE57615.1| alanyl-tRNA synthetase protein [Rhizobium etli CNPAF512]
          Length = 884

 Score =  920 bits (2378), Expect = 0.0,   Method: Composition-based stats.
 Identities = 487/896 (54%), Positives = 633/896 (70%), Gaps = 38/896 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+TFL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG EK  Y  
Sbjct: 1   MSGVNDIRSTFLDYFKKNGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEKRPYST 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RH TFFEMLGNFSFG YFKE AI+LAW L+T+ F L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHLTFFEMLGNFSFGDYFKENAIELAWKLVTEGFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + RL +TVY EDEEA  LWKKI+G S DKIIRI T+DNFW M +TGPCGPCSEIF DQG
Sbjct: 121 PKHRLLVTVYSEDEEAATLWKKIAGFSDDKIIRIPTSDNFWQMGDTGPCGPCSEIFIDQG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           E + GG PGS+ E+G+R++E WNLVFMQFEQ     R  LP+ SIDTGMGLERMA +LQ 
Sbjct: 181 ENVWGGPPGSAEEDGDRFLEFWNLVFMQFEQIEPGVRNPLPRPSIDTGMGLERMACILQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             + +D DLF+ L  A E   G+K       +HRVI DHLRSS+FLIADG+LP+NEGRGY
Sbjct: 241 VQSVFDTDLFRTLTGAIEDAVGVK--AEGSASHRVIADHLRSSAFLIADGVLPSNEGRGY 298

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPL+  LLP L  +MG AYPEL++A+ LI ETL+ E+ RF 
Sbjct: 299 VLRRIMRRAMRHAQLLGAKEPLIYKLLPTLVQQMGRAYPELVRAEALISETLKLEENRFR 358

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL    + L K ++L+G+ AFKLYDT+G PLD+ QD L AR   G+DI  F 
Sbjct: 359 KTLERGLSLLSDATADLSKGDMLDGETAFKLYDTYGFPLDLTQDALRAR-EIGVDISGFT 417

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A++ Q++ AR+H  G G   TE +WF L+EK+GAT+F+GYD                  
Sbjct: 418 DAMQRQKAEARSHWAGSGEKATETVWFELREKHGATEFLGYD------------------ 459

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +V+AIV+ G + E A +G KV+VV +QTPFY E+GGQ+GDTG    D  
Sbjct: 460 -----TEAAEGVVQAIVKDGAVAEGAKAGDKVQVVVNQTPFYGESGGQMGDTGVISSDHG 514

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           +++I+D QKK EG+FVH   V  G  +T  ++VLT+D+  R +L  NHSATHLLH AL  
Sbjct: 515 KIEISDTQKKGEGLFVHSGTVVEGAFKTGDAVVLTVDHARRSRLRANHSATHLLHEALRE 574

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG+HV+Q GS + P+ LRFDV+H KP+T+ ELK +E+  N+I+ QN PV TR+M+ +DA
Sbjct: 575 VLGTHVAQKGSLVAPERLRFDVSHPKPMTAEELKIVEEMANEIVLQNAPVTTRLMSVDDA 634

Query: 660 IASGAAALLGTKYNDRVRVVSVEY-----EDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+       +    +S  LCGGTHVS+TG+I L+ I+ ES
Sbjct: 635 IAEGAMALFGEKYGDEVRVVSMGTGLHGAKSNKPYSVELCGGTHVSATGQIGLVRILGES 694

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
           ++ AG+RR+EA+TG+ AR +L  QD+++K+LA+ LKV    V+ RVE + +E RKL+   
Sbjct: 695 AVGAGVRRLEAVTGESAREYLAEQDDRVKTLAASLKVQPSEVLSRVETLIDERRKLEREL 754

Query: 775 AKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
           A  K +L +         +  ++A V ++   ++ VD K+LK + D  +  I SGI+ L+
Sbjct: 755 ADAKRKLAMGGGQGGSADAVREVAGVKYLGKAVAGVDPKDLKGLADDGKASIGSGIVTLI 814

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNK 884
           G+S++ KAS ++ VT DL+DRF+AVDL R+++  LGG GGGGRP MAQ+GGP+G K
Sbjct: 815 GVSEDGKASAVVAVTPDLVDRFSAVDLVRVASAALGGKGGGGRPDMAQAGGPDGAK 870


>gi|221214968|ref|ZP_03587936.1| alanyl-tRNA synthetase [Burkholderia multivorans CGD1]
 gi|221165195|gb|EED97673.1| alanyl-tRNA synthetase [Burkholderia multivorans CGD1]
          Length = 874

 Score =  920 bits (2378), Expect = 0.0,   Method: Composition-based stats.
 Identities = 382/911 (41%), Positives = 539/911 (59%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTLMFTNSGMV FK++F G ++  Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDRRPYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIRFAWELLTTVYMLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW+M +TGPCGPC+E
Sbjct: 121 KDKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWTMGDTGPCGPCTE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPEVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKPCVDTGMGLERL 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ +VT +     N  + +VI DH+R+ +FLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIKAAARVTEVGD--LNNNSLKVIADHIRACAFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGAFFHKLVADLVAEMGAAYPELKEAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ L     ++L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILESALADLEAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKAAQG-------LEYTGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVDGSAVTEVKAGQDAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    L   ID Q R +   NHSATH
Sbjct: 509 GVLANASTRFAVADTLKVQADVIGHHGTLEQGTLKVGDVLRAEIDAQRRARTQRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD  H+ P+T  E++ +E  VND I  N P + 
Sbjct: 569 LMHKALREVLGSHVQQKGSLVDADKTRFDFAHNAPLTDDEIRRVEQIVNDEILANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHVS TG+I L  IV
Sbjct: 629 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVSRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   D ++   A+ LK     +  R+ ++ ++ + L+
Sbjct: 683 MEGGVAAGIRRVEAITGDNAVRYVQELDARVNEAAAALKAQPAELTQRIAQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
              A  K +L             ++  V+ ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELAALKSKLASSQGDELAQQAVEVGGVHVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT +   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LAAV-EGGKVSLIAGVTAEASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLK 897
            A+AGV  +++
Sbjct: 861 AALAGVKGWVE 871


>gi|302132483|ref|ZP_07258473.1| alanyl-tRNA synthetase [Pseudomonas syringae pv. tomato NCPPB 1108]
          Length = 874

 Score =  920 bits (2378), Expect = 0.0,   Method: Composition-based stats.
 Identities = 389/912 (42%), Positives = 537/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL FF++ GH  +PSSSLIP NDPTL+FTN+GM  FK+ F GQEK  Y   
Sbjct: 1   MKSAEIREAFLGFFEEQGHTRVPSSSLIPGNDPTLLFTNAGMNQFKDCFLGQEKRAYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
            T QKCVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW  LT  K  +
Sbjct: 61  VTSQKCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAITYAWTFLTSEKWLN 120

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY  D+EA+ +W K  G+ A++++RI  N       DNFW+M +TGPCGPC
Sbjct: 121 LPKEKLWVTVYATDDEAYDIWTKEIGVPAERMVRIGDNKGAPYASDNFWTMGDTGPCGPC 180

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           SEIFFD G  I GG PGS  E+G+RYIEIWN VFMQF +        LP  S+DTGMGLE
Sbjct: 181 SEIFFDHGADIWGGPPGSPEEDGDRYIEIWNNVFMQFNRTADGVLHPLPAPSVDTGMGLE 240

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R++ VLQ   +NY+IDLF+ L+ AS    G     +N  + +V+ DH+RS  FLIADG+L
Sbjct: 241 RVSAVLQHVHSNYEIDLFQSLLTASANAIGCS--NDNQASLKVVADHIRSCGFLIADGVL 298

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P++EGRGYVLRRI+RRA  +   LG        ++ AL  EMGSA+PEL+Q +  IE  L
Sbjct: 299 PSSEGRGYVLRRIIRRACRHGNKLGAKGSFFYQIVAALVAEMGSAFPELVQQQSHIERVL 358

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           R E+E+F KTL++GL +++  L+ L    ++ G++ FKLYDT+G P+D+  DI   R L 
Sbjct: 359 RGEEEQFAKTLEQGLKIIEQDLAELK-GTVVPGEIVFKLYDTYGFPMDLTGDIARERNLT 417

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F + +E QR RAR+ S           + SL +   ATQF GY    G      
Sbjct: 418 -LDEEGFEREMEAQRVRARSASSFGM------DYNSLVKVDVATQFTGYSATTG------ 464

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                            S+ V A+ + G+ V     G++  V+ D TPFYAE+GGQ+GD+
Sbjct: 465 -----------------SASVVALYKDGQSVTHLNEGEEGVVILDTTPFYAESGGQIGDS 507

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G  +    R  ++D  K     F+HH +V  G L   + +   +  + R    +NHSATH
Sbjct: 508 GFLLAGDTRFDVSDTTKTGG-AFLHHGVVASGSLSVGVQVETQVADEVRDATKLNHSATH 566

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV Q GS +    LRFD +H + I   +L+++ED VN  I +N PVVT
Sbjct: 567 LLHAALRQVLGEHVQQKGSLVDSQRLRFDFSHFESIKPEQLRALEDIVNAEIRKNTPVVT 626

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
              + + A   GA AL G KY D VRV+S+    GG  S  LCGG H S TG+I L  IV
Sbjct: 627 EETDIDTAKKKGAMALFGEKYGDSVRVLSM----GGEFSVELCGGIHASRTGDISLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SE  + AG+RRIEA+TG  A + L   +++LK  A+ +K ++ N++ ++  + E  R L+
Sbjct: 683 SEGGVAAGVRRIEAVTGAAALAWLNSAEDQLKEAATLVKGNRDNLLDKLTAVLERNRLLE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + + +           +   +  V  ++  +   D K L +++D L+ K+   +I+
Sbjct: 743 KQLEQLQAKAASAAGDDLSSAALDVKGVKVLATRLDGQDGKALLALVDQLKNKLGRAVIL 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +  E K  ++  VT+DL  +  A DL + +A  + GG GGGRP MAQ GG +    D
Sbjct: 803 LGSVH-EDKVVLVAGVTKDLTGQLKAGDLMKQAATAV-GGKGGGRPDMAQGGGVDATALD 860

Query: 887 QAIAGVASFLKK 898
            A+A    F+++
Sbjct: 861 SALALAVPFVEQ 872


>gi|221202097|ref|ZP_03575133.1| alanyl-tRNA synthetase [Burkholderia multivorans CGD2M]
 gi|221204772|ref|ZP_03577789.1| alanyl-tRNA synthetase [Burkholderia multivorans CGD2]
 gi|221175629|gb|EEE08059.1| alanyl-tRNA synthetase [Burkholderia multivorans CGD2]
 gi|221178180|gb|EEE10591.1| alanyl-tRNA synthetase [Burkholderia multivorans CGD2M]
          Length = 874

 Score =  920 bits (2378), Expect = 0.0,   Method: Composition-based stats.
 Identities = 382/911 (41%), Positives = 539/911 (59%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTLMFTNSGMV FK++F G ++  Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDRRPYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIRFAWELLTTVYMLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA+ +W K  G+  ++IIRI  N       DNFW+M +TGPCGPC+E
Sbjct: 121 KDKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWTMGDTGPCGPCTE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPEVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKPCVDTGMGLERL 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF++LI+A+ +VT +     N  + +VI DH+R+ +FLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQNLIEAAARVTEVGD--LNNNSLKVIADHIRACAFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGAFFHKLVADLVAEMGAAYPELKEAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ L     ++L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILESALADLEAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKAAQG-------LEYTGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V E  +GQ   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVDGSAVTEVKAGQDAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    L   ID Q R +   NHSATH
Sbjct: 509 GVLANASTRFAVADTLKVQADVIGHHGTLEQGTLKVGDVLRAEIDAQRRARTQRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD  H+ P+T  E++ +E  VND I  N P + 
Sbjct: 569 LMHKALREVLGSHVQQKGSLVDADKTRFDFAHNAPLTDDEIRRVEQIVNDEILANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  ++A+  GA AL G KY D VRV+ +        S  LCGGTHVS TG+I L  IV
Sbjct: 629 RVMPYDEAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVSRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   D ++   A+ LK     +  R+ ++ ++ + L+
Sbjct: 683 MEGGVAAGIRRVEAITGDNAVRYVQELDARVNEAAAALKAQPAELTQRIAQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
              A  K +L             ++  V+ ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELAALKSKLASSQGDELAQQAVEVGGVHVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT +   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LAAV-EGGKVSLIAGVTAEASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLK 897
            A+AGV  +++
Sbjct: 861 AALAGVKGWVE 871


>gi|205830261|sp|Q1QMV7|SYA_NITHX RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
          Length = 891

 Score =  920 bits (2377), Expect = 0.0,   Method: Composition-based stats.
 Identities = 459/901 (50%), Positives = 607/901 (67%), Gaps = 41/901 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+ FL +F  NGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG EK  YQ 
Sbjct: 1   MSGVNDIRSAFLNYFAANGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRPYQR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK+RAI+LAW L+T+EF L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKDRAIELAWKLVTEEFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + +L  TVY +D+EAF LWKKI+GL   +IIRI   DNFW M +TGPCGPCSEIF+D G
Sbjct: 121 PKDKLIATVYIDDDEAFGLWKKIAGLPDSRIIRIAGADNFWQMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + IPGG P    E+G+R++EIWNLVFMQ+E+     R  LPK SIDTG GLER+A VLQ 
Sbjct: 181 DKIPGGPPGSPDEDGDRFVEIWNLVFMQYEKLPDGSRLNLPKPSIDTGAGLERVAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           K +NYDIDLF  LI+A+  +TG    G    + RVI DHLR++SFLIADG+LP+NEGRGY
Sbjct: 241 KHDNYDIDLFVALIRAAADLTGADPHGPMKASLRVIADHLRATSFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  L+  L  EMG A+PEL +A+ LIEETLR E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAKEPLMWRLVGVLVREMGEAFPELQRARPLIEETLRLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL +LD   + L K ++ +G+ AF LYDT+G PLD+ QD L ARG  G+DI SF 
Sbjct: 361 KTLERGLSILDEKSASLKKGDMFDGETAFTLYDTYGFPLDLTQDALRARG-IGVDIASFT 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E+Q+++ARA   G G   TE IWF L+EK GAT+F+GY+                  
Sbjct: 420 DAMEQQKAKARASWSGSGEAATETIWFPLREKLGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T      V A+V+ G+  +   +G+   +V +QTPFY E+GGQ+GDTG   GDG+
Sbjct: 462 -----TEIAEGAVAALVKDGKEADSLKAGESGAIVLNQTPFYGESGGQVGDTGILTGDGV 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           R+++TD QKKA  +FVH   VE+G L   M+L L +D   R  +  NHSATHLLH AL  
Sbjct: 517 RVRVTDTQKKAGDLFVHLGTVEQGTLTPGMALALEVDRARRGAIRANHSATHLLHEALRQ 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG H++Q GS + P+ LRFD  H+KPI++ EL+ IED  ND++ +N  V TR+M  +DA
Sbjct: 577 VLGDHIAQRGSLVAPERLRFDFVHNKPISADELRRIEDIANDVVLENGEVTTRLMAVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSVEYE-------DGGVHSSALCGGTHVSSTGEIMLLYIVS 712
             +GA AL G KY D VRVVS+          +    S  LCGGTHV  TG+I L+ +  
Sbjct: 637 REAGARALFGEKYGDEVRVVSMGSTGRQGAASNALGWSVELCGGTHVKRTGDIGLISVTG 696

Query: 713 ESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQL 772
           ES++ +G+RRIEA+TG  AR H     +  K+ A  L+ +  ++  R+  + EE +KL+ 
Sbjct: 697 ESAVASGVRRIEALTGHHARHHANDAIQLAKTAAGELRTTLDDMPPRITSLMEERKKLER 756

Query: 773 IHAKRKLQLNV---------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSG 823
             ++ + +L +                +  +  M+  +  ++ K+LK++ D  +K++ SG
Sbjct: 757 ELSEARKKLAMGGGAASASSGAAGVRDVGGIKLMARSVEGIEIKDLKNLADQGKKQLGSG 816

Query: 824 IIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGN 883
           ++ LV  S + KAS+++ VT DL+ RF+AVDL R +++VLGG GGGG+P MAQ+GGP+G 
Sbjct: 817 VVALVATSGDGKASIVVGVTPDLVTRFSAVDLVRKASEVLGGKGGGGKPDMAQAGGPDGA 876

Query: 884 K 884
           K
Sbjct: 877 K 877


>gi|83312631|ref|YP_422895.1| alanyl-tRNA synthetase [Magnetospirillum magneticum AMB-1]
 gi|123541005|sp|Q2W1D9|SYA_MAGMM RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|82947472|dbj|BAE52336.1| Alanyl-tRNA synthetase [Magnetospirillum magneticum AMB-1]
          Length = 878

 Score =  920 bits (2377), Expect = 0.0,   Method: Composition-based stats.
 Identities = 444/906 (49%), Positives = 597/906 (65%), Gaps = 40/906 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR TFL+FF+KNGH ++ SS L+P NDPTLMFTN+GMV FKN+FTG EK  Y  
Sbjct: 1   MQTANEIRRTFLDFFEKNGHTVVNSSPLVPRNDPTLMFTNAGMVQFKNVFTGIEKRDYVR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             + QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK+ AI+ AW+L+TK+F +
Sbjct: 61  AASSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKDLAIEHAWNLITKDFGI 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
           D+ RL +TVY +D++A   WKKI+GL   +IIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 121 DKSRLLVTVYHDDDQAADAWKKIAGLPESRIIRIPTSDNFWAMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           E I GG P    ++G+R+IEIWNLVFMQFEQ +K+ R  LPK SIDTGMGLER+A +LQ 
Sbjct: 181 EHIFGGPPGSPDQDGDRFIEIWNLVFMQFEQVDKETRIPLPKPSIDTGMGLERLAALLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           K +NYD+DL + LI+AS + +    +G + V+HRV+ DHLRSSSFLIADG+LP+NEGRGY
Sbjct: 241 KHDNYDVDLLRALIEASAEASNTDPDGPHKVSHRVVADHLRSSSFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A L+G TEPL+  L+PAL  +MG AYPEL++A  LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAHLMGCTEPLLHKLVPALTRQMGEAYPELVRANALITETLKLEETRFK 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
            TLD+GL LLD  ++ +G  + L G+VAFKLYDT+G PLD+ QD L A+G  G+D   F 
Sbjct: 361 VTLDKGLKLLDDEITRIGSGQKLAGEVAFKLYDTYGFPLDLTQDALKAKG-IGVDTDGFA 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E QR+ AR    G G   TE +WF L+EK GA++F+GYD                  
Sbjct: 420 SAMERQRAEARKAWAGSGDTATETVWFELREKLGASEFLGYD------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCA----- 534
                       + A+V+ G++VE    G +V V+ +QTPFY E+GGQ+GDTG       
Sbjct: 462 -----AEQAEGKIVALVENGKVVEAVHPGHQVAVIANQTPFYGESGGQMGDTGVITLGTP 516

Query: 535 -IGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLL 593
             G    + +TD QKK   + VH   VE G +         ++   R     +HSATHLL
Sbjct: 517 GTGGKATIAVTDTQKKLGDLIVHFGTVEGGPVAVGEDAHFAVESTRRDATRGHHSATHLL 576

Query: 594 HHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRI 653
           H AL  ILG HV+Q GS + PD LRFD  H+K +++ E +++E  VN  I  N  V T++
Sbjct: 577 HAALRDILGDHVTQKGSQVGPDRLRFDFAHTKALSAEETRAVEAEVNRRIRLNAEVATKV 636

Query: 654 MNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSE 713
           M  +DAI +GA AL G KY + VRVVS+     G  S+ LCGGTH + TG+I    IV+E
Sbjct: 637 MTPDDAIKAGAMALFGEKYGEEVRVVSM-----GDLSTELCGGTHANRTGDIGGFKIVAE 691

Query: 714 SSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLI 773
           S++ +G+RRIEA+TG    +    Q++ L   A  LK +  ++  R+  + ++ RKL+  
Sbjct: 692 SAVASGVRRIEAVTGPAFLAWAQAQEDLLAKAADTLKAAPADLPARIAGLMDDRRKLERE 751

Query: 774 HAKRKLQLNV---EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGI 830
            A+ + QL     +  +   +  + +   ++S V +K+LK + D ++K+I SGII LV  
Sbjct: 752 LAEVRKQLATGGGQGAATKTVNGITYAGKVLSGVPAKDLKGMADEIKKQIGSGIIALVS- 810

Query: 831 SKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIA 890
             + KAS+++ VTEDL  + +AVDL R+ ++ LGG GGGGRP MAQ+GGP+ + A  A+ 
Sbjct: 811 DADGKASIVVCVTEDLTSKHSAVDLVRIGSEALGGKGGGGRPDMAQAGGPDASAAQAAVD 870

Query: 891 GVASFL 896
            +   L
Sbjct: 871 RIEQAL 876


>gi|92117171|ref|YP_576900.1| alanyl-tRNA synthetase [Nitrobacter hamburgensis X14]
 gi|91800065|gb|ABE62440.1| alanyl-tRNA synthetase [Nitrobacter hamburgensis X14]
          Length = 897

 Score =  920 bits (2377), Expect = 0.0,   Method: Composition-based stats.
 Identities = 459/901 (50%), Positives = 607/901 (67%), Gaps = 41/901 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+ FL +F  NGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG EK  YQ 
Sbjct: 7   MSGVNDIRSAFLNYFAANGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRPYQR 66

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK+RAI+LAW L+T+EF L
Sbjct: 67  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKDRAIELAWKLVTEEFGL 126

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + +L  TVY +D+EAF LWKKI+GL   +IIRI   DNFW M +TGPCGPCSEIF+D G
Sbjct: 127 PKDKLIATVYIDDDEAFGLWKKIAGLPDSRIIRIAGADNFWQMGDTGPCGPCSEIFYDHG 186

Query: 181 ECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + IPGG P    E+G+R++EIWNLVFMQ+E+     R  LPK SIDTG GLER+A VLQ 
Sbjct: 187 DKIPGGPPGSPDEDGDRFVEIWNLVFMQYEKLPDGSRLNLPKPSIDTGAGLERVAAVLQG 246

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           K +NYDIDLF  LI+A+  +TG    G    + RVI DHLR++SFLIADG+LP+NEGRGY
Sbjct: 247 KHDNYDIDLFVALIRAAADLTGADPHGPMKASLRVIADHLRATSFLIADGVLPSNEGRGY 306

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  L+  L  EMG A+PEL +A+ LIEETLR E+ RF 
Sbjct: 307 VLRRIMRRAMRHAQLLGAKEPLMWRLVGVLVREMGEAFPELQRARPLIEETLRLEETRFR 366

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL +LD   + L K ++ +G+ AF LYDT+G PLD+ QD L ARG  G+DI SF 
Sbjct: 367 KTLERGLSILDEKSASLKKGDMFDGETAFTLYDTYGFPLDLTQDALRARG-IGVDIASFT 425

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E+Q+++ARA   G G   TE IWF L+EK GAT+F+GY+                  
Sbjct: 426 DAMEQQKAKARASWSGSGEAATETIWFPLREKLGATEFLGYE------------------ 467

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T      V A+V+ G+  +   +G+   +V +QTPFY E+GGQ+GDTG   GDG+
Sbjct: 468 -----TEIAEGAVAALVKDGKEADSLKAGESGAIVLNQTPFYGESGGQVGDTGILTGDGV 522

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           R+++TD QKKA  +FVH   VE+G L   M+L L +D   R  +  NHSATHLLH AL  
Sbjct: 523 RVRVTDTQKKAGDLFVHLGTVEQGTLTPGMALALEVDRARRGAIRANHSATHLLHEALRQ 582

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG H++Q GS + P+ LRFD  H+KPI++ EL+ IED  ND++ +N  V TR+M  +DA
Sbjct: 583 VLGDHIAQRGSLVAPERLRFDFVHNKPISADELRRIEDIANDVVLENGEVTTRLMAVDDA 642

Query: 660 IASGAAALLGTKYNDRVRVVSVEYE-------DGGVHSSALCGGTHVSSTGEIMLLYIVS 712
             +GA AL G KY D VRVVS+          +    S  LCGGTHV  TG+I L+ +  
Sbjct: 643 REAGARALFGEKYGDEVRVVSMGSTGRQGAASNALGWSVELCGGTHVKRTGDIGLISVTG 702

Query: 713 ESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQL 772
           ES++ +G+RRIEA+TG  AR H     +  K+ A  L+ +  ++  R+  + EE +KL+ 
Sbjct: 703 ESAVASGVRRIEALTGHHARHHANDAIQLAKTAAGELRTTLDDMPPRITSLMEERKKLER 762

Query: 773 IHAKRKLQLNV---------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSG 823
             ++ + +L +                +  +  M+  +  ++ K+LK++ D  +K++ SG
Sbjct: 763 ELSEARKKLAMGGGAASASSGAAGVRDVGGIKLMARSVEGIEIKDLKNLADQGKKQLGSG 822

Query: 824 IIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGN 883
           ++ LV  S + KAS+++ VT DL+ RF+AVDL R +++VLGG GGGG+P MAQ+GGP+G 
Sbjct: 823 VVALVATSGDGKASIVVGVTPDLVTRFSAVDLVRKASEVLGGKGGGGKPDMAQAGGPDGA 882

Query: 884 K 884
           K
Sbjct: 883 K 883


>gi|157148231|ref|YP_001455550.1| alanyl-tRNA synthetase [Citrobacter koseri ATCC BAA-895]
 gi|205830024|sp|A8ANQ1|SYA_CITK8 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|157085436|gb|ABV15114.1| hypothetical protein CKO_04048 [Citrobacter koseri ATCC BAA-895]
          Length = 875

 Score =  920 bits (2377), Expect = 0.0,   Method: Composition-based stats.
 Identities = 399/910 (43%), Positives = 564/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT    F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTGENWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKDRLWVTVYETDDEAYEIWEKEVGIPRERIIRIGDNKGAAYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NY+IDLF+ LI+A  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYEIDLFRTLIEAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVV 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  EL + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEELKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++    GA++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDGASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAISAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G G    ++D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGAGFAFAVSDTQKYG-QAIGHIGTLSTGSLKVGDAVQADVDDARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  ILG+HV+Q GS +    LRFD +H++ +  +E++++ED VN  I +NLPV T
Sbjct: 569 LMHAALRQILGTHVAQKGSLVNDKVLRFDFSHNEAMKPSEIRAVEDLVNAQIRRNLPVET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY+DRVRV+S+     G  S+ LCGGTH S TG+I L  IV
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDDRVRVLSM-----GDFSTELCGGTHASRTGDIGLFRIV 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + L  + ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATLHAESDRLSDIAQLLKGDSQNLGEKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          I  V  +   ++ V+ K L++++D L+ ++ S +I+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAVDINGVKLLVSELAGVEPKMLRTMVDDLKNQLGSTVIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELVGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|271501699|ref|YP_003334725.1| alanyl-tRNA synthetase [Dickeya dadantii Ech586]
 gi|270345254|gb|ACZ78019.1| alanyl-tRNA synthetase [Dickeya dadantii Ech586]
          Length = 875

 Score =  920 bits (2377), Expect = 0.0,   Method: Composition-based stats.
 Identities = 385/910 (42%), Positives = 542/910 (59%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQIVASSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRNYVRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAITYAWELLTSSQWFG 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY  D+EA+ +W    G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKEKLWVTVYASDDEAYDIWANEVGVPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           SEIF+D G+ I GG PGS  E+G+RYIEIWNLVFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 SEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNLVFMQFNRQADGTMLPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R++ VLQ   +NYDIDLFK LI  + +V G      N  + RVI DH+RS +FLIADG++
Sbjct: 243 RISAVLQHVNSNYDIDLFKTLIAEAARVVGTDD--LNNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MG+A  EL + + L+E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAIRHGNMLGAKETFFYKLVGTLIEVMGAAGEELKRQQSLVEQAL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL+LLD  +  L   + L+G+ AF+LYDT+G P+D+  D+   R L 
Sbjct: 361 KNEEEQFARTLERGLLLLDEEIKQLK-GDTLSGEAAFRLYDTYGFPVDLTADVCRERNLK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F +A+E QR RAR       +      + SL     +T F GY+          
Sbjct: 420 -VDEAGFERAMEAQRQRAR------DASGFGADYNSLIRVDASTSFCGYERTEQ------ 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             S V AI +QGE V+E  +G    V+  +TPFY E+GGQ+GD 
Sbjct: 467 -----------------QSTVVAIYRQGESVQEIQAGDDAVVILSETPFYGESGGQVGDQ 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G  +       + D QK  +    H   + +G+LR    +   +D+  R ++ +NHSATH
Sbjct: 510 GELVSAAACFSVADAQKYGQ-AIGHIGSLAQGVLRVNDKVNAVVDHVRRDRIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV+Q GS +  + LRFD +H + +   +++ +ED VN  I +NL + T
Sbjct: 569 LLHAALRQVLGEHVAQKGSLVNDNYLRFDFSHPEAMKPEQIRQVEDIVNTQIRRNLSIDT 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            +M  + A A GA AL G KY++ VRV+S+     G  S  LCGGTH   TG+I L  IV
Sbjct: 629 DVMALDAARAKGAMALFGEKYDEHVRVLSM-----GDFSIELCGGTHARRTGDIGLFRIV 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AGIRRIEA+TG+ A   L  Q + L  +   +K     +  +V  + E  R L+
Sbjct: 684 SESGTAAGIRRIEAVTGENAIVALHEQSDVLHEVTQLVKGDSNTLADKVRSLLERNRGLE 743

Query: 772 LIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++ S       +I  V  +   ++ V+ K L++++D L+ ++ S +I+
Sbjct: 744 KELQQLKEQQAAQESSSLSSKAKEINGVKLLVTQLNNVEPKLLRTMVDDLKNQLGSAVIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L     + K S++  VT++L +R  A +L    A  + GG GGGRP MAQ+GG + +   
Sbjct: 804 L-STVADGKVSLIAGVTKELTNRVKAGELIGFVANQV-GGKGGGRPDMAQAGGSDVDALP 861

Query: 887 QAIAGVASFL 896
            A+  V +++
Sbjct: 862 SALTSVEAWV 871


>gi|205371825|sp|Q89I89|SYA_BRAJA RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
          Length = 892

 Score =  920 bits (2377), Expect = 0.0,   Method: Composition-based stats.
 Identities = 458/911 (50%), Positives = 615/911 (67%), Gaps = 41/911 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+TFL FF +NGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG EK  YQ 
Sbjct: 1   MSGVNEIRSTFLNFFAENGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRPYQR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RH TFFEMLGNFSFG YFKERAI+LAW L+TK+F L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHLTFFEMLGNFSFGDYFKERAIELAWKLITKDFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
           ++ +L +TVY  D+EA  LWKKI+G S D+IIRI T+DNFW+M +TGPCGPCSEIF D+G
Sbjct: 121 NKDKLLVTVYHTDDEAHGLWKKIAGFSDDRIIRIPTSDNFWAMGDTGPCGPCSEIFIDRG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R++E WNLVFMQ+EQ  K+ER  LP+ SIDTGMGLERMA ++Q 
Sbjct: 181 DHIWGGPPGSPEEDGDRFLEFWNLVFMQYEQVTKEERVDLPRPSIDTGMGLERMACIMQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             + ++ DLF+HLI A+    G       + + RVI DHLRSS+FL++DG+LP+NEGRGY
Sbjct: 241 VDSVFETDLFRHLIDATASALGSGPNEQTVASFRVIADHLRSSAFLVSDGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  L+ AL  EMG AYPEL++A+ LIEETLR E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAKEPLMHRLVWALVREMGQAYPELMRAEKLIEETLRLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL RGL +LD   + L K ++ +GDVAF LYDT+G PLD+ QD L +RG  G+D  +F 
Sbjct: 361 KTLTRGLAILDEKSASLKKGDMFDGDVAFTLYDTYGFPLDLTQDALKSRG-IGVDQSAFT 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E Q+++AR    G G   +E IWF L+EK GAT+F+GY+                  
Sbjct: 420 DAMERQKAKARESWKGSGEAASEAIWFPLREKLGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +V A+V+ G+      +G+   +V +QTPFYAE+GGQ+GDTG  +G+G 
Sbjct: 462 -----TESAEGVVSALVKDGQEAASLKAGETGALVLNQTPFYAESGGQVGDTGVLLGEGG 516

Query: 540 -RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALS 598
            + ++TD QKK   +FVH   VE G L+   +L L +D+  R  +  +HSATHL+H AL 
Sbjct: 517 VKFRVTDTQKKLGDLFVHVGTVESGELKLGTALQLEVDHSRRSSIRAHHSATHLIHEALR 576

Query: 599 TILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNRED 658
            +LG H++Q GS + PD LRFD  H KPIT+ EL  +ED  ND++ +N  V TR+M  ++
Sbjct: 577 QVLGDHIAQRGSMVAPDRLRFDFVHPKPITAEELARVEDIANDVVLENDEVTTRVMGVDE 636

Query: 659 AIASGAAALLGTKYNDRVRVVSVE------YEDGGVHSSALCGGTHVSSTGEIMLLYIVS 712
           A  +GA AL G KY D VRVVS+         +    S  LCGGTHV  TG+I L+ +  
Sbjct: 637 AREAGARALFGEKYGDEVRVVSMGRTARERGANALGWSVELCGGTHVRRTGDIGLITLTG 696

Query: 713 ESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQL 772
           ES++ +G+RRIEA+TG  AR H        K+ A+ L+ S  +V  R+  + EE +KL+ 
Sbjct: 697 ESAVASGVRRIEALTGNYARKHANDTMALAKTAANELRTSIDDVPARITALMEERKKLER 756

Query: 773 IHAKRKLQLNV---------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSG 823
             +  + +L +               ++ DV  M+  +  ++ K+LKS+ D  +K+I SG
Sbjct: 757 ELSDARKKLAMGGGAAASNGAASGVREVGDVKLMARAVEGIEMKDLKSLADDGKKQIGSG 816

Query: 824 IIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGN 883
           ++ +VG++ + KA +++ VT DL  RFNAV+L R++++ LGG GGGGRP MAQ+GGP+G 
Sbjct: 817 VVAIVGVTGDGKAGIVVGVTADLTARFNAVNLVRVASEALGGKGGGGRPDMAQAGGPDGA 876

Query: 884 KADQAIAGVAS 894
           KA +A+A +  
Sbjct: 877 KAPEALAAIEK 887


>gi|306840334|ref|ZP_07473106.1| alanyl-tRNA synthetase [Brucella sp. BO2]
 gi|306289733|gb|EFM60922.1| alanyl-tRNA synthetase [Brucella sp. BO2]
          Length = 885

 Score =  919 bits (2376), Expect = 0.0,   Method: Composition-based stats.
 Identities = 475/893 (53%), Positives = 623/893 (69%), Gaps = 36/893 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M+ V+ IR+TFL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG E   Y  
Sbjct: 1   MAGVNEIRSTFLDYFRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRSYNR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE AI  AW+L+T+EF L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEDAISFAWNLITREFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + +L +TVY  D++A   WKKI+GLS D+IIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 121 PKDKLLVTVYHTDDDAANFWKKIAGLSDDRIIRIPTSDNFWAMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R+IEIWNLVFMQFEQQ  + R  LP+ SIDTGMGLER+A VLQ 
Sbjct: 181 DHIWGGPPGSPEEDGDRFIEIWNLVFMQFEQQTPELRIDLPRPSIDTGMGLERIAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NYDIDLFK LI+ASE+ TG+K EG+   +HRVI DHLR+SSFLIADG+LP+NEGRGY
Sbjct: 241 VHDNYDIDLFKALIRASEEATGVKAEGDFRASHRVIADHLRASSFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  LLPAL  EMG AYPELI+A+ LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAKEPLMWRLLPALIREMGQAYPELIRAEALISETLKLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL     +L + + L+G+ AFKLYDT+G PLD+ QD L  RG   +D   FN
Sbjct: 361 KTLERGLGLLSDASENLAEGDRLDGETAFKLYDTYGFPLDLTQDALRQRG-IAVDTEGFN 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E Q++ ARA+  G G   TE IWF +K+K GAT+F+GY+                  
Sbjct: 420 AAMERQKAEARANWTGSGEAATETIWFGIKDKVGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     ++ ++V+ G  V     G+ + VV +QTPFY E+GGQ GDTG   G+G 
Sbjct: 462 -----TESAEGVIASLVRDGVEVPSVREGETISVVVNQTPFYGESGGQQGDTGTISGEGF 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
            + + D QKK EG+FVH   V +G  +    + L +D   R ++  NHSATHLLH AL  
Sbjct: 517 VIAVKDTQKKGEGVFVHIGEVTKGTAKAGDVVELKVDSARRTRIRSNHSATHLLHEALRE 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
            LG+HV+Q GS + PD LRFD +H KPI++ EL+++E+  N+II QN PV TR+M  +DA
Sbjct: 577 TLGTHVAQKGSLVAPDRLRFDFSHPKPISAEELEAVENLANEIILQNAPVTTRLMAVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSV-----EYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           I  GA AL G KY D VRVVS+       + G  +S  LCGGTHV  TG+I L+ IVSE 
Sbjct: 637 ITEGAMALFGEKYGDEVRVVSMGTAKHGSKAGKAYSVELCGGTHVRQTGDIGLVRIVSEG 696

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
            + AG+RR+EA+TG+ AR +L  QDE++K++AS LK +  +V+ RV  + +E +KL+   
Sbjct: 697 GVAAGVRRLEALTGEAARLYLEEQDERVKAIASALKTTSADVLDRVNALIDERKKLEREL 756

Query: 775 AKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
           A  + +L +         +   +  VNF+  I++ V  ++LK + D  +K++ SG+++ +
Sbjct: 757 ADARKKLALGGGSSDGGSAVEAVNGVNFLGKIVTGVSPRDLKPLADEGKKQVGSGVVLFI 816

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPN 881
           G+ ++ KAS +  VTED++ RF+AVDL R ++  LGG GGGGRP MAQ+GGP+
Sbjct: 817 GVGEDGKASAVAAVTEDMVGRFSAVDLVRAASAALGGAGGGGRPDMAQAGGPD 869


>gi|157374457|ref|YP_001473057.1| alanine--tRNA ligase [Shewanella sediminis HAW-EB3]
 gi|205830208|sp|A8FSV6|SYA_SHESH RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|157316831|gb|ABV35929.1| Alanine--tRNA ligase [Shewanella sediminis HAW-EB3]
          Length = 874

 Score =  919 bits (2376), Expect = 0.0,   Method: Composition-based stats.
 Identities = 377/909 (41%), Positives = 546/909 (60%), Gaps = 54/909 (5%)

Query: 3   NVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVT 62
             +++R+ FLE+F+ NGH+++ SSSL+P NDPTL+FTN+GM  FK++F G++K  Y   T
Sbjct: 4   TTAALRSAFLEYFRTNGHQVVDSSSLVPVNDPTLLFTNAGMNQFKDVFLGEDKRSYTRAT 63

Query: 63  TVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQ 122
           + Q+CVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK  AI  AW+ LT+E  L +
Sbjct: 64  SSQRCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKRDAISFAWNFLTQELKLPK 123

Query: 123 RRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSEI 175
            RL +T+Y+ D+EA+ +W K  G+ A+ +IRI  N       DNFW M +TGPCGPCSEI
Sbjct: 124 ERLCVTIYETDDEAYDIWTKEIGVPAENLIRIGDNKGAPYASDNFWQMGDTGPCGPCSEI 183

Query: 176 FFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMA 234
           F+D G+ I GG P    E+G+R+IEIWN+VFMQ+ +Q+  E   LPK S+DTGMG+ER+A
Sbjct: 184 FYDHGDHIWGGRPGTPEEDGDRFIEIWNIVFMQYNRQSDGEMLPLPKPSVDTGMGIERIA 243

Query: 235 TVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPAN 294
            ++Q   +NY+ID+F+ LI+ + ++  +        + RVI DH+RS +FLIADG++P+N
Sbjct: 244 AIMQGVHSNYEIDIFQALIKKTAEILSVTD--LENKSLRVISDHIRSCAFLIADGVMPSN 301

Query: 295 EGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSE 354
           EGRGYVLRRI+RRA+ +   LG ++     L+P L   MG A   L+  + ++E++L++E
Sbjct: 302 EGRGYVLRRIIRRAVRHGNKLGASDSFFYKLVPTLIEVMGDAAKGLVATQAIVEKSLKAE 361

Query: 355 DERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGID 414
           +E+F +TL+RGL +LDG L+ L   ++L+G+ AFKLYDT+G P+D+  D+   R +  +D
Sbjct: 362 EEQFARTLERGLGILDGALNALK-GDVLDGETAFKLYDTYGFPVDLTADVCREREIT-VD 419

Query: 415 IISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRK 474
              F  A+ EQRSRA+A       G  E  +    +    T F GY  L           
Sbjct: 420 EAGFEVAMAEQRSRAQAA------GQFETDYNDSLKIDELTHFSGYTELTAP-------- 465

Query: 475 VLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCA 534
                            + AI   GE V    +G +  +V D TPFY E+GGQ GD G  
Sbjct: 466 ---------------GKITAIYMAGESVNSLSAGDEAVIVLDSTPFYGESGGQCGDRGVL 510

Query: 535 IGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLH 594
              GI   + D QK  + +      +  G L    SL   +D + R +  +NHS THLLH
Sbjct: 511 SAKGIEFDVKDTQKYGQAVGHQ-GALTSGTLSVGDSLEANVDKKLRHRTELNHSVTHLLH 569

Query: 595 HALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIM 654
            AL  +LG+HV+Q GS +  + LRFD +H + +   ELK++ED VN  I +N  +   +M
Sbjct: 570 AALRQLLGTHVTQKGSLVDSERLRFDFSHFEGVKPEELKAVEDLVNTQIRRNHKLSAEVM 629

Query: 655 NREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           + + A   GA AL G KY D VRVV++     G  S  LCGGTHV  TG+I L  I SE 
Sbjct: 630 DMDQAKEKGAMALFGEKYTDEVRVVTM-----GDFSIELCGGTHVGRTGDIGLFKITSEG 684

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
            I AG+RRIEA+TG  A +++ GQ  +L   A+ LK    +VV +++   +  + L+   
Sbjct: 685 GIAAGVRRIEAVTGAAAMAYVAGQKAELDQAAALLKADSASVVSKLKAQLDRTKLLEKEL 744

Query: 775 AKRKLQLNVE-----DLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVG 829
           ++ K +L             ++  VN +   +  V++  L+ + D L++K+ SGI++L G
Sbjct: 745 SQLKDKLAAATSADLAGEAQQVNGVNVLVKKLDGVEAGALRGLQDELKQKLGSGIVVL-G 803

Query: 830 ISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAI 889
           I+ + K ++++ VT+DL  +  A +L    A  + GG GGGRP MAQ+GG      D A+
Sbjct: 804 IAGDAKVNLIVGVTKDLTSKVKAGELVASIASQV-GGKGGGRPDMAQAGGSQPENLDSAL 862

Query: 890 AGVASFLKK 898
             V  +L +
Sbjct: 863 EQVIPWLTE 871


>gi|209549551|ref|YP_002281468.1| alanyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209535307|gb|ACI55242.1| alanyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 884

 Score =  919 bits (2376), Expect = 0.0,   Method: Composition-based stats.
 Identities = 492/896 (54%), Positives = 631/896 (70%), Gaps = 38/896 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+TFL++F+KNGHE++ SS L+P NDPTLMFTN+GMV FKN+FTG EK  Y  
Sbjct: 1   MSGVNDIRSTFLDYFKKNGHEIVSSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEKRPYST 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RH TFFEMLGNFSFG YFKE AI+LAW L+T+ FDL
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHLTFFEMLGNFSFGDYFKENAIELAWKLVTEGFDL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + RL +TVY EDEEA  LWKKI+G S DKIIRI T+DNFW M +TGPCGPCSEIF DQG
Sbjct: 121 PKHRLLVTVYSEDEEAATLWKKIAGFSDDKIIRIPTSDNFWQMGDTGPCGPCSEIFIDQG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           E + GG PGS  E+G+R++E WNLVFMQFEQ     R  LP+ SIDTGMGLERMA +LQ 
Sbjct: 181 ENVWGGPPGSPEEDGDRFLEFWNLVFMQFEQTEPGVRNPLPRPSIDTGMGLERMACILQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             + +D DLF+ LI A E+  G K       +HRVI DHLRSS+FLIADG+LP+NEGRGY
Sbjct: 241 VQSVFDTDLFRTLIGAIEETMGAK--AKGSASHRVIADHLRSSAFLIADGVLPSNEGRGY 298

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  LLP L  EMG AYPEL++A+ LI ETL+ E+ RF 
Sbjct: 299 VLRRIMRRAMRHAQLLGAKEPLMYKLLPTLVQEMGRAYPELVRAEALISETLKLEEGRFR 358

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL    + LGK ++L+G+ AFKLYDT+G PLD+ QD L AR   G+DI  F 
Sbjct: 359 KTLERGLSLLSDATTDLGKGDMLDGETAFKLYDTYGFPLDLTQDALRAR-EIGVDISGFT 417

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A++ Q++ AR+H  G G   TE IWF L+EK+GAT+F+GYD                  
Sbjct: 418 DAMQRQKAEARSHWAGSGEKATETIWFELREKHGATEFLGYD------------------ 459

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +V+AIV++G   EE  +G KV++V +QTPFY E+GGQ+GDTG    D  
Sbjct: 460 -----TETAEGVVQAIVREGAAAEEVKAGDKVQIVVNQTPFYGESGGQMGDTGVISSDHG 514

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           R++I+D QKK EG+FVH  +V  G  +   ++VLT+D+  R +L  NHSATHLLH AL  
Sbjct: 515 RIEISDTQKKGEGLFVHSGVVVEGAFKAGDAVVLTVDHARRSRLRANHSATHLLHEALRE 574

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG+HV+Q GS + P+ LRFDV+H KP+++ ELK +ED  N+I+ QN  V TR+M+ +DA
Sbjct: 575 VLGTHVAQKGSLVAPERLRFDVSHPKPMSAEELKIVEDMANEIVLQNSAVTTRLMSVDDA 634

Query: 660 IASGAAALLGTKYNDRVRVVSVEYEDGG-----VHSSALCGGTHVSSTGEIMLLYIVSES 714
           I  GA AL G KY D VRVVS+     G      +S  LCGGTHVS+TG+I L+ ++ ES
Sbjct: 635 IEEGAMALFGEKYGDEVRVVSMGTGVHGAKSNKPYSVELCGGTHVSATGQIGLIRVLGES 694

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
           ++ AG+RRIEA+TG+ AR +L  QD+++K+LA+ LKV    V+ RVE + +E RKL+   
Sbjct: 695 AVGAGVRRIEAVTGESAREYLAEQDDRVKTLAASLKVQPSEVLSRVEALMDERRKLEKEL 754

Query: 775 AKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
           A  K +L +         +  ++A V F+   IS VD K+LK + D  +  I SG++ L+
Sbjct: 755 ADAKRKLAMGGGQGGSADAVREVAGVKFLGKSISGVDPKDLKGLADDGKTSIGSGVVTLI 814

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNK 884
           G+S + KAS ++ VT DL+DRF+AVDL R+++  LGG GGGGRP MAQ+GGP+G K
Sbjct: 815 GVSDDGKASAVVAVTPDLVDRFSAVDLVRVASAALGGKGGGGRPDMAQAGGPDGAK 870


>gi|87122506|ref|ZP_01078386.1| alanyl-tRNA synthetase [Marinomonas sp. MED121]
 gi|86162299|gb|EAQ63584.1| alanyl-tRNA synthetase [Marinomonas sp. MED121]
          Length = 871

 Score =  919 bits (2376), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/908 (41%), Positives = 542/908 (59%), Gaps = 54/908 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              S +R +FL++F+   H+++ SSSLIP NDPTL+FTN+GMV FK++F G +   Y   
Sbjct: 1   MKSSELRQSFLKYFESKQHQVVDSSSLIPGNDPTLLFTNAGMVQFKDVFLGMDDRPYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFKE AIQ AW+ LT+   L 
Sbjct: 61  TSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKEDAIQYAWEFLTQVLKLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L +TVY +D+EA+ +W K  G+  D+I+RI  N       DNFW M +TGPCGPC+E
Sbjct: 121 TEKLLVTVYADDDEAWDIWAKKIGVPEDRIVRIGDNKGARYASDNFWQMGDTGPCGPCTE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D GE I GG PGS  E+G+R+IEIWN+VFMQF +        LPK S+DTGMGLER+
Sbjct: 181 IFYDHGEHIWGGPPGSPEEDGDRFIEIWNVVFMQFNRDANGVMNPLPKPSVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A +LQ   +NY+ID+F++LI+A+ +V G         + RVI DH+RS SF+I DGI+P+
Sbjct: 241 AAILQGVHSNYEIDIFQNLIKAAAKVVGTDD--LEAQSLRVIADHIRSCSFMIVDGIVPS 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG  +     L+  L TEMG AYP+L +    I+  L  
Sbjct: 299 NEGRGYVLRRIVRRAIRHGHKLGQKQAFFNTLVADLVTEMGDAYPDLAKLADRIQAILLK 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGI 413
           E+E+F KTL++G+ +LD  +  LG  +I++G+  FKLYDT+G P D+  D+   R    I
Sbjct: 359 EEEQFAKTLEQGMRILDDAIGELGDSKIISGETVFKLYDTYGFPADLTNDVARER-HLEI 417

Query: 414 DIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDR 473
           D   F +A+EEQR+RAR+ S      +          + G T+F GY  L          
Sbjct: 418 DEKGFERAMEEQRNRARSASQFTMDMSGSI-------EAGDTEFTGYSHLVD-------- 462

Query: 474 KVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGC 533
                             ++A++  GE VE   +GQ   V+  QTPFY E+GGQ+GD G 
Sbjct: 463 ---------------ECEIEALILDGEKVESLTAGQSGIVILKQTPFYGESGGQVGDQGW 507

Query: 534 AIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLL 593
             G+G          K     +HH  +  G +     L  T+D   R    +NHSATHL+
Sbjct: 508 LRGNGA--FSVTNTTKQGKTHLHHGELREGSITLGDKLTATVDASLRAATGLNHSATHLM 565

Query: 594 HHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRI 653
           H AL  ++G HV Q GS    + LRFD +H + +T+AE++ +ED VN+ I  N  V+T  
Sbjct: 566 HEALRRVVGDHVHQKGSLCDAERLRFDFSHFEGVTAAEIEQVEDMVNEQIRLNHEVLTEE 625

Query: 654 MNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSE 713
           M+ E A   GA AL G KY+ +VRV+++       +S  LCGGTHV  TG+I +  IV+E
Sbjct: 626 MDIESAKERGAMALFGEKYDSQVRVLTMGS----EYSIELCGGTHVKRTGDIGVFKIVAE 681

Query: 714 SSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLI 773
           S I AG+RRIEAITG+ A  +    ++ ++ +A+ +K ++ N++ +V  + ++ R LQ  
Sbjct: 682 SGIAAGVRRIEAITGKVAIDYNRATEKSVQQVAALVKGNKENMIEKVTALSDQNRALQKE 741

Query: 774 HAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
               K +L  +  S        I     +   +   D K L+ ++D L+ K++S +I+L 
Sbjct: 742 LDVIKAKLAAQAGSDLASQAVDIDGGKLLVAQVDVEDPKALRDMLDELKSKLESAVILLA 801

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQA 888
            +  + K S++  VT++L  +  A DL ++ A ++  G GGGRP MAQ+GG N     +A
Sbjct: 802 SV-NDSKVSLIAGVTKELTKKVKAGDLIKMVAPLV-DGRGGGRPDMAQAGGNNPAGLPEA 859

Query: 889 IAGVASFL 896
           +A V  ++
Sbjct: 860 LASVQPWV 867


>gi|190892008|ref|YP_001978550.1| alanyl-tRNA synthetase protein [Rhizobium etli CIAT 652]
 gi|190697287|gb|ACE91372.1| alanyl-tRNA synthetase protein [Rhizobium etli CIAT 652]
          Length = 884

 Score =  919 bits (2375), Expect = 0.0,   Method: Composition-based stats.
 Identities = 487/896 (54%), Positives = 634/896 (70%), Gaps = 38/896 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+TFL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG EK  Y  
Sbjct: 1   MSGVNDIRSTFLDYFKKNGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEKRPYST 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RH TFFEMLGNFSFG YFKE AI+LAW L+T+ F L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHLTFFEMLGNFSFGDYFKENAIELAWKLVTEGFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + RL +TVY EDEEA  LWKKI+G S DKIIRI T+DNFW M +TGPCGPCSEIF DQG
Sbjct: 121 PKHRLLVTVYSEDEEAATLWKKIAGFSDDKIIRIPTSDNFWQMGDTGPCGPCSEIFIDQG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           E + GG PGS+ E+G+R++E WNLVFMQFEQ     R  LP+ SIDTGMGLERMA +LQ 
Sbjct: 181 ENVWGGPPGSAEEDGDRFLEFWNLVFMQFEQIEPGVRNPLPRPSIDTGMGLERMACILQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             + +D DLF+ L  A E   G+K       +HRVI DHLRSS+FLIADG+LP+NEGRGY
Sbjct: 241 VQSVFDTDLFRTLTGAIEDAAGVK--AEGSASHRVIADHLRSSAFLIADGVLPSNEGRGY 298

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPL+  LLP L  +MG AYPEL++A+ LI ETL+ E+ RF 
Sbjct: 299 VLRRIMRRAMRHAQLLGAKEPLIYKLLPTLVQQMGRAYPELVRAEALISETLKLEENRFR 358

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL    + L K ++L+G+ AFKLYDT+G PLD+ QD L AR   G+DI  F 
Sbjct: 359 KTLERGLSLLSDATADLSKGDMLDGETAFKLYDTYGFPLDLTQDALRAR-EIGVDISGFT 417

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A++ Q++ AR+H  G G   TE +WF L+EK+GAT+F+GYD                  
Sbjct: 418 DAMQRQKAEARSHWAGSGEKATETVWFELREKHGATEFLGYD------------------ 459

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +V+AIV+ G + E A +G KV+VV +QTPFY E+GGQ+GDTG    D  
Sbjct: 460 -----TEAAEGVVQAIVKDGAVAEGAKAGDKVQVVVNQTPFYGESGGQMGDTGVISSDHG 514

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           +++I+D QKK EG+FVH   V  G  +T  ++VLT+D+  R +L  NHSATHLLH AL  
Sbjct: 515 KIEISDTQKKGEGLFVHSGTVVEGAFKTGDAVVLTVDHARRSRLRANHSATHLLHEALRE 574

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG+HV+Q GS + P+ LRFDV+H KP+T+ ELK +E+  N+I+ QN PV TR+M+ +DA
Sbjct: 575 VLGTHVAQKGSLVAPERLRFDVSHPKPMTAEELKIVEEMANEIVLQNAPVTTRLMSVDDA 634

Query: 660 IASGAAALLGTKYNDRVRVVSVEY-----EDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+       +    +S  LCGGTHVS+TG+I L+ I+ ES
Sbjct: 635 IAEGAMALFGEKYGDEVRVVSMGTGLHGAKSNKPYSVELCGGTHVSATGQIGLVRILGES 694

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
           ++ AG+RR+EA+TG+ AR++L  QD+++K+LA+ LKV    V+ RVE + +E RKL+   
Sbjct: 695 AVGAGVRRLEAVTGESARAYLAEQDDRVKTLAASLKVQPSEVLSRVETLIDERRKLEREL 754

Query: 775 AKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
           A  K +L +         +  ++A V ++   ++ VD K+LK + D  +  I SGI+ L+
Sbjct: 755 ADAKRKLAMGGGQGGSADAVREVAGVKYLGKAVAGVDPKDLKGLADDGKASIGSGIVTLI 814

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNK 884
           G+S++ KAS ++ VT DL+DRF+AVDL R+++  LGG GGGGRP MAQ+GGP+G K
Sbjct: 815 GVSEDGKASAVVAVTPDLVDRFSAVDLVRVASAALGGKGGGGRPDMAQAGGPDGAK 870


>gi|27380861|ref|NP_772390.1| alanyl-tRNA synthetase [Bradyrhizobium japonicum USDA 110]
 gi|27354027|dbj|BAC51015.1| alanyl-tRNA synthetase [Bradyrhizobium japonicum USDA 110]
          Length = 894

 Score =  919 bits (2375), Expect = 0.0,   Method: Composition-based stats.
 Identities = 458/911 (50%), Positives = 615/911 (67%), Gaps = 41/911 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+TFL FF +NGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG EK  YQ 
Sbjct: 3   MSGVNEIRSTFLNFFAENGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRPYQR 62

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RH TFFEMLGNFSFG YFKERAI+LAW L+TK+F L
Sbjct: 63  ATTSQKCVRAGGKHNDLDNVGYTARHLTFFEMLGNFSFGDYFKERAIELAWKLITKDFGL 122

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
           ++ +L +TVY  D+EA  LWKKI+G S D+IIRI T+DNFW+M +TGPCGPCSEIF D+G
Sbjct: 123 NKDKLLVTVYHTDDEAHGLWKKIAGFSDDRIIRIPTSDNFWAMGDTGPCGPCSEIFIDRG 182

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R++E WNLVFMQ+EQ  K+ER  LP+ SIDTGMGLERMA ++Q 
Sbjct: 183 DHIWGGPPGSPEEDGDRFLEFWNLVFMQYEQVTKEERVDLPRPSIDTGMGLERMACIMQG 242

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             + ++ DLF+HLI A+    G       + + RVI DHLRSS+FL++DG+LP+NEGRGY
Sbjct: 243 VDSVFETDLFRHLIDATASALGSGPNEQTVASFRVIADHLRSSAFLVSDGVLPSNEGRGY 302

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  L+ AL  EMG AYPEL++A+ LIEETLR E+ RF 
Sbjct: 303 VLRRIMRRAMRHAQLLGAKEPLMHRLVWALVREMGQAYPELMRAEKLIEETLRLEETRFR 362

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL RGL +LD   + L K ++ +GDVAF LYDT+G PLD+ QD L +RG  G+D  +F 
Sbjct: 363 KTLTRGLAILDEKSASLKKGDMFDGDVAFTLYDTYGFPLDLTQDALKSRG-IGVDQSAFT 421

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E Q+++AR    G G   +E IWF L+EK GAT+F+GY+                  
Sbjct: 422 DAMERQKAKARESWKGSGEAASEAIWFPLREKLGATEFLGYE------------------ 463

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +V A+V+ G+      +G+   +V +QTPFYAE+GGQ+GDTG  +G+G 
Sbjct: 464 -----TESAEGVVSALVKDGQEAASLKAGETGALVLNQTPFYAESGGQVGDTGVLLGEGG 518

Query: 540 -RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALS 598
            + ++TD QKK   +FVH   VE G L+   +L L +D+  R  +  +HSATHL+H AL 
Sbjct: 519 VKFRVTDTQKKLGDLFVHVGTVESGELKLGTALQLEVDHSRRSSIRAHHSATHLIHEALR 578

Query: 599 TILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNRED 658
            +LG H++Q GS + PD LRFD  H KPIT+ EL  +ED  ND++ +N  V TR+M  ++
Sbjct: 579 QVLGDHIAQRGSMVAPDRLRFDFVHPKPITAEELARVEDIANDVVLENDEVTTRVMGVDE 638

Query: 659 AIASGAAALLGTKYNDRVRVVSVE------YEDGGVHSSALCGGTHVSSTGEIMLLYIVS 712
           A  +GA AL G KY D VRVVS+         +    S  LCGGTHV  TG+I L+ +  
Sbjct: 639 AREAGARALFGEKYGDEVRVVSMGRTARERGANALGWSVELCGGTHVRRTGDIGLITLTG 698

Query: 713 ESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQL 772
           ES++ +G+RRIEA+TG  AR H        K+ A+ L+ S  +V  R+  + EE +KL+ 
Sbjct: 699 ESAVASGVRRIEALTGNYARKHANDTMALAKTAANELRTSIDDVPARITALMEERKKLER 758

Query: 773 IHAKRKLQLNV---------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSG 823
             +  + +L +               ++ DV  M+  +  ++ K+LKS+ D  +K+I SG
Sbjct: 759 ELSDARKKLAMGGGAAASNGAASGVREVGDVKLMARAVEGIEMKDLKSLADDGKKQIGSG 818

Query: 824 IIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGN 883
           ++ +VG++ + KA +++ VT DL  RFNAV+L R++++ LGG GGGGRP MAQ+GGP+G 
Sbjct: 819 VVAIVGVTGDGKAGIVVGVTADLTARFNAVNLVRVASEALGGKGGGGRPDMAQAGGPDGA 878

Query: 884 KADQAIAGVAS 894
           KA +A+A +  
Sbjct: 879 KAPEALAAIEK 889


>gi|324111325|gb|EGC05307.1| alanyl-tRNA synthetase [Escherichia fergusonii B253]
          Length = 876

 Score =  919 bits (2375), Expect = 0.0,   Method: Composition-based stats.
 Identities = 397/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           +S  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LSGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|325579107|ref|ZP_08149063.1| alanine--tRNA ligase [Haemophilus parainfluenzae ATCC 33392]
 gi|325159342|gb|EGC71476.1| alanine--tRNA ligase [Haemophilus parainfluenzae ATCC 33392]
          Length = 874

 Score =  919 bits (2375), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/911 (42%), Positives = 545/911 (59%), Gaps = 56/911 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR +FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSFLDFFHSKGHQVVASSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAINFAWEYLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ D EA+ +W K  G+ A++IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDNEAYDIWHKEVGVPAERIIRIGDNKGAPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LP+ S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNVVFMQFNRLADGTMEKLPRPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NY+ID+F+ LI  + +V G         + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYEIDIFQKLIAKTAEVVGTTD--LTNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   M  A  E+ + +  +E+ 
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGHLLGAKEAFFYKLVPTLIEVMAEAGKEVKEKQANVEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  L+ +  D +L+G+VAFKLYDT+G PLD+  D+   R  
Sbjct: 359 LRLEEEQFARTLERGLSLLDDALAQVK-DGVLSGEVAFKLYDTYGFPLDLTADVCRERD- 416

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F + +E QR RA++ S           + ++    G T+F GY          
Sbjct: 417 IAIDEAGFEREMEAQRLRAQSASQFGM------DYNNVIRVEGETKFEGYTESESL---- 466

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + V A+   G+ VE   +GQ   V+ + TPFYAE+GGQ+GD
Sbjct: 467 -------------------AKVTALFHDGKSVESITAGQSAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G     GI+  + D QK    +F H   +E+G L+   ++   +D   R Q S+NHSAT
Sbjct: 508 SGYLTSQGIQFNVKDTQKYG-QVFGHIGELEQGTLKVGQTVNAVVDAARRHQTSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV Q GS ++   LRFD  H + IT A+L  IE  VN  + +N  V 
Sbjct: 567 HLLHAALRQVLGHHVVQKGSLVSDTALRFDFAHPEAITKAQLNEIETLVNQKVRENFVVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T +M+ E A A GA AL G KY D VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TDVMDIEAAKAKGAMALFGEKYADVVRVLTM-----GDFSVELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           V+E+++ AG+RRIEA+TG+ A + L  Q   L   A   K     +V +++++ ++ +K 
Sbjct: 682 VAETAVAAGVRRIEAVTGENAMNWLHNQQRILTQSADLFKSDVNTLVEKIQQLQDKAKKA 741

Query: 771 QLIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI DV+ + H +  +++K L+ ++D L+ ++ SG+I
Sbjct: 742 EKELQGLKEKAAMQAGSDLVKSAVKINDVSVIVHQLDGIETKSLRVMVDDLKNQLGSGVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +   I  + K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 VFASIL-DDKVNLVVGVTSDLTTKVKAGELVNLMAQQV-GGKGGGRPDMAMAGGSQPENV 859

Query: 886 DQAIAGVASFL 896
           + A+    ++L
Sbjct: 860 NLALTVAQNWL 870


>gi|33602167|ref|NP_889727.1| alanyl-tRNA synthetase [Bordetella bronchiseptica RB50]
 gi|41018190|sp|Q7WHL6|SYA_BORBR RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|33576605|emb|CAE33683.1| alanyl-tRNA synthetase [Bordetella bronchiseptica RB50]
          Length = 874

 Score =  919 bits (2374), Expect = 0.0,   Method: Composition-based stats.
 Identities = 398/911 (43%), Positives = 547/911 (60%), Gaps = 53/911 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              S IR  FL+FFQ  GH ++PSSSL+P NDPTL+FTNSGMV FK++FTG+E   Y+  
Sbjct: 1   MKSSEIRQKFLQFFQSKGHTIVPSSSLVPANDPTLLFTNSGMVQFKDVFTGKEARAYKRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT+ + L 
Sbjct: 61  TSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIQYAWELLTQVYRLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY ED+EA+ +W K  G+ A++IIRI  N       DNFW MA+TGPCGPCSE
Sbjct: 121 AEKLWVTVYQEDDEAYDIWAKEVGVPAERIIRIGDNKGARYASDNFWQMADTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  I GG PGS  E+G+RYIEIWNLVFMQFE+        LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPEIWGGPPGSPEEDGDRYIEIWNLVFMQFERDAAGNMERLPKPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI A+ + TG+K   +N  + +VI DH+R+ +FLI DGI+P+
Sbjct: 241 AAVLQHVHSNYEIDLFQKLIAAAARETGVKDLADN--SLKVIADHIRACAFLIVDGIIPS 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG T+P    L+P L  EMG AYPEL Q    + + LR 
Sbjct: 299 NEGRGYVLRRIVRRALRHGYKLGQTKPFFHRLVPDLVAEMGEAYPELAQVAERVAQVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGI 413
           E+ERFG+TL+ G+ +LDG L+ + K + L+G   F LYDT+G P+D+  DI   RG   +
Sbjct: 359 EEERFGETLEHGMKILDGALAKVAKGDPLDGTTLFTLYDTYGFPVDLTADICRERG-VEV 417

Query: 414 DIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDR 473
           D+  F  A++ QR +ARA      +         L  +   T+F GY+ L  S       
Sbjct: 418 DMAGFEAAMQRQREQARAAGKFKMAEG-------LSYEGAETRFEGYESLELSGV----- 465

Query: 474 KVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGC 533
                             V A+  +G  VE+  +GQ   VV D TPFYAE+GGQ+GDTG 
Sbjct: 466 -----------------KVTALYVEGTQVEQVSAGQDAVVVLDATPFYAESGGQVGDTGL 508

Query: 534 AIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLL 593
               G+R  + D  K   G+F HH  +E G L+   +L+  +D   R +   NHSATHL+
Sbjct: 509 LEAGGVRFAVADTLKIQPGVFGHHGTLEAGALKVGDTLLARVDAVRRARTVRNHSATHLM 568

Query: 594 HHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRI 653
           H AL  +LG+HV Q GS + PD  RFD  H  P+T+ ++  +E  VN  +  N     ++
Sbjct: 569 HKALREVLGAHVQQRGSLVDPDKTRFDFAHDAPMTAEQIARVEAIVNAEVLANQATEAKV 628

Query: 654 MNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSE 713
           M  +DA+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  +VSE
Sbjct: 629 MAYDDAVKGGAMALFGEKYGDTVRVLDIG------FSRELCGGTHVRRTGDIGLFKVVSE 682

Query: 714 SSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLI 773
             + AG+RRIEAITG  A + +  Q+  L+  A  L+     +  R+ ++ E+ + L+  
Sbjct: 683 GGVAAGVRRIEAITGDNALAWVQDQNALLQRAAGVLRAPAHELPERIVQVQEQLKALEKE 742

Query: 774 HAKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
             + + +L           +  ++  +  ++  I +VD K L+ ++D L+ +++  +++L
Sbjct: 743 LEQARTKLAASAGNDLAATATVEVKGIKVLAASIGDVDPKALRGMVDNLKDRLKPAVVLL 802

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQ 887
              S + K S++  VT DL  R  A DL    A  +GG G GGRP MA  GG +      
Sbjct: 803 AAGSADGKISLVGGVTADLTGRIKAGDLVGFVAGQVGGKG-GGRPDMAMGGGTDLAALPA 861

Query: 888 AIAGVASFLKK 898
           A+A V  ++ +
Sbjct: 862 AVASVQKWVDE 872


>gi|331654174|ref|ZP_08355174.1| alanine--tRNA ligase [Escherichia coli M718]
 gi|331047556|gb|EGI19633.1| alanine--tRNA ligase [Escherichia coli M718]
          Length = 876

 Score =  919 bits (2374), Expect = 0.0,   Method: Composition-based stats.
 Identities = 395/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV+Q GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVTQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|251788614|ref|YP_003003335.1| alanyl-tRNA synthetase [Dickeya zeae Ech1591]
 gi|247537235|gb|ACT05856.1| alanyl-tRNA synthetase [Dickeya zeae Ech1591]
          Length = 875

 Score =  919 bits (2374), Expect = 0.0,   Method: Composition-based stats.
 Identities = 388/910 (42%), Positives = 543/910 (59%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRNYVRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIIYAWELLTSSEWFG 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY  D+EA+ +W    G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKEKLWVTVYATDDEAYDIWANEVGVPHERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           SEIF+D G+ I GG PGS  E+G+RYIEIWNLVFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 SEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNLVFMQFNRQADGTMLPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R++ VLQ   +NYDIDLF  LI  + +V G      N  + RVI DH+RS +FLIADG++
Sbjct: 243 RISAVLQHVNSNYDIDLFSTLIAEAARVVGTDD--LNNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  EL + + L+E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAIRHGNMLGAKETFFYKLVGPLVDVMGSAAEELKRQQSLVEQAL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL+LLD  +  L   + L+G+ AF+LYDT+G P+D+  D+   R L 
Sbjct: 361 KNEEEQFARTLERGLLLLDEEIKQLK-GDTLSGEAAFRLYDTYGFPVDLTADVCRERNLK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F +A+E QR RAR       +      + SL     +T F GY+          
Sbjct: 420 -VDEAGFERAMEAQRQRAR------DASGFGADYNSLIRVDESTTFCGYERTEQ------ 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             S V AI +QGE V+E  +G    V+  +TPFY E+GGQ+GD 
Sbjct: 467 -----------------QSTVVAIYRQGESVQEIQAGDDAVVILSETPFYGESGGQVGDQ 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G  +    R  + D QK  +    H   + +G+LR    +   +D+  R ++ +NHSATH
Sbjct: 510 GTLVSAAARFSVVDAQKYGQ-AIGHVGSLVQGVLRVNDKVDAAVDHVRRDRIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV+Q GS +  + LRFD +H + +   +++ +ED VN  I +NLPV T
Sbjct: 569 LLHAALRQVLGDHVAQKGSLVNDNYLRFDFSHPEAMKPEQIRQVEDIVNTQIRRNLPVDT 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            +M  + A A GA AL G KY+++VRV+S+     G  S  LCGGTH   TG+I L  IV
Sbjct: 629 DVMALDAARAKGAMALFGEKYDEQVRVLSM-----GDFSIELCGGTHARRTGDIGLFQIV 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A   L  Q + L  +   +K    N+  +V  + E  R L+
Sbjct: 684 SESGTAAGVRRIEAVTGENAIVALHQQSDVLHEVTQLVKGDSNNLADKVRSLLERTRGLE 743

Query: 772 LIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++ S        I  V  +   ++ V+ K L++++D L+ ++ S +I+
Sbjct: 744 KELQQLKEQQAAQESSSLSGKAKDINGVKLLVTQLNNVEPKLLRTMVDDLKNQLGSAVIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L     + K S++  VT++L DR  A +L    A  + GG GGGRP MAQ+GG +     
Sbjct: 804 L-STVADGKVSLIAGVTKELTDRVKAGELVGFVANQV-GGKGGGRPDMAQAGGSDVGALP 861

Query: 887 QAIAGVASFL 896
            A+  + +++
Sbjct: 862 SALTSIEAWV 871


>gi|323978695|gb|EGB73777.1| alanyl-tRNA synthetase [Escherichia coli TW10509]
          Length = 876

 Score =  919 bits (2374), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGVNFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSKLSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|306844100|ref|ZP_07476694.1| alanyl-tRNA synthetase [Brucella sp. BO1]
 gi|306275543|gb|EFM57275.1| alanyl-tRNA synthetase [Brucella sp. BO1]
          Length = 885

 Score =  919 bits (2374), Expect = 0.0,   Method: Composition-based stats.
 Identities = 476/893 (53%), Positives = 624/893 (69%), Gaps = 36/893 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M+ V+ IR+TFL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG E   Y  
Sbjct: 1   MAGVNEIRSTFLDYFRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRSYNR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE AI  AW+L+T+EF L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEDAISFAWNLITREFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + +L +TVY  D++A   WKKI+GLS D+IIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 121 PKDKLLVTVYHTDDDAANFWKKIAGLSEDRIIRIPTSDNFWAMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R+IEIWNLVFMQFEQQ  + R  LP+ SIDTGMGLER+A VLQ 
Sbjct: 181 DHIWGGPPGSPEEDGDRFIEIWNLVFMQFEQQTPELRIDLPRPSIDTGMGLERIAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NYDIDLFK LI+ASE+ TG+K EG+   +HRVI DHLR+SSFLIADG+LP+NEGRGY
Sbjct: 241 VHDNYDIDLFKALIRASEEATGVKAEGDFRASHRVIADHLRASSFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  LLPAL  EMG AYPELI+A+ LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAKEPLMWRLLPALIREMGQAYPELIRAESLISETLKLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL     +L + + L+G+ AFKLYDT+G PLD+ QD L  RG   +D   FN
Sbjct: 361 KTLERGLGLLSDASENLAEGDRLDGETAFKLYDTYGFPLDLTQDALRQRG-IAVDTEGFN 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E Q++ ARA+  G G   TE IWF +K+K GAT+F+GY+                  
Sbjct: 420 VAMERQKAEARANWTGSGEAATETIWFGIKDKVGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     ++ ++V+ G  V     G+ + VV +QTPFY E+GGQ GDTG   G+G 
Sbjct: 462 -----TESAEGVIASLVRNGVEVPSVREGETISVVVNQTPFYGESGGQQGDTGTISGEGF 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
            + + D QKK EG+FVH   V +G  +    + L +D   R ++  NHSATHLLH AL  
Sbjct: 517 VIAVKDTQKKGEGVFVHIGEVTKGTAKAGDVVELKVDSARRTRIRSNHSATHLLHEALRE 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
            LG+HV+Q GS + PD LRFD +H KPI++ EL+++E+  N+II QN PV TR+M  +DA
Sbjct: 577 TLGTHVAQKGSLVAPDRLRFDFSHPKPISAEELEAVENLANEIILQNAPVTTRLMAVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSV-----EYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+       + G  +S  LCGGTHV  TG+I L+ IVSE 
Sbjct: 637 IAEGAMALFGEKYGDEVRVVSMGTAKHGSKAGKAYSVELCGGTHVRQTGDIGLVRIVSEG 696

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
            + AG+RR+EA+TG+ AR +L  QDE++K++AS LK +  +V+ RV  + +E +KL+   
Sbjct: 697 GVAAGVRRLEALTGEAARLYLEEQDERVKAIASALKTTSADVLDRVNALIDERKKLEREL 756

Query: 775 AKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
           A  + +L +         +   +  VNF+  I++ V  ++LK + D  +K++ SG+++ +
Sbjct: 757 ADARKKLALGGGSSDGGSAVEAVNGVNFLGKIVTGVSPRDLKPLADEGKKQVGSGVVLFI 816

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPN 881
           G+ ++ KAS +  VTED++ RF+AVDL R ++  LGG GGGGRP MAQ+GGP+
Sbjct: 817 GVGEDGKASAVAAVTEDMVGRFSAVDLVRAASAALGGAGGGGRPDMAQAGGPD 869


>gi|253772448|ref|YP_003035279.1| alanyl-tRNA synthetase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254162628|ref|YP_003045736.1| alanyl-tRNA synthetase [Escherichia coli B str. REL606]
 gi|242378254|emb|CAQ33029.1| alanyl-tRNA synthetase [Escherichia coli BL21(DE3)]
 gi|253323492|gb|ACT28094.1| alanyl-tRNA synthetase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253974529|gb|ACT40200.1| alanyl-tRNA synthetase [Escherichia coli B str. REL606]
 gi|253978696|gb|ACT44366.1| alanyl-tRNA synthetase [Escherichia coli BL21(DE3)]
          Length = 876

 Score =  919 bits (2374), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 559/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNTQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSKLSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +  E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVV-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|170682603|ref|YP_001744844.1| alanyl-tRNA synthetase [Escherichia coli SMS-3-5]
 gi|205830086|sp|B1LQ15|SYA_ECOSM RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|170520321|gb|ACB18499.1| alanyl-tRNA synthetase [Escherichia coli SMS-3-5]
          Length = 876

 Score =  919 bits (2374), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLATGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|256113755|ref|ZP_05454559.1| alanyl-tRNA synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|265995116|ref|ZP_06107673.1| alanyl-tRNA synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|262766229|gb|EEZ12018.1| alanyl-tRNA synthetase [Brucella melitensis bv. 3 str. Ether]
          Length = 885

 Score =  919 bits (2374), Expect = 0.0,   Method: Composition-based stats.
 Identities = 474/893 (53%), Positives = 622/893 (69%), Gaps = 36/893 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M+ V+ IR+TFL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG E   Y  
Sbjct: 1   MAGVNEIRSTFLDYFRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRSYNR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE AI  AW+L+T+EF L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEDAISFAWNLITREFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + +L +TVY  D++A   WKKI+GLS D+IIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 121 PKDKLLVTVYHTDDDAANFWKKIAGLSDDRIIRIPTSDNFWAMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R+IEIWNLVFMQFEQQ  + R  LP+ SIDTGMGLER+A VLQ 
Sbjct: 181 DHIWGGPPGSPEEDGDRFIEIWNLVFMQFEQQTPELRIDLPRPSIDTGMGLERIAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NYDIDLFK LI+A E+ TG+K EG+   +HRVI DHLR+SSFLIADG+LP+NEGRGY
Sbjct: 241 VHDNYDIDLFKALIRALEEATGVKAEGDFRASHRVIADHLRASSFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  LLPAL  EMG AYPELI+A+ LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAKEPLMWRLLPALIREMGQAYPELIRAESLISETLKLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL     +L + + L+G+ AFKLYDT+G PLD+ QD L  RG   +D   FN
Sbjct: 361 KTLERGLGLLSDASENLAEGDRLDGETAFKLYDTYGFPLDLTQDALRQRG-IAVDTEGFN 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E Q++ ARA+  G G   TE IWF +K+K GAT+F+GY+                  
Sbjct: 420 VAMERQKAEARANWTGSGEAATETIWFGIKDKVGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     ++ ++V+ G  V     G+ + VV +QTPFY E+GGQ GDTG   G+G 
Sbjct: 462 -----TESAEGVIASLVRDGVEVPSVREGETISVVVNQTPFYGESGGQQGDTGTISGEGF 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
            + + D QKK EG+FVH   V  G  +    + L +D   R ++  NHSATHLLH AL  
Sbjct: 517 VIAVKDTQKKGEGVFVHIGEVTEGTAKAGDVVELKVDSARRTRIRSNHSATHLLHEALRE 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
            LG+HV+Q GS + PD LRFD +H KPI++ EL+++E+  N+II QN PV TR+M  +DA
Sbjct: 577 TLGTHVAQKGSLVAPDRLRFDFSHPKPISAEELEAVENLANEIILQNAPVTTRLMAVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSV-----EYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+       + G  +S  LCGGTHV  TG+I L+ I+SE 
Sbjct: 637 IAEGAMALFGEKYGDEVRVVSMGTAKHGSKAGKAYSVELCGGTHVRQTGDIGLVRIISEG 696

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
            + AG+RR+EA+TG+ AR +L  QDE++K++AS LK +  +V+ RV  + +E +KL+   
Sbjct: 697 GVAAGVRRLEALTGEAARLYLEEQDERVKAIASALKTTSADVLDRVNALIDERKKLEREL 756

Query: 775 AKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
           A  + +L +         +   +  VNF+  I++ V  ++LK + D  +K++ SG+++ +
Sbjct: 757 ADARKKLALGGGSSDGGSAVEAVNGVNFLGKIVTGVSPRDLKPLADEGKKQVGSGVVLFI 816

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPN 881
           G+ ++ KAS +  VTED++ RF+AVDL R ++  LGG GGGGRP MAQ+GGP+
Sbjct: 817 GVGEDGKASAVAAVTEDMVGRFSAVDLVRAASAALGGAGGGGRPDMAQAGGPD 869


>gi|17987072|ref|NP_539706.1| alanyl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|23502078|ref|NP_698205.1| alanyl-tRNA synthetase [Brucella suis 1330]
 gi|62290112|ref|YP_221905.1| alanyl-tRNA synthetase [Brucella abortus bv. 1 str. 9-941]
 gi|82700035|ref|YP_414609.1| alanyl-tRNA synthetase [Brucella melitensis biovar Abortus 2308]
 gi|161619156|ref|YP_001593043.1| alanyl-tRNA synthetase [Brucella canis ATCC 23365]
 gi|163843466|ref|YP_001627870.1| alanyl-tRNA synthetase [Brucella suis ATCC 23445]
 gi|189024350|ref|YP_001935118.1| Alanyl-tRNA synthetase, class Iic [Brucella abortus S19]
 gi|225627671|ref|ZP_03785708.1| alanyl-tRNA synthetase [Brucella ceti str. Cudo]
 gi|237815619|ref|ZP_04594616.1| alanyl-tRNA synthetase [Brucella abortus str. 2308 A]
 gi|254689421|ref|ZP_05152675.1| alanyl-tRNA synthetase [Brucella abortus bv. 6 str. 870]
 gi|254693906|ref|ZP_05155734.1| alanyl-tRNA synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|254697556|ref|ZP_05159384.1| alanyl-tRNA synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701941|ref|ZP_05163769.1| alanyl-tRNA synthetase [Brucella suis bv. 5 str. 513]
 gi|254704486|ref|ZP_05166314.1| alanyl-tRNA synthetase [Brucella suis bv. 3 str. 686]
 gi|254706618|ref|ZP_05168446.1| alanyl-tRNA synthetase [Brucella pinnipedialis M163/99/10]
 gi|254710272|ref|ZP_05172083.1| alanyl-tRNA synthetase [Brucella pinnipedialis B2/94]
 gi|254730450|ref|ZP_05189028.1| alanyl-tRNA synthetase [Brucella abortus bv. 4 str. 292]
 gi|256031766|ref|ZP_05445380.1| alanyl-tRNA synthetase [Brucella pinnipedialis M292/94/1]
 gi|256044851|ref|ZP_05447755.1| alanyl-tRNA synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061281|ref|ZP_05451431.1| alanyl-tRNA synthetase [Brucella neotomae 5K33]
 gi|256159936|ref|ZP_05457654.1| alanyl-tRNA synthetase [Brucella ceti M490/95/1]
 gi|256255167|ref|ZP_05460703.1| alanyl-tRNA synthetase [Brucella ceti B1/94]
 gi|256257667|ref|ZP_05463203.1| alanyl-tRNA synthetase [Brucella abortus bv. 9 str. C68]
 gi|256369625|ref|YP_003107135.1| alanyl-tRNA synthetase [Brucella microti CCM 4915]
 gi|260168900|ref|ZP_05755711.1| alanyl-tRNA synthetase [Brucella sp. F5/99]
 gi|260546661|ref|ZP_05822400.1| alanyl-tRNA synthetase [Brucella abortus NCTC 8038]
 gi|260565546|ref|ZP_05836030.1| alanyl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|260566269|ref|ZP_05836739.1| alanyl-tRNA synthetase [Brucella suis bv. 4 str. 40]
 gi|260754944|ref|ZP_05867292.1| alanine-tRNA ligase [Brucella abortus bv. 6 str. 870]
 gi|260758160|ref|ZP_05870508.1| alanine-tRNA ligase [Brucella abortus bv. 4 str. 292]
 gi|260761986|ref|ZP_05874329.1| alanine-tRNA ligase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883954|ref|ZP_05895568.1| alanyl-tRNA synthetase [Brucella abortus bv. 9 str. C68]
 gi|261214196|ref|ZP_05928477.1| alanine-tRNA ligase [Brucella abortus bv. 3 str. Tulya]
 gi|261222364|ref|ZP_05936645.1| alanyl-tRNA synthetase [Brucella ceti B1/94]
 gi|261314078|ref|ZP_05953275.1| alanyl-tRNA synthetase [Brucella pinnipedialis M163/99/10]
 gi|261317834|ref|ZP_05957031.1| alanyl-tRNA synthetase [Brucella pinnipedialis B2/94]
 gi|261325289|ref|ZP_05964486.1| alanyl-tRNA synthetase [Brucella neotomae 5K33]
 gi|261752508|ref|ZP_05996217.1| alanyl-tRNA synthetase [Brucella suis bv. 5 str. 513]
 gi|261755167|ref|ZP_05998876.1| alanyl-tRNA synthetase [Brucella suis bv. 3 str. 686]
 gi|261758391|ref|ZP_06002100.1| alanyl-tRNA synthetase [Brucella sp. F5/99]
 gi|265988865|ref|ZP_06101422.1| alanyl-tRNA synthetase [Brucella pinnipedialis M292/94/1]
 gi|265991279|ref|ZP_06103836.1| alanyl-tRNA synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265998329|ref|ZP_06110886.1| alanyl-tRNA synthetase [Brucella ceti M490/95/1]
 gi|297248508|ref|ZP_06932226.1| alanyl-tRNA synthetase [Brucella abortus bv. 5 str. B3196]
 gi|54039648|sp|P67009|SYA_BRUSU RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|54042023|sp|P67008|SYA_BRUME RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|75496699|sp|Q57CU0|SYA_BRUAB RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|123547531|sp|Q2YRU8|SYA_BRUA2 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|205829996|sp|A9M5L7|SYA_BRUC2 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|205829998|sp|B0CGZ9|SYA_BRUSI RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|17982730|gb|AAL51970.1| alanyl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|23348036|gb|AAN30120.1| alanyl-tRNA synthetase [Brucella suis 1330]
 gi|62196244|gb|AAX74544.1| AlaS, alanyl-tRNA synthetase [Brucella abortus bv. 1 str. 9-941]
 gi|82616136|emb|CAJ11179.1| Alanyl-tRNA synthetase, class IIc:Phosphoesterase,
           DHHA1:Alanyl-transfer RNA synthetase [Brucella
           melitensis biovar Abortus 2308]
 gi|161335967|gb|ABX62272.1| alanyl-tRNA synthetase [Brucella canis ATCC 23365]
 gi|163674189|gb|ABY38300.1| alanyl-tRNA synthetase [Brucella suis ATCC 23445]
 gi|189019922|gb|ACD72644.1| Alanyl-tRNA synthetase, class Iic [Brucella abortus S19]
 gi|225617676|gb|EEH14721.1| alanyl-tRNA synthetase [Brucella ceti str. Cudo]
 gi|237788917|gb|EEP63128.1| alanyl-tRNA synthetase [Brucella abortus str. 2308 A]
 gi|255999787|gb|ACU48186.1| alanyl-tRNA synthetase [Brucella microti CCM 4915]
 gi|260095711|gb|EEW79588.1| alanyl-tRNA synthetase [Brucella abortus NCTC 8038]
 gi|260151614|gb|EEW86708.1| alanyl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|260155787|gb|EEW90867.1| alanyl-tRNA synthetase [Brucella suis bv. 4 str. 40]
 gi|260668478|gb|EEX55418.1| alanine-tRNA ligase [Brucella abortus bv. 4 str. 292]
 gi|260672418|gb|EEX59239.1| alanine-tRNA ligase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675052|gb|EEX61873.1| alanine-tRNA ligase [Brucella abortus bv. 6 str. 870]
 gi|260873482|gb|EEX80551.1| alanyl-tRNA synthetase [Brucella abortus bv. 9 str. C68]
 gi|260915803|gb|EEX82664.1| alanine-tRNA ligase [Brucella abortus bv. 3 str. Tulya]
 gi|260920948|gb|EEX87601.1| alanyl-tRNA synthetase [Brucella ceti B1/94]
 gi|261297057|gb|EEY00554.1| alanyl-tRNA synthetase [Brucella pinnipedialis B2/94]
 gi|261301269|gb|EEY04766.1| alanyl-tRNA synthetase [Brucella neotomae 5K33]
 gi|261303104|gb|EEY06601.1| alanyl-tRNA synthetase [Brucella pinnipedialis M163/99/10]
 gi|261738375|gb|EEY26371.1| alanyl-tRNA synthetase [Brucella sp. F5/99]
 gi|261742261|gb|EEY30187.1| alanyl-tRNA synthetase [Brucella suis bv. 5 str. 513]
 gi|261744920|gb|EEY32846.1| alanyl-tRNA synthetase [Brucella suis bv. 3 str. 686]
 gi|262552797|gb|EEZ08787.1| alanyl-tRNA synthetase [Brucella ceti M490/95/1]
 gi|263002063|gb|EEZ14638.1| alanyl-tRNA synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|264661062|gb|EEZ31323.1| alanyl-tRNA synthetase [Brucella pinnipedialis M292/94/1]
 gi|297175677|gb|EFH35024.1| alanyl-tRNA synthetase [Brucella abortus bv. 5 str. B3196]
          Length = 885

 Score =  919 bits (2374), Expect = 0.0,   Method: Composition-based stats.
 Identities = 475/893 (53%), Positives = 623/893 (69%), Gaps = 36/893 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M+ V+ IR+TFL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG E   Y  
Sbjct: 1   MAGVNEIRSTFLDYFRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRSYNR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE AI  AW+L+T+EF L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEDAISFAWNLITREFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + +L +TVY  D++A   WKKI+GLS D+IIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 121 PKDKLLVTVYHTDDDAANFWKKIAGLSDDRIIRIPTSDNFWAMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R+IEIWNLVFMQFEQQ  + R  LP+ SIDTGMGLER+A VLQ 
Sbjct: 181 DHIWGGPPGSPEEDGDRFIEIWNLVFMQFEQQTPELRIDLPRPSIDTGMGLERIAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NYDIDLFK LI+ASE+ TG+K EG+   +HRVI DHLR+SSFLIADG+LP+NEGRGY
Sbjct: 241 VHDNYDIDLFKALIRASEEATGVKAEGDFRASHRVIADHLRASSFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  LLPAL  EMG AYPELI+A+ LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAKEPLMWRLLPALIREMGQAYPELIRAESLISETLKLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL     +L + + L+G+ AFKLYDT+G PLD+ QD L  RG   +D   FN
Sbjct: 361 KTLERGLGLLSDASENLAEGDRLDGETAFKLYDTYGFPLDLTQDALRQRG-IAVDTEGFN 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E Q++ ARA+  G G   TE IWF +K+K GAT+F+GY+                  
Sbjct: 420 VAMERQKAEARANWTGSGEAATETIWFGIKDKVGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     ++ ++V+ G  V     G+ + VV +QTPFY E+GGQ GDTG   G+G 
Sbjct: 462 -----TESAEGVIASLVRDGVEVPSVREGETISVVVNQTPFYGESGGQQGDTGTISGEGF 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
            + + D QKK EG+FVH   V  G  +    + L +D   R ++  NHSATHLLH AL  
Sbjct: 517 VIAVKDTQKKGEGVFVHIGEVTEGTAKAGDVVELKVDSARRTRIRSNHSATHLLHEALRE 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
            LG+HV+Q GS + PD LRFD +H KPI++ EL+++E+  N+II QN PV TR+M  +DA
Sbjct: 577 TLGTHVAQKGSLVAPDRLRFDFSHPKPISAEELEAVENLANEIILQNAPVTTRLMAVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSV-----EYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+       + G  +S  LCGGTHV  TG+I L+ I+SE 
Sbjct: 637 IAEGAMALFGEKYGDEVRVVSMGTAKHGSKAGKAYSVELCGGTHVRQTGDIGLVRIISEG 696

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
            + AG+RR+EA+TG+ AR +L  QDE++K++AS LK +  +V+ RV  + +E +KL+   
Sbjct: 697 GVAAGVRRLEALTGEAARLYLEEQDERVKAIASALKTTSADVLDRVNALIDERKKLEREL 756

Query: 775 AKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
           A  + +L +         +   +  VNF+  I++ V  ++LK + D  +K++ SG+++ +
Sbjct: 757 ADARKKLALGGGSSDGGSAVEAVNGVNFLGKIVTGVSPRDLKPLADEGKKQVGSGVVLFI 816

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPN 881
           G+ ++ KAS +  VTED++ RF+AVDL R ++  LGG GGGGRP MAQ+GGP+
Sbjct: 817 GVGEDGKASAVAAVTEDMVGRFSAVDLVRAASAALGGAGGGGRPDMAQAGGPD 869


>gi|306812426|ref|ZP_07446624.1| alanyl-tRNA synthetase [Escherichia coli NC101]
 gi|305854464|gb|EFM54902.1| alanyl-tRNA synthetase [Escherichia coli NC101]
 gi|320194836|gb|EFW69465.1| Alanyl-tRNA synthetase [Escherichia coli WV_060327]
          Length = 876

 Score =  919 bits (2374), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKSVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|331648414|ref|ZP_08349502.1| alanine--tRNA ligase [Escherichia coli M605]
 gi|281179700|dbj|BAI56030.1| alanyl-tRNA synthetase [Escherichia coli SE15]
 gi|331042161|gb|EGI14303.1| alanine--tRNA ligase [Escherichia coli M605]
          Length = 876

 Score =  918 bits (2373), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 561/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F+ A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFDAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKSVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAVGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|330908728|gb|EGH37242.1| alanyl-tRNA synthetase [Escherichia coli AA86]
          Length = 876

 Score =  918 bits (2373), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F+ A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFDAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKSVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAVGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++ +ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRVVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|251793474|ref|YP_003008203.1| alanyl-tRNA synthetase [Aggregatibacter aphrophilus NJ8700]
 gi|247534870|gb|ACS98116.1| alanyl-tRNA synthetase [Aggregatibacter aphrophilus NJ8700]
          Length = 874

 Score =  918 bits (2373), Expect = 0.0,   Method: Composition-based stats.
 Identities = 385/912 (42%), Positives = 549/912 (60%), Gaps = 56/912 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR ++L+FF   GH+++ SSSL+P NDPTL+FTN+GM  FKN+F G EK  Y  
Sbjct: 1   MKTTAQIRQSYLDFFHSKGHQVVASSSLVPDNDPTLLFTNAGMNQFKNVFLGLEKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI   W+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIHYGWEFLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ DEEA+K+W    G+ A++IIRI  N       DNFW M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDEEAYKIWHDEIGIPAERIIRIGDNKGAPYASDNFWQMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRHADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NYDID+FK LI    ++TG K    N  + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYDIDIFKTLIAKVAELTGEKD--LNNKSLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG TE     L+P L   M  A  ++ + +  +E+ 
Sbjct: 299 VPSNEGRGYVLRRIIRRAVRHGHLLGATEAFFYKLVPTLIEVMAQAGEDVKKHQATVEKF 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  L+++  D +L+G VAFKLYDT+G PLD+  D+   RG 
Sbjct: 359 LRLEEEQFARTLERGLTLLDEALANVK-DNVLSGKVAFKLYDTYGFPLDLTADVCRERG- 416

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   F + +  QR RA++ S           + ++    G T+F GY          
Sbjct: 417 IAIDEAGFEREMASQRVRAQSASQFGM------DYNNVIRVDGTTRFEGYTESESL---- 466

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + V A+   G+ VE   +GQ+  V+ + TPFYAE+GGQ+GD
Sbjct: 467 -------------------AKVTALFHDGKAVESITAGQRAVVILENTPFYAESGGQIGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
            G   G+G    + D QK    +F H   + +G L    S+   +D   R+Q+S+NHSAT
Sbjct: 508 IGRLEGNGFIFDVKDTQKYG-QVFGHIGELTQGSLSVGQSVNAVVDDVRRQQISLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV+Q GS ++   LRFD  H + I+  +L  +E  VN  +  N PV 
Sbjct: 567 HLLHAALRQVLGEHVAQKGSLVSDALLRFDFAHHEAISKEQLAEVERIVNQQVRANNPVQ 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
           T  M  + A A GA AL G KY+++VRV+++     G  S  LCGG H   TG+I L  I
Sbjct: 627 TEAMALDAAKAKGAMALFGEKYSEQVRVLTM-----GDFSIELCGGIHAKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           V+E+++ AGIRRIEAITG+ A   L  Q   L   A  LK    ++  ++  + ++++K+
Sbjct: 682 VTETAVAAGIRRIEAITGETAIEWLQHQQTLLNQSADLLKSDVNSITDKISLLQDKFKKV 741

Query: 771 QLIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +  ++       S  KI  V+ +   +  +++K L+S++D+L+ ++ S +I
Sbjct: 742 EKELQTLKEKAALQAGNDLAQSAVKIHGVSVIVQQLDGIEAKSLRSMVDSLKNQLGS-VI 800

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           ++     ++K ++++ VT DL  +  A +L  L A+ + GG GGGRP MA +GG      
Sbjct: 801 VVFASVLDEKVNLIVGVTGDLTAKVKAGELVNLMAQQV-GGKGGGRPDMAMAGGTQPQNI 859

Query: 886 DQAIAGVASFLK 897
            +A++  + +LK
Sbjct: 860 GKALSVCSDWLK 871


>gi|292491239|ref|YP_003526678.1| alanyl-tRNA synthetase [Nitrosococcus halophilus Nc4]
 gi|291579834|gb|ADE14291.1| alanyl-tRNA synthetase [Nitrosococcus halophilus Nc4]
          Length = 873

 Score =  918 bits (2373), Expect = 0.0,   Method: Composition-based stats.
 Identities = 389/906 (42%), Positives = 550/906 (60%), Gaps = 50/906 (5%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M + + +R  FL++F+  GHE++PSS L+P NDPTL+FTN+GMV FK++F G+E   Y+ 
Sbjct: 1   MKSSAELRKIFLDYFRHQGHEIVPSSPLVPANDPTLLFTNAGMVQFKDVFLGRETRAYRR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             + Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI   W LLT+   L
Sbjct: 61  AASAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIGYGWALLTEVLKL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
              RL+ITV+++D+EA  +W K  G+S ++  R    DNFWSM +TGPCGP SEIF+D G
Sbjct: 121 PPERLWITVFEDDDEAANIWLKEIGVSPERFARCGAEDNFWSMGDTGPCGPSSEIFYDHG 180

Query: 181 ECIPGGLPGSSE-EGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
             I GG PGS E EG+RY EIWNLVFMQ+++  +     LPK S+DTGMGLER+A V+Q 
Sbjct: 181 SGIAGGPPGSPEQEGDRYTEIWNLVFMQYDRNKEGHLSPLPKPSVDTGMGLERLAAVMQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NYDIDLF++LI A   ++G++       + RVI DH+RS +FLI DG+ P+NEGRGY
Sbjct: 241 VHDNYDIDLFRNLITAITALSGIQ--NQEPTSLRVIADHIRSCAFLIVDGVQPSNEGRGY 298

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRI+RRA+ +   LG  +P    L+  L  EMG AYPEL QA+  +E  L+ E+ERF 
Sbjct: 299 VLRRIIRRAIRHGHKLGLRDPFFYQLVQPLAVEMGEAYPELPQAQSRVERMLKLEEERFN 358

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           +TLD+GL +L+  + +L   +++ G+  F+LYDT G P+D+  DI   RGL  +D+  F 
Sbjct: 359 ETLDQGLKILEQDIENLS-GQVIPGETVFRLYDTFGFPVDLTADIARERGLT-LDMRGFE 416

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+ +QR RARA S        +       +    T+FIGY+ LRG              
Sbjct: 417 HAMAKQRERARAASRFKIEYGPD------LQLDLETEFIGYEHLRG-------------- 456

Query: 480 PPIDLTNGVSSIVKAIVQ---QGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIG 536
                       V A+ +     E VE+  +G+K  VV D+TPFYAEAGGQ+GD G    
Sbjct: 457 ---------EGQVTALFRVAETTEAVEQLSAGEKGIVVLDRTPFYAEAGGQVGDQGTLRA 507

Query: 537 DGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHA 596
            G    +TD QK+    + H   V  G LR    +   ++  +R    +NHSATHLLH +
Sbjct: 508 PGGLFNVTDTQKQGA-AYAHLGEVRLGELRVGDLIQAEVERAHRAPTRLNHSATHLLHAS 566

Query: 597 LSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNR 656
           L  +LG HV+Q GS +T D LRFD +H + +   +L+ IE  VN  I  +LPV T+IM  
Sbjct: 567 LRQVLGEHVAQKGSLVTADRLRFDFSHFEALEPEQLRQIERLVNAQIRADLPVETQIMPL 626

Query: 657 EDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSI 716
           ++A+ +G  AL G KY ++VRV+ +     G  S  LCGGTHV  TG I L  I++E+ I
Sbjct: 627 QEALDAGVVALFGEKYGEQVRVLRM-----GNFSVELCGGTHVDRTGNIGLFKIINETGI 681

Query: 717 RAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAK 776
            AGIRRIEA+TG+ A   +   + +L+++A  LK S+ +V+ ++E + ++ R+ +     
Sbjct: 682 AAGIRRIEAVTGEAALRWVEENEARLEAVAGLLKASRESVIDKLELLQQQARQQEKEIQS 741

Query: 777 RKLQLNVE-----DLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGIS 831
            K +L             +I  V  ++  I  VD K L++  D L+ K+ +  I+L G  
Sbjct: 742 LKARLASAGGSDLSAQAQEIQGVKVLAARIDGVDIKTLRNTADQLKSKLATAAIVL-GTV 800

Query: 832 KEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAG 891
            E K  ++  VT++ +++  A DL    A+ + GG GGGRP MAQ+GG + +K D A+  
Sbjct: 801 VEGKVVLIAGVTKNAINQIKAGDLVNFVAEQV-GGRGGGRPDMAQAGGKDPDKLDAALKS 859

Query: 892 VASFLK 897
           V  +++
Sbjct: 860 VPEWVE 865


>gi|323935749|gb|EGB32063.1| alanyl-tRNA synthetase [Escherichia coli E1520]
          Length = 876

 Score =  918 bits (2373), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 559/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYSSDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNTQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +  E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVV-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|33592894|ref|NP_880538.1| alanyl-tRNA synthetase [Bordetella pertussis Tohama I]
 gi|41018186|sp|Q7VXE1|SYA_BORPE RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|33572542|emb|CAE42122.1| alanyl-tRNA synthetase [Bordetella pertussis Tohama I]
          Length = 874

 Score =  918 bits (2373), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/911 (43%), Positives = 545/911 (59%), Gaps = 53/911 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              S IR  FL+FFQ  GH ++PSSSL+P NDPTL+FTNSGMV FK++FTG+E   Y+  
Sbjct: 1   MKSSEIRQKFLQFFQSKGHTIVPSSSLVPANDPTLLFTNSGMVQFKDVFTGKEARAYKRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT+ + L 
Sbjct: 61  TSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIQYAWELLTQVYKLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY ED+EA+ +W K  G+ A++IIRI  N       DNFW MA+TGPCGPCSE
Sbjct: 121 AEKLWVTVYQEDDEAYDIWAKEVGVPAERIIRIGDNKGARYASDNFWQMADTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  I GG PGS  E+G+RYIEIWNLVFMQFE+        LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPEIWGGPPGSPEEDGDRYIEIWNLVFMQFERDAAGNMERLPKPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI A+ + TG+K   +N  + +VI DH+R+ +FLI DGI+P+
Sbjct: 241 AAVLQHVHSNYEIDLFQKLIAAAARETGVKDLADN--SLKVIADHIRACAFLIVDGIIPS 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG T+     L+P L  EMG AYPEL Q    + + LR 
Sbjct: 299 NEGRGYVLRRIVRRALRHGYKLGQTKSFFHRLVPDLVAEMGEAYPELAQVAERVAQVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGI 413
           E+ERFG+TL+ G+ +LDG L+ + K + L+G   F LYDT+G P+D+  DI   R    +
Sbjct: 359 EEERFGETLEHGMKILDGALAKVAKGDPLDGTTLFTLYDTYGFPVDLTADICRER-EVEV 417

Query: 414 DIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDR 473
           D+  F  A++ QR +ARA      +         L  +   T+F GY+ L  S       
Sbjct: 418 DMAGFEAAMQRQREQARAAGKFKMAEG-------LSYEGAETRFEGYENLELSGV----- 465

Query: 474 KVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGC 533
                             V A+  +G  VE+  +GQ   VV D TPFYAE+GGQ+GDTG 
Sbjct: 466 -----------------KVTALYVEGTQVEQVSAGQDAVVVLDATPFYAESGGQVGDTGL 508

Query: 534 AIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLL 593
               G+R  + D  K   G+F HH  +E G L+   +L+  +D   R +   NHSATHL+
Sbjct: 509 LEAGGVRFAVADTLKIQPGVFGHHGTLEAGALKVGDTLLARVDAVRRARTVRNHSATHLM 568

Query: 594 HHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRI 653
           H AL  +LG+HV Q GS + PD  RFD  H  P+T+ ++  +E  VN  +  N     ++
Sbjct: 569 HKALREVLGAHVQQRGSLVDPDKTRFDFAHDAPMTAEQIARVEAIVNAEVLANQATEAKV 628

Query: 654 MNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSE 713
           M  +DA+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  +VSE
Sbjct: 629 MAYDDAVKGGAMALFGEKYGDTVRVLDIG------FSRELCGGTHVRRTGDIGLFKVVSE 682

Query: 714 SSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLI 773
             + AG+RRIEAITG  A + +  Q+  L+  A  L+     +  R+ ++ E+ + L+  
Sbjct: 683 GGVAAGVRRIEAITGDNALAWVQDQNALLQRAAGVLRAPAHELPERIAQVQEQLKALEKE 742

Query: 774 HAKRKLQLNVE------DLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
             + + +L           +  ++  +  ++  I +VD K L+ ++D L+ +++  +++L
Sbjct: 743 LEQARTKLAASAGNDLVATATVEVKGIKVLAASIGDVDPKALRGMVDNLKDRLKPAVVLL 802

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQ 887
              S + K S++  VT DL  R  A DL    A  +GG G GGRP MA  GG +      
Sbjct: 803 AAGSADGKISLVGGVTADLTGRIKAGDLVGFVAGQVGGKG-GGRPDMAMGGGTDLAALPA 861

Query: 888 AIAGVASFLKK 898
           A+A V  ++ +
Sbjct: 862 AVASVQKWVDE 872


>gi|293415946|ref|ZP_06658586.1| alanyl-tRNA synthetase [Escherichia coli B185]
 gi|331684309|ref|ZP_08384901.1| alanine--tRNA ligase [Escherichia coli H299]
 gi|291432135|gb|EFF05117.1| alanyl-tRNA synthetase [Escherichia coli B185]
 gi|331077924|gb|EGI49130.1| alanine--tRNA ligase [Escherichia coli H299]
          Length = 876

 Score =  918 bits (2373), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFVVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|157162143|ref|YP_001459461.1| alanyl-tRNA synthetase [Escherichia coli HS]
 gi|218690819|ref|YP_002399031.1| alanyl-tRNA synthetase [Escherichia coli ED1a]
 gi|227888232|ref|ZP_04006037.1| alanyl-tRNA synthetase [Escherichia coli 83972]
 gi|331658802|ref|ZP_08359744.1| alanine--tRNA ligase [Escherichia coli TA206]
 gi|205830083|sp|A8A3H4|SYA_ECOHS RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|157067823|gb|ABV07078.1| alanyl-tRNA synthetase [Escherichia coli HS]
 gi|218428383|emb|CAR09311.2| alanyl-tRNA synthetase [Escherichia coli ED1a]
 gi|227834501|gb|EEJ44967.1| alanyl-tRNA synthetase [Escherichia coli 83972]
 gi|307554671|gb|ADN47446.1| alanyl-tRNA synthetase [Escherichia coli ABU 83972]
 gi|331053384|gb|EGI25413.1| alanine--tRNA ligase [Escherichia coli TA206]
          Length = 876

 Score =  918 bits (2373), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|294852536|ref|ZP_06793209.1| alanyl-tRNA synthetase [Brucella sp. NVSL 07-0026]
 gi|294821125|gb|EFG38124.1| alanyl-tRNA synthetase [Brucella sp. NVSL 07-0026]
          Length = 885

 Score =  918 bits (2373), Expect = 0.0,   Method: Composition-based stats.
 Identities = 475/893 (53%), Positives = 623/893 (69%), Gaps = 36/893 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M+ V+ IR+TFL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG E   Y  
Sbjct: 1   MAGVNEIRSTFLDYFRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRSYNR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE AI  AW+L+T+EF L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEDAISFAWNLITREFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + +L +TVY  D++A   WKKI+GLS D+IIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 121 PKDKLLVTVYHTDDDAANFWKKIAGLSDDRIIRIPTSDNFWAMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R+IEIWNLVFMQFEQQ  + R  LP+ SIDTGMGLER+A VLQ 
Sbjct: 181 DHIWGGPPGSPEEDGDRFIEIWNLVFMQFEQQTPELRIDLPRPSIDTGMGLERIAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NYDIDLFK LI+ASE+ TG+K EG+   +HRVI DHLR+SSFLIADG+LP+NEGRGY
Sbjct: 241 VHDNYDIDLFKALIRASEEATGVKAEGDFRASHRVIADHLRASSFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  LLPAL  EMG AYPELI+A+ LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAKEPLMWRLLPALIREMGLAYPELIRAESLISETLKLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL     +L + + L+G+ AFKLYDT+G PLD+ QD L  RG   +D   FN
Sbjct: 361 KTLERGLGLLSDASENLAEGDRLDGETAFKLYDTYGFPLDLTQDALRQRG-IAVDTEGFN 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E Q++ ARA+  G G   TE IWF +K+K GAT+F+GY+                  
Sbjct: 420 VAMERQKAEARANWTGSGEAATETIWFGIKDKVGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     ++ ++V+ G  V     G+ + VV +QTPFY E+GGQ GDTG   G+G 
Sbjct: 462 -----TESAEGVIASLVRDGVEVPSVREGETISVVANQTPFYGESGGQQGDTGTISGEGF 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
            + + D QKK EG+FVH   V  G  +    + L +D   R ++  NHSATHLLH AL  
Sbjct: 517 VIAVKDTQKKGEGVFVHIGEVTEGTAKAGDVVELKVDSARRTRIRSNHSATHLLHEALRE 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
            LG+HV+Q GS + PD LRFD +H KPI++ EL+++E+  N+II QN PV TR+M  +DA
Sbjct: 577 TLGTHVAQKGSLVAPDRLRFDFSHPKPISAEELEAVENLANEIILQNAPVTTRLMAVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSV-----EYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+       + G  +S  LCGGTHV  TG+I L+ I+SE 
Sbjct: 637 IAEGAMALFGEKYGDEVRVVSMGTAKHGSKAGKAYSVELCGGTHVRQTGDIGLVRIISEG 696

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
            + AG+RR+EA+TG+ AR +L  QDE++K++AS LK +  +V+ RV  + +E +KL+   
Sbjct: 697 GVAAGVRRLEALTGEAARLYLEEQDERVKAIASALKTTSADVLDRVNALIDERKKLEREL 756

Query: 775 AKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
           A  + +L +         +   +  VNF+  I++ V  ++LK + D  +K++ SG+++ +
Sbjct: 757 ADARKKLALGGGSSDGGSAVEAVNGVNFLGKIVTGVSPRDLKPLADEGKKQVGSGVVLFI 816

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPN 881
           G+ ++ KAS +  VTED++ RF+AVDL R ++  LGG GGGGRP MAQ+GGP+
Sbjct: 817 GVGEDGKASAVAAVTEDMVGRFSAVDLVRAASAALGGAGGGGRPDMAQAGGPD 869


>gi|110642817|ref|YP_670547.1| alanyl-tRNA synthetase [Escherichia coli 536]
 gi|123147797|sp|Q0TEI3|SYA_ECOL5 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|110344409|gb|ABG70646.1| alanyl-tRNA synthetase [Escherichia coli 536]
          Length = 876

 Score =  918 bits (2373), Expect = 0.0,   Method: Composition-based stats.
 Identities = 397/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    E+L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSERLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|16130604|ref|NP_417177.1| alanyl-tRNA synthetase [Escherichia coli str. K-12 substr. MG1655]
 gi|89109484|ref|AP_003264.1| alanyl-tRNA synthetase [Escherichia coli str. K-12 substr. W3110]
 gi|170082274|ref|YP_001731594.1| alanyl-tRNA synthetase [Escherichia coli str. K-12 substr. DH10B]
 gi|188492036|ref|ZP_02999306.1| alanyl-tRNA synthetase [Escherichia coli 53638]
 gi|194439000|ref|ZP_03071084.1| alanyl-tRNA synthetase [Escherichia coli 101-1]
 gi|238901834|ref|YP_002927630.1| alanyl-tRNA synthetase [Escherichia coli BW2952]
 gi|254037736|ref|ZP_04871794.1| alanyl t-RNA synthetase [Escherichia sp. 1_1_43]
 gi|256024797|ref|ZP_05438662.1| alanyl-tRNA synthetase [Escherichia sp. 4_1_40B]
 gi|307139383|ref|ZP_07498739.1| alanyl-tRNA synthetase [Escherichia coli H736]
 gi|331643380|ref|ZP_08344511.1| alanine--tRNA ligase [Escherichia coli H736]
 gi|2507425|sp|P00957|SYA_ECOLI RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|205830082|sp|B1XCM5|SYA_ECODH RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|1789048|gb|AAC75739.1| alanyl-tRNA synthetase [Escherichia coli str. K-12 substr. MG1655]
 gi|1800083|dbj|BAA16559.1| alanyl-tRNA synthetase [Escherichia coli str. K12 substr. W3110]
 gi|169890109|gb|ACB03816.1| alanyl-tRNA synthetase [Escherichia coli str. K-12 substr. DH10B]
 gi|188487235|gb|EDU62338.1| alanyl-tRNA synthetase [Escherichia coli 53638]
 gi|194422121|gb|EDX38124.1| alanyl-tRNA synthetase [Escherichia coli 101-1]
 gi|226839360|gb|EEH71381.1| alanyl t-RNA synthetase [Escherichia sp. 1_1_43]
 gi|238859951|gb|ACR61949.1| alanyl-tRNA synthetase [Escherichia coli BW2952]
 gi|260448253|gb|ACX38675.1| alanyl-tRNA synthetase [Escherichia coli DH1]
 gi|309703056|emb|CBJ02388.1| alanyl-tRNA synthetase [Escherichia coli ETEC H10407]
 gi|315137304|dbj|BAJ44463.1| alanyl-tRNA synthetase [Escherichia coli DH1]
 gi|323941473|gb|EGB37656.1| alanyl-tRNA synthetase [Escherichia coli E482]
 gi|323960644|gb|EGB56270.1| alanyl-tRNA synthetase [Escherichia coli H489]
 gi|323971514|gb|EGB66748.1| alanyl-tRNA synthetase [Escherichia coli TA007]
 gi|331036851|gb|EGI09075.1| alanine--tRNA ligase [Escherichia coli H736]
          Length = 876

 Score =  918 bits (2373), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 559/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNTQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +  E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVV-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|218547790|ref|YP_002381581.1| alanyl-tRNA synthetase [Escherichia fergusonii ATCC 35469]
 gi|218355331|emb|CAQ87938.1| alanyl-tRNA synthetase [Escherichia fergusonii ATCC 35469]
          Length = 876

 Score =  918 bits (2373), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRKVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|323966841|gb|EGB62270.1| alanyl-tRNA synthetase [Escherichia coli M863]
          Length = 876

 Score =  918 bits (2373), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGVNFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|218706191|ref|YP_002413710.1| alanyl-tRNA synthetase [Escherichia coli UMN026]
 gi|293406188|ref|ZP_06650114.1| alaS [Escherichia coli FVEC1412]
 gi|298381926|ref|ZP_06991523.1| alanyl-tRNA synthetase [Escherichia coli FVEC1302]
 gi|331664248|ref|ZP_08365154.1| alanine--tRNA ligase [Escherichia coli TA143]
 gi|218433288|emb|CAR14188.1| alanyl-tRNA synthetase [Escherichia coli UMN026]
 gi|284922633|emb|CBG35721.1| alanyl-tRNA synthetase [Escherichia coli 042]
 gi|291426194|gb|EFE99226.1| alaS [Escherichia coli FVEC1412]
 gi|298277066|gb|EFI18582.1| alanyl-tRNA synthetase [Escherichia coli FVEC1302]
 gi|331058179|gb|EGI30160.1| alanine--tRNA ligase [Escherichia coli TA143]
          Length = 876

 Score =  918 bits (2373), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 559/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGTNFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +  E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVV-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|145300678|ref|YP_001143519.1| alanyl-tRNA synthetase [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|205829973|sp|A4SS99|SYA_AERS4 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|142853450|gb|ABO91771.1| alanyl-tRNA synthetase [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 874

 Score =  918 bits (2373), Expect = 0.0,   Method: Composition-based stats.
 Identities = 373/910 (40%), Positives = 548/910 (60%), Gaps = 53/910 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + S IR  FLE+F+  GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   MSTSEIRAAFLEYFRSQGHQVVSSSSLVPHNDPTLLFTNAGMNQFKDVFLGADKRAYNRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI+ AW+ LT    L 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAIRFAWEFLTGTLKLP 122

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + RL +TVY+ D+EAF +W    G+  ++I+RI  N       DNFW M++TGPCGPC+E
Sbjct: 123 KERLLVTVYETDDEAFNIWANEVGVPVERIVRIGDNKGAAFASDNFWQMSDTGPCGPCTE 182

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G+ I GG PGS  E+G+R+IEIWN+VFMQF +Q       LP+ S+DTGMGLER+
Sbjct: 183 IFYDHGDHIWGGPPGSPEEDGDRFIEIWNVVFMQFNRQADGTMEPLPRPSVDTGMGLERI 242

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           + ++Q   +NY+ID+F+ LI+ + ++ G      +  + RVI DH+RS +FLIADG++P+
Sbjct: 243 SAIMQGVHSNYEIDIFQALIKKAAEIVGTTD--LSNQSLRVIADHIRSCAFLIADGVMPS 300

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ + R LG T+     L   L  +M     ELI    L++  LR 
Sbjct: 301 NEGRGYVLRRIIRRAVRHGRKLGATDVFFYKLAAELAVQMKDVGAELIAQLPLVKRVLRI 360

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGI 413
           E+E+F +TLDRGL+LL+ VL++LG  +++ G+V FKLYDT+G P D+  D++  R   GI
Sbjct: 361 EEEQFVRTLDRGLLLLEDVLANLGDAKVIPGEVVFKLYDTYGFPADLTADVVRER-EIGI 419

Query: 414 DIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDR 473
           D   FN  +E+QR+RA+  S    +      +  + +    T F GY  L          
Sbjct: 420 DEEGFNAEMEKQRARAKEASSFGVN------YNEVLKLDFETPFTGYKQLSQKTS----- 468

Query: 474 KVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGC 533
                             V  I + G  V   ++G++  VV  +TPFYAE+GGQ+GD G 
Sbjct: 469 ------------------VVGIYKDGVEVNGLIAGEEAVVVLAETPFYAESGGQVGDCGV 510

Query: 534 AIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLL 593
              D     +TD QK  + I      +E G L     +   +D + R+ +++NHS THLL
Sbjct: 511 LKVDDGIFAVTDTQKAGKAIIHK-GYLELGTLEKGALVEAVVDGERRQAVALNHSVTHLL 569

Query: 594 HHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRI 653
           H AL   LG HV+Q GS +  + +RFD +H + +T A ++ +E+ VN  I  N  + T++
Sbjct: 570 HAALRQALGDHVTQKGSLVGAERMRFDFSHFEGLTMATIRRVEELVNAQIRANHDIATQV 629

Query: 654 MNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSE 713
           M+ E A ++GA AL G KY D VRVV +     G +S+ LCGGTH   TG+I    I++E
Sbjct: 630 MDLEAAKSAGAMALFGEKYEDDVRVVRM-----GDYSTELCGGTHAKRTGDIGFFKIIAE 684

Query: 714 SSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLI 773
           S I AG+RRIEA+TG+ A   +    E+++  A+ +K  Q ++  +V +I ++ + ++  
Sbjct: 685 SGIAAGVRRIEAVTGKGAIDFMHQMGEQIEEAAALVKGDQFSIADKVRQILDKSKMMERE 744

Query: 774 HAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
             + K +L  +  S       +I     +   +   D K L+ ++D L+ +++SG+++L 
Sbjct: 745 LEQLKAKLAAQAGSDLLSQVIEINGQKVLIAALEGADPKSLRGMLDELKNRMKSGVVLLA 804

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQA 888
             S + K +++  VT DL  +  A +L  L A+ + GG GGGRP MAQ+GG        A
Sbjct: 805 -TSSDDKVNLIAGVTSDLTGKVKAGELVNLVAQQV-GGKGGGRPDMAQAGGTQPEAVPAA 862

Query: 889 IAGVASFLKK 898
           +  V S+L++
Sbjct: 863 LQSVHSWLEE 872


>gi|215488016|ref|YP_002330447.1| alanyl-tRNA synthetase [Escherichia coli O127:H6 str. E2348/69]
 gi|215266088|emb|CAS10508.1| alanyl-tRNA synthetase [Escherichia coli O127:H6 str. E2348/69]
          Length = 876

 Score =  918 bits (2372), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLNEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|91212055|ref|YP_542041.1| alanyl-tRNA synthetase [Escherichia coli UTI89]
 gi|117624928|ref|YP_853916.1| alanyl-tRNA synthetase [Escherichia coli APEC O1]
 gi|218559685|ref|YP_002392598.1| alanyl-tRNA synthetase [Escherichia coli S88]
 gi|237706683|ref|ZP_04537164.1| alanyl-tRNA synthetase [Escherichia sp. 3_2_53FAA]
 gi|122422735|sp|Q1R804|SYA_ECOUT RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|205830084|sp|A1AEN7|SYA_ECOK1 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|91073629|gb|ABE08510.1| alanyl-tRNA synthetase [Escherichia coli UTI89]
 gi|115514052|gb|ABJ02127.1| alanyl-tRNA synthetase [Escherichia coli APEC O1]
 gi|218366454|emb|CAR04206.1| alanyl-tRNA synthetase [Escherichia coli S88]
 gi|226899723|gb|EEH85982.1| alanyl-tRNA synthetase [Escherichia sp. 3_2_53FAA]
 gi|294489971|gb|ADE88727.1| penicillin-binding protein 7 [Escherichia coli IHE3034]
 gi|307625735|gb|ADN70039.1| alanyl-tRNA synthetase [Escherichia coli UM146]
 gi|323951085|gb|EGB46961.1| alanyl-tRNA synthetase [Escherichia coli H252]
 gi|323957093|gb|EGB52818.1| alanyl-tRNA synthetase [Escherichia coli H263]
          Length = 876

 Score =  918 bits (2372), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 561/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNESRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F+ A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFDAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|330432525|gb|AEC17584.1| alanyl-tRNA synthetase [Gallibacterium anatis UMN179]
          Length = 874

 Score =  918 bits (2372), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/902 (42%), Positives = 545/902 (60%), Gaps = 56/902 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR ++L+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y  
Sbjct: 1   MKTTAEIRQSYLDFFHSKGHQIVASSSLVPENDPTLLFTNAGMNQFKDVFLGIDKRSYHR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+ LT  +  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIHFAWEFLTSPQWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +L++TVY+ DEEA+ +W +  G+ AD+I+RI  N       DNFW M +TGPCGP
Sbjct: 121 GLPKEKLWVTVYETDEEAYNIWHQQIGVPADRIVRIGDNKGAPYASDNFWQMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D G+ I GG PGS+ E+G+RYIEIWN+VFMQ+ +        LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGDHIWGGPPGSAEEDGDRYIEIWNIVFMQYNRLADGTMEKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ER++ VLQ   +NYDID+FK LI    ++TG K   N   + RVI DH+RS ++LIADG+
Sbjct: 241 ERISAVLQHVNSNYDIDIFKVLIAKVAEITGEKDLANK--SLRVIADHIRSCAYLIADGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
            P+NEGRGYVLRRI+RRA+ +  LLG  +     L+P L   M  A   L + ++ IE+ 
Sbjct: 299 YPSNEGRGYVLRRIIRRAVRHGHLLGAKDTFFYKLVPTLIEVMAQAGEILKEKQVHIEKL 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           LR E+E+F +TL+RGL LLD  L+ L    +L+G+VAFKLYDT+G PLD+  D+   R  
Sbjct: 359 LRLEEEQFARTLERGLALLDAELASLK-GNVLSGEVAFKLYDTYGFPLDLTADVCRERD- 416

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID   FN+ +E QR RA+A S           + +L    G T F GY          
Sbjct: 417 IAIDEDGFNREMEAQRERAQAASQFGM------DYNNLIRVDGTTAFEGYHAAESL---- 466

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + V AI   G+ V +  +GQ   ++ + TPFYAE+GGQ+GD
Sbjct: 467 -------------------AKVSAIFVDGKEVNQVQAGQSAVIILENTPFYAESGGQVGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G          + D QK    +F H   +++G ++   +L   +D + R+  S+NHSAT
Sbjct: 508 SGILESADALFTVNDTQKYG-QVFGHIGELKKGEIKVGQTLHAVVDAERRQATSLNHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG+HV+Q GS ++   LRFD +  + I+ A++  IE  VN  I  N  V 
Sbjct: 567 HLLHAALRQVLGTHVAQKGSLVSDKLLRFDFSQPEAISKAQIAEIERIVNSQIRANHVVS 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
              M+ E A A GA AL G KY DRVRV+++     G  S  LCGG HV  TG+I L  I
Sbjct: 627 VEEMDIEAAKAKGAMALFGEKYGDRVRVITM-----GDFSIELCGGIHVKRTGDIGLFKI 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           VSES+I AG RRIEA+TG+ A + ++ Q   L   A  LK    ++V +++++ +  +KL
Sbjct: 682 VSESAIAAGTRRIEAVTGEEAFNVVLAQQSLLTQSAELLKSDLPSIVEKIQQLQDRAKKL 741

Query: 771 QLIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +    + K +  V+ +S        I  V  +   ++ VD K L+ ++D L+ ++ + +I
Sbjct: 742 EKELQQLKEKSAVQAVSDLAQKAQTINGVKVVIESVTGVDPKSLRIMVDDLKNQLGTAVI 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +  G ++++K ++++ VT+DL  +  A +L    A+++ GG GGGRP MA +GG    K 
Sbjct: 802 V-FGATQDEKVNLIVGVTQDLTGKVKAGELVNQLAQLV-GGKGGGRPDMAMAGGNEPAKL 859

Query: 886 DQ 887
           ++
Sbjct: 860 NE 861


>gi|331674208|ref|ZP_08374968.1| alanine--tRNA ligase [Escherichia coli TA280]
 gi|222034390|emb|CAP77132.1| alanyl-tRNA synthetase [Escherichia coli LF82]
 gi|312947225|gb|ADR28052.1| alanyl-tRNA synthetase [Escherichia coli O83:H1 str. NRG 857C]
 gi|331068302|gb|EGI39697.1| alanine--tRNA ligase [Escherichia coli TA280]
          Length = 876

 Score =  918 bits (2372), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 559/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +  E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVV-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|148560301|ref|YP_001259121.1| alanyl-tRNA synthetase [Brucella ovis ATCC 25840]
 gi|205829997|sp|A5VQX4|SYA_BRUO2 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|148371558|gb|ABQ61537.1| alanyl-tRNA synthetase [Brucella ovis ATCC 25840]
          Length = 885

 Score =  918 bits (2372), Expect = 0.0,   Method: Composition-based stats.
 Identities = 475/893 (53%), Positives = 623/893 (69%), Gaps = 36/893 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M+ V+ IR+TFL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG E   Y  
Sbjct: 1   MAGVNEIRSTFLDYFRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRSYNR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE AI  AW+L+T+EF L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEDAISFAWNLITREFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + +L +TVY  D++A   WKKI+GLS D+IIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 121 PKDKLLVTVYHTDDDAANFWKKIAGLSDDRIIRIPTSDNFWAMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R+IEIWNLVFMQFEQQ  + R  LP+ SIDTGMGLER+A VLQ 
Sbjct: 181 DHIWGGPPGSPEEDGDRFIEIWNLVFMQFEQQTPELRIDLPRPSIDTGMGLERIAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NYDIDLFK LI+ASE+ TG+K EG+   +HRVI DHLR+SSFLIADG+LP+NEGRGY
Sbjct: 241 VHDNYDIDLFKALIRASEEATGVKAEGDFRASHRVIADHLRASSFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  LLPAL  EMG AYPELI+A+ LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAKEPLMWRLLPALIREMGQAYPELIRAESLISETLKLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL     +L + + L+G+ AFKLYDT+G PLD+ QD L  RG   +D   FN
Sbjct: 361 KTLERGLGLLSDASENLAEGDRLDGETAFKLYDTYGFPLDLTQDALRQRG-IAVDTEGFN 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E Q++ ARA+  G G   TE IWF +K+K GAT+F+GY+                  
Sbjct: 420 VAMERQKAEARANWTGSGEAATETIWFGIKDKVGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     ++ ++V+ G  V     G+ + VV +QTPFY E+GGQ GDTG   G+G 
Sbjct: 462 -----TESAEGVIASLVRDGVEVPSVREGETISVVVNQTPFYGESGGQQGDTGTISGEGF 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
            + + D QKK EG+FVH   V  G  +    + L +D   R ++  NHSATHLLH AL  
Sbjct: 517 VIAVKDTQKKGEGVFVHIGEVTEGTAKAGDVVELKVDSARRTRIRSNHSATHLLHEALRE 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
            LG+HV+Q GS + PD LRFD +H KPI++ EL+++E+  N+II QN PV TR+M  +DA
Sbjct: 577 TLGTHVAQKGSLVAPDRLRFDFSHPKPISAEELEAVENLANEIILQNAPVTTRLMAVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSV-----EYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+       + G  +S  LCGGTHV  TG+I L+ I+SE 
Sbjct: 637 IAEGAMALFGEKYGDEVRVVSMGTAKHGSKAGKAYSVELCGGTHVRQTGDIGLVRIISEG 696

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
            + AG+RR+EA+TG+ AR +L  QDE++K++AS LK +  +V+  V  + +E +KL+   
Sbjct: 697 GVAAGVRRLEALTGEAARLYLEEQDERVKAIASALKTTSADVLDHVNALIDERKKLEREL 756

Query: 775 AKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
           A  + +L +       D +   +  VNF+  I++ V  ++LK + D  +K++ SG+++ +
Sbjct: 757 ADARKKLALGGGSSDGDSAVEAVNGVNFLGKIVTGVSPRDLKPLADEGKKQVGSGVVLFI 816

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPN 881
           G+ ++ KAS +  VTED++ RF+AVDL R ++  LGG GGGGRP MAQ+GGP+
Sbjct: 817 GVGEDGKASAVAAVTEDMVGRFSAVDLVRAASAALGGAGGGGRPDMAQAGGPD 869


>gi|170019057|ref|YP_001724011.1| alanyl-tRNA synthetase [Escherichia coli ATCC 8739]
 gi|205830085|sp|B1IUY2|SYA_ECOLC RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|169753985|gb|ACA76684.1| alanyl-tRNA synthetase [Escherichia coli ATCC 8739]
          Length = 876

 Score =  918 bits (2372), Expect = 0.0,   Method: Composition-based stats.
 Identities = 397/910 (43%), Positives = 559/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           PANE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PANENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNTQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +  E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVV-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|30064057|ref|NP_838228.1| alanyl-tRNA synthetase [Shigella flexneri 2a str. 2457T]
 gi|56480163|ref|NP_708505.2| alanyl-tRNA synthetase [Shigella flexneri 2a str. 301]
 gi|110806677|ref|YP_690197.1| alanyl-tRNA synthetase [Shigella flexneri 5 str. 8401]
 gi|44888327|sp|Q7UBU3|SYA_SHIFL RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|123146773|sp|Q0T1C3|SYA_SHIF8 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|30042313|gb|AAP18038.1| alanyl-tRNA synthetase [Shigella flexneri 2a str. 2457T]
 gi|56383714|gb|AAN44212.2| alanyl-tRNA synthetase [Shigella flexneri 2a str. 301]
 gi|110616225|gb|ABF04892.1| alanyl-tRNA synthetase [Shigella flexneri 5 str. 8401]
 gi|281602067|gb|ADA75051.1| Alanyl-tRNA synthetase [Shigella flexneri 2002017]
          Length = 876

 Score =  918 bits (2372), Expect = 0.0,   Method: Composition-based stats.
 Identities = 398/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   ID   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADIDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IMN E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMNLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAITTVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|293412052|ref|ZP_06654775.1| alanyl-tRNA synthetase [Escherichia coli B354]
 gi|291468823|gb|EFF11314.1| alanyl-tRNA synthetase [Escherichia coli B354]
          Length = 876

 Score =  918 bits (2372), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 559/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLNEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +  E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVV-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|213968623|ref|ZP_03396765.1| alanyl-tRNA synthetase [Pseudomonas syringae pv. tomato T1]
 gi|301385518|ref|ZP_07233936.1| alanyl-tRNA synthetase [Pseudomonas syringae pv. tomato Max13]
 gi|213926556|gb|EEB60109.1| alanyl-tRNA synthetase [Pseudomonas syringae pv. tomato T1]
          Length = 874

 Score =  917 bits (2371), Expect = 0.0,   Method: Composition-based stats.
 Identities = 388/912 (42%), Positives = 536/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL FF++ GH  +PSSSLIP NDPTL+FTN+GM  FK+ F GQEK  Y   
Sbjct: 1   MKSAEIREAFLGFFEEQGHTRVPSSSLIPGNDPTLLFTNAGMNQFKDCFLGQEKRAYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
            T QKCVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW  LT  K  +
Sbjct: 61  VTSQKCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAITYAWTFLTSEKWLN 120

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY  D+EA+ +W K  G+ A++++RI  N       DNFW+M +TGPCGPC
Sbjct: 121 LPKEKLWVTVYATDDEAYDIWTKEIGVPAERMVRIGDNKGAPYASDNFWTMGDTGPCGPC 180

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           SEIFFD G  I GG PGS  E+G+RYIEIWN VFMQF +        LP  S+DTGMGLE
Sbjct: 181 SEIFFDHGADIWGGPPGSPEEDGDRYIEIWNNVFMQFNRTADGVLHPLPAPSVDTGMGLE 240

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R++ VLQ   +NY+IDLF+ L+ AS    G     +N  + +V+ DH+RS  FLIADG+L
Sbjct: 241 RVSAVLQHVHSNYEIDLFQSLLTASANAIGCS--NDNQASLKVVADHIRSCGFLIADGVL 298

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P++EGRGYVLRRI+RRA  +   LG        ++ AL  EMGSA+PEL+Q +  IE  L
Sbjct: 299 PSSEGRGYVLRRIIRRACRHGNKLGAKGSFFYQIVAALVAEMGSAFPELVQQQSHIERVL 358

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           R E+E+F KTL++GL +++  L+ L    ++ G++ FKLYDT+G P+D+  DI   R L 
Sbjct: 359 RGEEEQFAKTLEQGLKIIEQDLAELK-GTVVPGEIVFKLYDTYGFPMDLTGDIARERNLT 417

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F + +E QR RAR+ S           + SL +   ATQF GY    G      
Sbjct: 418 -LDEEGFEREMEAQRVRARSASSFGM------DYNSLVKVDVATQFTGYSATTG------ 464

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                            S+ V A+ + G+ V     G++  V+ D TPFYAE+GGQ+GD+
Sbjct: 465 -----------------SASVVALYKDGQSVTHLNEGEEGVVILDTTPFYAESGGQIGDS 507

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G  +    R  ++D  K      +HH +V  G L   + +   +  + R    +NHSATH
Sbjct: 508 GFLLAGDTRFDVSDTTKTGGAS-LHHGVVASGSLSVGVQVETQVADEVRDATKLNHSATH 566

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV Q GS +    LRFD +H + I   +L+++ED VN  I +N PVVT
Sbjct: 567 LLHAALRQVLGEHVQQKGSLVDSQRLRFDFSHFESIKPEQLRALEDIVNAEIRKNTPVVT 626

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
              + + A   GA AL G KY D VRV+S+    GG  S  LCGG H S TG+I L  IV
Sbjct: 627 EETDIDTAKKKGAMALFGEKYGDSVRVLSM----GGEFSVELCGGIHASRTGDISLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SE  + AG+RRIEA+TG  A + L   +++LK  A+ +K ++ N++ ++  + E  R L+
Sbjct: 683 SEGGVAAGVRRIEAVTGAAALAWLNSAEDQLKEAATLVKGNRDNLLDKLTAVLERNRLLE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + + +           +   +  V  ++  +   D K L +++D L+ K+   +I+
Sbjct: 743 KQLEQLQAKAASAAGDDLSSAALDVKGVKVLATRLDGQDGKALLALVDQLKNKLGRAVIL 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +  E K  ++  VT+DL  +  A DL + +A  + GG GGGRP MAQ GG +    D
Sbjct: 803 LGSVH-EDKVVLVAGVTKDLTGQLKAGDLMKQAATAV-GGKGGGRPDMAQGGGVDATALD 860

Query: 887 QAIAGVASFLKK 898
            A+A    F+++
Sbjct: 861 SALALAVPFVEQ 872


>gi|317493956|ref|ZP_07952373.1| alanyl-tRNA synthetase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918283|gb|EFV39625.1| alanyl-tRNA synthetase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 875

 Score =  917 bits (2371), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 567/910 (62%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+F+   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFYHSKGHQIVESSSLVPNNDPTLLFTNAGMNQFKDVFLGIDKRSYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT    F+
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTGENWFN 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY+ D+EAF +W    G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKEKLWVTVYETDDEAFNIWADEVGVPRERIIRIGDNKGAPFASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS+ E+G+RYIEIWN+VFMQF +Q+      LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSAEEDGDRYIEIWNIVFMQFNRQSDGTMLPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LI A+ +VTG      +  + RVI DH+RS +FL++DG+L
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIAATAKVTGATD--LSSKSLRVIADHIRSCAFLVSDGVL 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NEGRGYVLRRI+RRA+ +  ++G  E     L+  L   MG A  EL + + ++E+ L
Sbjct: 301 PSNEGRGYVLRRIIRRAVRHGNMVGAKETFFYKLVAPLIEVMGPAADELKRQQSMVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  LS L   + L+G+ AF+LYDT+G PLD+  D+   R L 
Sbjct: 361 KTEEEQFARTLERGLALLDDELSKLS-GDTLDGETAFRLYDTYGFPLDLTADVCRERNLK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D I F +A+EEQR RAR       S      + S+    GA++F GYD          
Sbjct: 420 -VDEIGFERAMEEQRRRARE------SSGFGADYNSMIRVDGASKFSGYDH--------- 463

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                         N   S V A+ + G+ V+   +G++  VV ++TPFYAE+GGQ+GD 
Sbjct: 464 --------------NQQHSSVTALFRDGQAVDVLNAGEEGVVVLNETPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G     G+   +TD QK       H   V +G ++   S+  TID   R ++ +NHSATH
Sbjct: 510 GELTAQGVSFVVTDTQKYG-QAIGHQGKVAQGSVKVGDSVEATIDEARRSRIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HVSQ GS ++   LRFD +H + +   +++ +ED VN  I +NLP+ T
Sbjct: 569 LLHAALRQVLGDHVSQKGSLVSDRNLRFDFSHFEAMKPEQIRQVEDIVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ EDA A GA AL G KY++ VRV+S+     G  S+ LCGGTH   TG+I L  I 
Sbjct: 629 NIMDLEDAKAKGAMALFGEKYDESVRVLSM-----GDFSTELCGGTHARQTGDIGLFRIT 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SE+   AG+RRIEA+TG+ A + +    + L+  AS +K    +V  ++  + ++ R+L+
Sbjct: 684 SEAGTAAGVRRIEAVTGEGAIAVMHQDADALREAASLVKSDAHSVAEKIRAVMDKTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +  V++K L++++D L+ ++ SG+++
Sbjct: 744 KELQQLKDQQAAQESASLSSKAVDVKGVKLLVSQLDNVEAKMLRTMVDDLKNQLGSGVVV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L   + E K S++  VT+DL D+  A +L  + A+ + GG GGGRP MA +GG +     
Sbjct: 804 LATTA-EGKVSLVAGVTKDLTDKVKAGELIGMVAQQV-GGKGGGRPDMAMAGGSDATALP 861

Query: 887 QAIAGVASFL 896
           QA+AGV +++
Sbjct: 862 QALAGVEAWV 871


>gi|298292138|ref|YP_003694077.1| alanyl-tRNA synthetase [Starkeya novella DSM 506]
 gi|296928649|gb|ADH89458.1| alanyl-tRNA synthetase [Starkeya novella DSM 506]
          Length = 883

 Score =  917 bits (2371), Expect = 0.0,   Method: Composition-based stats.
 Identities = 466/905 (51%), Positives = 618/905 (68%), Gaps = 33/905 (3%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR TFL++F KNGH+++ SS L+P NDPTLMFTN+GMV FKN+FTG EK  Y  
Sbjct: 1   MSGVNEIRATFLDYFAKNGHQVVDSSPLVPRNDPTLMFTNAGMVQFKNVFTGIEKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             T QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE AI+ AW+L+T+EF+L
Sbjct: 61  AATSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKENAIEFAWNLITREFEL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
              +L +TVY ED+EAF LWK+I+GL   KI+RI T+DNFW M +TGPCGPCSEIF+D G
Sbjct: 121 PVEKLMVTVYHEDDEAFSLWKRIAGLPDSKIVRIATSDNFWQMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + IPGG P     +G+R+IEIWNLVFMQFEQ    ER  LP+ SIDTGMGLER++ VLQ 
Sbjct: 181 DHIPGGPPGSPDADGDRFIEIWNLVFMQFEQLPGGERLNLPRPSIDTGMGLERISAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NY+IDL + L  A E++T +  +G    +HRVI DHLR+S+FL+ADG+LP+NEGRGY
Sbjct: 241 THDNYEIDLMRALTGAVEEMTDVPADGPQKASHRVIADHLRASTFLVADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  +PLM  L+P L  EMG A+PE+++A+ L+ ETLR E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGARDPLMHRLVPILVREMGRAFPEIVRAEPLVTETLRLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL +L+     LG     +G+ AFKLYDT+G PLD+ +D L ARG   +D+ SFN
Sbjct: 361 KTLERGLSILETESEGLGAGAKFSGETAFKLYDTYGFPLDLTEDALRARG-VNVDVDSFN 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E QR+ ARA   G G   T+ +WF+++E+ G T+F+GY                   
Sbjct: 420 AAMERQRAEARASWAGSGEAATDTVWFAVREEVGPTEFLGY------------------- 460

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T      V A+V +G+ VE   +G +  VV +QTPFY E+GGQ+GDTG   G+G 
Sbjct: 461 ----GTETAEGTVTALVTEGKRVETLPAGARGLVVLNQTPFYGESGGQVGDTGTMSGEGG 516

Query: 540 -RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALS 598
            +L++T  QKK   IF H   VE G L     L L +D + R+ +  NHSATHLLH AL 
Sbjct: 517 LKLRVTGTQKKLGDIFAHEVEVEEGTLTIGAPLALFVDGERRQAIRANHSATHLLHEALR 576

Query: 599 TILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNRED 658
            +LG HV+Q GS + PD LRFD +H KP+ +AELK++ED  N I+ +N PVVTR+M  +D
Sbjct: 577 RVLGDHVAQKGSLVAPDRLRFDFSHPKPVEAAELKAVEDIANRIVLRNEPVVTRLMAVDD 636

Query: 659 AIASGAAALLGTKYNDRVRVVSVEYEDGG--VHSSALCGGTHVSSTGEIMLLYIVSESSI 716
           AI SGA AL G KY D VRVVS+  + G    +S  LCGGTHV+ TG+I L+ ++ ES++
Sbjct: 637 AIESGARALFGEKYGDEVRVVSMGTDPGNGAPYSVELCGGTHVARTGDIGLVSVLGESAV 696

Query: 717 RAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH-- 774
            AG+RRIEA+TG  AR HL  Q   L+  A  L+   G V  R+ ++ EE RKL+     
Sbjct: 697 GAGVRRIEAMTGDAARHHLNAQSRALQGAADVLRAPVGEVEARIAQLVEERRKLERELGD 756

Query: 775 AKRKLQL---NVEDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGIS 831
           AKRKL +      +     +  V  ++  +S +D K+LKS+ D  +K+I SGI+ +VG++
Sbjct: 757 AKRKLAMGGGAASEEPARTVGAVKLLARQVSGIDLKDLKSLADEGKKRIGSGIVAIVGVT 816

Query: 832 KEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAG 891
           +E +A +++ VT+DL  +++AV L R  A+ LGG GGGGRP MAQ+GGP+G +A +A+A 
Sbjct: 817 EEGRAGLVVGVTDDLTGKYDAVALVRRGAEALGGKGGGGRPDMAQAGGPDGGRAAEALAA 876

Query: 892 VASFL 896
           + + L
Sbjct: 877 IENAL 881


>gi|74313262|ref|YP_311681.1| alanyl-tRNA synthetase [Shigella sonnei Ss046]
 gi|157158305|ref|YP_001464004.1| alanyl-tRNA synthetase [Escherichia coli E24377A]
 gi|191167095|ref|ZP_03028916.1| alanyl-tRNA synthetase [Escherichia coli B7A]
 gi|193065058|ref|ZP_03046133.1| alanyl-tRNA synthetase [Escherichia coli E22]
 gi|193069650|ref|ZP_03050602.1| alanyl-tRNA synthetase [Escherichia coli E110019]
 gi|194427866|ref|ZP_03060412.1| alanyl-tRNA synthetase [Escherichia coli B171]
 gi|209920136|ref|YP_002294220.1| alanyl-tRNA synthetase [Escherichia coli SE11]
 gi|218555239|ref|YP_002388152.1| alanyl-tRNA synthetase [Escherichia coli IAI1]
 gi|218696288|ref|YP_002403955.1| alanyl-tRNA synthetase [Escherichia coli 55989]
 gi|256019527|ref|ZP_05433392.1| alanyl-tRNA synthetase [Shigella sp. D9]
 gi|260845339|ref|YP_003223117.1| alanyl-tRNA synthetase [Escherichia coli O103:H2 str. 12009]
 gi|260856802|ref|YP_003230693.1| alanyl-tRNA synthetase [Escherichia coli O26:H11 str. 11368]
 gi|260869370|ref|YP_003235772.1| alanyl-tRNA synthetase [Escherichia coli O111:H- str. 11128]
 gi|293449010|ref|ZP_06663431.1| alanyl-tRNA synthetase [Escherichia coli B088]
 gi|307314418|ref|ZP_07594023.1| alanyl-tRNA synthetase [Escherichia coli W]
 gi|331669429|ref|ZP_08370275.1| alanine--tRNA ligase [Escherichia coli TA271]
 gi|123616373|sp|Q3YYG6|SYA_SHISS RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|205830081|sp|A7ZQC5|SYA_ECO24 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|73856739|gb|AAZ89446.1| alanyl-tRNA synthetase [Shigella sonnei Ss046]
 gi|157080335|gb|ABV20043.1| alanyl-tRNA synthetase [Escherichia coli E24377A]
 gi|190902877|gb|EDV62605.1| alanyl-tRNA synthetase [Escherichia coli B7A]
 gi|192927355|gb|EDV81974.1| alanyl-tRNA synthetase [Escherichia coli E22]
 gi|192957013|gb|EDV87464.1| alanyl-tRNA synthetase [Escherichia coli E110019]
 gi|194414099|gb|EDX30375.1| alanyl-tRNA synthetase [Escherichia coli B171]
 gi|209913395|dbj|BAG78469.1| alanyl-tRNA synthase [Escherichia coli SE11]
 gi|218353020|emb|CAU98845.1| alanyl-tRNA synthetase [Escherichia coli 55989]
 gi|218362007|emb|CAQ99613.1| alanyl-tRNA synthetase [Escherichia coli IAI1]
 gi|257755451|dbj|BAI26953.1| alanyl-tRNA synthetase [Escherichia coli O26:H11 str. 11368]
 gi|257760486|dbj|BAI31983.1| alanyl-tRNA synthetase [Escherichia coli O103:H2 str. 12009]
 gi|257765726|dbj|BAI37221.1| alanyl-tRNA synthetase [Escherichia coli O111:H- str. 11128]
 gi|291322100|gb|EFE61529.1| alanyl-tRNA synthetase [Escherichia coli B088]
 gi|306905986|gb|EFN36507.1| alanyl-tRNA synthetase [Escherichia coli W]
 gi|315061973|gb|ADT76300.1| alanyl-tRNA synthetase [Escherichia coli W]
 gi|323180115|gb|EFZ65667.1| alanyl-tRNA synthetase [Escherichia coli 1180]
 gi|323377445|gb|ADX49713.1| alanyl-tRNA synthetase [Escherichia coli KO11]
 gi|323946425|gb|EGB42453.1| alanyl-tRNA synthetase [Escherichia coli H120]
 gi|324119946|gb|EGC13824.1| alanyl-tRNA synthetase [Escherichia coli E1167]
 gi|331063097|gb|EGI35010.1| alanine--tRNA ligase [Escherichia coli TA271]
 gi|332103001|gb|EGJ06347.1| alanyl-tRNA synthetase [Shigella sp. D9]
          Length = 876

 Score =  917 bits (2371), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAITTVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|15832808|ref|NP_311581.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. Sakai]
 gi|168749982|ref|ZP_02775004.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4113]
 gi|168755438|ref|ZP_02780445.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4401]
 gi|168762908|ref|ZP_02787915.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4501]
 gi|168768784|ref|ZP_02793791.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4486]
 gi|168774775|ref|ZP_02799782.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4196]
 gi|168778675|ref|ZP_02803682.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4076]
 gi|168800226|ref|ZP_02825233.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC508]
 gi|194433071|ref|ZP_03065354.1| alanyl-tRNA synthetase [Shigella dysenteriae 1012]
 gi|195938445|ref|ZP_03083827.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4024]
 gi|208805868|ref|ZP_03248205.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4206]
 gi|208813761|ref|ZP_03255090.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4045]
 gi|208818286|ref|ZP_03258606.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4042]
 gi|209398791|ref|YP_002272160.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4115]
 gi|217327497|ref|ZP_03443580.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. TW14588]
 gi|254794638|ref|YP_003079475.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. TW14359]
 gi|291284024|ref|YP_003500842.1| Alanyl-tRNA synthetase [Escherichia coli O55:H7 str. CB9615]
 gi|20532246|sp|Q8X3W8|SYA_ECO57 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|13363025|dbj|BAB36977.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. Sakai]
 gi|187769613|gb|EDU33457.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4196]
 gi|188015823|gb|EDU53945.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4113]
 gi|189003197|gb|EDU72183.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4076]
 gi|189357241|gb|EDU75660.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4401]
 gi|189362083|gb|EDU80502.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4486]
 gi|189366853|gb|EDU85269.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4501]
 gi|189377449|gb|EDU95865.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC508]
 gi|194418798|gb|EDX34884.1| alanyl-tRNA synthetase [Shigella dysenteriae 1012]
 gi|208725669|gb|EDZ75270.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4206]
 gi|208735038|gb|EDZ83725.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4045]
 gi|208738409|gb|EDZ86091.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4042]
 gi|209160191|gb|ACI37624.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4115]
 gi|217319864|gb|EEC28289.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. TW14588]
 gi|254594038|gb|ACT73399.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. TW14359]
 gi|290763897|gb|ADD57858.1| Alanyl-tRNA synthetase [Escherichia coli O55:H7 str. CB9615]
 gi|320640339|gb|EFX09878.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. G5101]
 gi|320645886|gb|EFX14867.1| alanyl-tRNA synthetase [Escherichia coli O157:H- str. 493-89]
 gi|320651186|gb|EFX19621.1| alanyl-tRNA synthetase [Escherichia coli O157:H- str. H 2687]
 gi|320656736|gb|EFX24624.1| alanyl-tRNA synthetase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320662279|gb|EFX29676.1| alanyl-tRNA synthetase [Escherichia coli O55:H7 str. USDA 5905]
 gi|320667330|gb|EFX34288.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. LSU-61]
          Length = 876

 Score =  917 bits (2371), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFVVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAITTVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|187734262|ref|YP_001881554.1| alanyl-tRNA synthetase [Shigella boydii CDC 3083-94]
 gi|205830210|sp|B2U049|SYA_SHIB3 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|187431254|gb|ACD10528.1| alanyl-tRNA synthetase [Shigella boydii CDC 3083-94]
          Length = 876

 Score =  917 bits (2371), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 559/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++ +ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRVVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAITTVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|295688603|ref|YP_003592296.1| alanyl-tRNA synthetase [Caulobacter segnis ATCC 21756]
 gi|295430506|gb|ADG09678.1| alanyl-tRNA synthetase [Caulobacter segnis ATCC 21756]
          Length = 880

 Score =  917 bits (2371), Expect = 0.0,   Method: Composition-based stats.
 Identities = 447/904 (49%), Positives = 588/904 (65%), Gaps = 34/904 (3%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M +++ IR+TFL++F K  H ++PS+ L+P NDPTL+F N+GMVPFKN+FTG E P +  
Sbjct: 1   MPSLNEIRSTFLDYFGKADHAVVPSAPLVPQNDPTLLFVNAGMVPFKNVFTGAETPAHPR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             + QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE+AI  AW LLT EF L
Sbjct: 61  AASSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEQAIHHAWTLLTGEFKL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + +L +TVY  D+EA  LWKKI+GLS D+IIRI T+DNFWSM +TGPCGPCSEIF+D G
Sbjct: 121 PKEKLLVTVYHTDDEAADLWKKIAGLSDDRIIRIPTSDNFWSMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
             I GG P    E+G+R+IEIWNLVFMQFEQ    +R  LPK SIDTGMGLER+A VLQ 
Sbjct: 181 PSIAGGPPGSPDEDGDRFIEIWNLVFMQFEQLAGGDRVSLPKPSIDTGMGLERVAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             NNYD+DLFK LI AS ++TG+K EG+   +HRVI DHLRSSSFL+ADG+ P+NEGRGY
Sbjct: 241 VHNNYDVDLFKALIAASVELTGVKAEGDQAPSHRVIADHLRSSSFLLADGVSPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A LLG  EPLM  L P L  EMG AYPEL +A+  I ETLR E+ERF 
Sbjct: 301 VLRRIMRRAMRHAYLLGAQEPLMHRLAPTLVAEMGQAYPELRRAEASIVETLRQEEERFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
            TL RG+ LLD   ++L    +L+G+ AFKLYDT+G PLD+ QD + A+GL  +D   F+
Sbjct: 361 TTLGRGMGLLDEATANLSAGGVLDGETAFKLYDTYGFPLDLTQDAVRAKGLT-VDTDGFD 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+++QR  ARA+  G G       WF++KEK GAT F+GY+                  
Sbjct: 420 AAMQKQREMARANWAGSGQQGAAAAWFAIKEKNGATDFVGYETTE--------------- 464

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                    + +V+AIV  G  V+ A  G  VEV+ D+T FYAE+GGQ GD G    +G 
Sbjct: 465 --------TTGVVQAIVVDGAEVQSATGGTTVEVLLDRTSFYAESGGQAGDQGALEANGR 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
             ++ D QK+A  + VH      G L+    +V+++D   R+    NHSA HL+H AL  
Sbjct: 517 ENRVIDTQKQAGELHVHRV-ELSGELKVGDKVVVSVDADRRQTTRSNHSAAHLVHAALHH 575

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG HV+Q G  +  + +RFD +H  P+T  EL  IE  VN +I QN+P  T+ M  ++A
Sbjct: 576 VLGPHVAQKGQMVDGERMRFDFSHGGPLTPEELDKIEAEVNAVIRQNVPAETKEMAPQEA 635

Query: 660 IASGAAALLGTKYNDRVRVVSVEY---EDGGVHSSALCGGTHVSSTGEIMLLYIVSESSI 716
           I +GA AL G KY D VRV+++     ++   +S  LCGGTHVS TG+I L  IVSE  +
Sbjct: 636 IEAGAVALFGEKYGDSVRVLTLGKSLTDESKAYSVELCGGTHVSRTGDIALFKIVSEQGV 695

Query: 717 RAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAK 776
            AG+RRIEA+TG+ AR  L+ Q    KSLA   K     V  RV+ +  + ++L+   A+
Sbjct: 696 AAGVRRIEALTGEAARRFLLDQAGVAKSLADQFKTPVAEVAQRVDALIADRKRLEKELAE 755

Query: 777 RKLQLNVEDLSC----HKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISK 832
            K QL +           +  V  ++ ++  V  KEL+ V +  +K++ SG++ LVG S 
Sbjct: 756 AKKQLALGGGGAASGPEDVNGVALIARVLDGVGGKELRGVAEEFKKQLTSGVVALVGTS- 814

Query: 833 EKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGV 892
           + KA+V + VT DL  +F+A DLA+ +   +GG G GG+   AQ G P+ +KAD+ +A V
Sbjct: 815 DGKAAVTVAVTADLTGKFSAADLAKAAVIAMGGQGAGGKADFAQGGAPDDSKADEGLAAV 874

Query: 893 ASFL 896
            + L
Sbjct: 875 KAAL 878


>gi|307132211|ref|YP_003884227.1| alanyl-tRNA synthetase [Dickeya dadantii 3937]
 gi|306529740|gb|ADM99670.1| alanyl-tRNA synthetase [Dickeya dadantii 3937]
          Length = 875

 Score =  917 bits (2371), Expect = 0.0,   Method: Composition-based stats.
 Identities = 389/910 (42%), Positives = 539/910 (59%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRNYVRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIIYAWELLTSPQWFG 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY  D+EA+ +W    G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKEKLWVTVYATDDEAYDIWANEVGVPHERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           SEIF+D G+ I GG PGS  E+G+RYIEIWNLVFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 SEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNLVFMQFNRQADGTMLPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R++ VLQ   +NY+IDLFK LI  +  V G      N  + RVI DH+RS +FLIADG++
Sbjct: 243 RISAVLQHVNSNYEIDLFKALIAEAASVVGTDD--LNNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MG A  EL + + L+E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAIRHGNMLGAKETFFYKLVGTLIKVMGPAAEELQRQQGLVEQAL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL+LLD  +  L   + L+G+ AF+LYDT+G P+D+  D+   R L 
Sbjct: 361 KNEEEQFARTLERGLLLLDEEIKQLK-GDTLSGEAAFRLYDTYGFPVDLTADVCRERNLK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F +A+E QR RAR       +      + SL     +T F GY+          
Sbjct: 420 -VDEEGFERAMEAQRQRAR------DASGFGADYNSLIRVDESTTFCGYERTDQ------ 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             S V AI +QGE V+E  +G    V+  +TPFY E+GGQ+GD 
Sbjct: 467 -----------------QSKVVAIYRQGESVQEIQAGDDAVVILSETPFYGESGGQVGDQ 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D QK  +    H   + +G LR    +   +D+  R ++ +NHSATH
Sbjct: 510 GELTSAAARFSVADAQKYGQ-AIGHIGKLTQGSLRVNDKVDAVVDHVRRDRIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV+Q GS +    LRFD +H + +   +++ +ED VN  I +NLPV T
Sbjct: 569 LLHAALRQVLGEHVAQKGSLVNDSYLRFDFSHPEAMKPEQIRQVEDIVNTQIRRNLPVET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            +M  + A A GA AL G KY + VRV+S+     G  S  LCGGTH   TG+I L  IV
Sbjct: 629 DVMALDAARAKGAMALFGEKYEENVRVLSM-----GDFSIELCGGTHARRTGDIGLFRIV 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AGIRRIEA+TG+ A   L  Q++ L  +   +K    N+  +V  + E  R L+
Sbjct: 684 SESGTAAGIRRIEAVTGENAIVALHHQNDLLHEVTQLVKGDSNNLADKVRSLLERTRGLE 743

Query: 772 LIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++ S        I  V  +   +S V+ K L++++D L+ ++ S +I+
Sbjct: 744 KELQQLKEQQAAQESSSLSSKAKDINGVKLLVTQLSNVEPKLLRTMVDDLKNQLGSAVIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L     + K S++  VT++L DR  A +L    A  + GG GGGRP MAQ+GG + +   
Sbjct: 804 L-STVADGKVSLIAGVTKELTDRVKAGELIGFVANQV-GGKGGGRPDMAQAGGSDVDALP 861

Query: 887 QAIAGVASFL 896
            A+  + +++
Sbjct: 862 SALTSIEAWV 871


>gi|168787948|ref|ZP_02812955.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC869]
 gi|261225988|ref|ZP_05940269.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. FRIK2000]
 gi|261256754|ref|ZP_05949287.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. FRIK966]
 gi|189372228|gb|EDU90644.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EC869]
          Length = 876

 Score =  917 bits (2371), Expect = 0.0,   Method: Composition-based stats.
 Identities = 395/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFVVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED +N  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLMNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAITTVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|330879688|gb|EGH13837.1| alanyl-tRNA synthetase [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 874

 Score =  917 bits (2371), Expect = 0.0,   Method: Composition-based stats.
 Identities = 388/912 (42%), Positives = 538/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL FF++ GH  + SSSLIP NDPTL+FTN+GM  FK+ F GQEK  Y   
Sbjct: 1   MKSAEIREAFLGFFEEQGHTRVASSSLIPGNDPTLLFTNAGMNQFKDCFLGQEKRAYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
            T QKCVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW  LT  K  +
Sbjct: 61  VTSQKCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAITYAWTFLTSEKWLN 120

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY  D+EA+ +W K  G+ A++++RI  N       DNFW+M +TGPCGPC
Sbjct: 121 LPKEKLWVTVYATDDEAYDIWTKEIGVPAERMVRIGDNKGAPYASDNFWTMGDTGPCGPC 180

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           SEIFFD G  I GG PGS  E+G+RYIEIWN VFMQF +        LP  S+DTGMGLE
Sbjct: 181 SEIFFDHGADIWGGPPGSPEEDGDRYIEIWNNVFMQFNRTADGVLHPLPAPSVDTGMGLE 240

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R++ VLQ   +NY+IDLF+ L+ AS +  G     +N  + +V+ DH+RS  FLIADG+L
Sbjct: 241 RVSAVLQHVHSNYEIDLFQSLLAASARAIGCS--NDNQASLKVVADHIRSCGFLIADGVL 298

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P++EGRGYVLRRI+RRA  +   LG        ++ AL TEMGSA+PEL+Q +  IE  L
Sbjct: 299 PSSEGRGYVLRRIIRRACRHGNKLGAKGSFFYQIVAALVTEMGSAFPELVQQQSHIERVL 358

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           + E+E+F KTL++GL +++  L+ L    ++ G++ FKLYDT+G P+D+  DI   R L 
Sbjct: 359 KGEEEQFAKTLEQGLKIIEQDLAELK-GTVVPGEIVFKLYDTYGFPMDLTGDIARERNLT 417

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F + +E QR RAR+ S           + SL +   ATQF GY    G      
Sbjct: 418 -LDEEGFEREMEAQRVRARSASSFGM------DYNSLVKVDVATQFTGYSATTG------ 464

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                            S+ V A+ + G+ V     G++  V+ D TPFYAE+GGQ+GD+
Sbjct: 465 -----------------SASVVALYKDGQSVTHLNEGEEGVVILDTTPFYAESGGQIGDS 507

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G  +    R  ++D  K     F+HH +V  G L   + +   +  + R    +NHSATH
Sbjct: 508 GFLLAGDARFDVSDTTKTGG-AFLHHGVVASGSLSVGVQVETQVADEVRDATKLNHSATH 566

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV Q GS +    LRFD +H + I   +L+++ED VN  I +N PVVT
Sbjct: 567 LLHAALRQVLGEHVQQKGSLVDSQRLRFDFSHFESIKPEQLRALEDIVNAEIRKNTPVVT 626

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
              + + A   GA AL G KY D VRV+S+    GG  S  LCGG H S TG+I L  IV
Sbjct: 627 EETDIDTAKKKGAMALFGEKYGDSVRVLSM----GGEFSVELCGGIHASRTGDISLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SE  + AG+RRIEA+TG  A + L   +++LK  A+ +K ++ N++ ++  + E  R L+
Sbjct: 683 SEGGVAAGVRRIEAVTGAAALAWLNSAEDQLKEAATLVKGNRDNLLDKLTAVLERNRLLE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + + +           +   +  V  ++  +   D K L +++D L+ K+   +I+
Sbjct: 743 KQLEQLQAKAASAAGDDLSSAALDVKGVKVLATRLDGQDGKALLALVDQLKNKLGRAVIL 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +  E K  ++  VT+DL  +  A DL + +A  + GG GGGRP MAQ GG +    D
Sbjct: 803 LGSVH-EDKVVLVAGVTKDLTGQLKAGDLMKQAATAV-GGKGGGRPDMAQGGGVDATALD 860

Query: 887 QAIAGVASFLKK 898
            A+A    F+++
Sbjct: 861 SALALAVPFVEQ 872


>gi|82778066|ref|YP_404415.1| alanyl-tRNA synthetase [Shigella dysenteriae Sd197]
 gi|123561812|sp|Q32CN1|SYA_SHIDS RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|81242214|gb|ABB62924.1| alanyl-tRNA synthetase [Shigella dysenteriae Sd197]
          Length = 876

 Score =  917 bits (2371), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 559/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ   VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQDAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFVVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|331678669|ref|ZP_08379343.1| alanine--tRNA ligase [Escherichia coli H591]
 gi|331073499|gb|EGI44820.1| alanine--tRNA ligase [Escherichia coli H591]
          Length = 876

 Score =  917 bits (2370), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAITTVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQERANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|269140202|ref|YP_003296903.1| alanyl-tRNA synthetase [Edwardsiella tarda EIB202]
 gi|267985863|gb|ACY85692.1| alanyl-tRNA synthetase [Edwardsiella tarda EIB202]
 gi|304560033|gb|ADM42697.1| Alanyl-tRNA synthetase [Edwardsiella tarda FL6-60]
          Length = 875

 Score =  917 bits (2370), Expect = 0.0,   Method: Composition-based stats.
 Identities = 385/910 (42%), Positives = 553/910 (60%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+F+   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFYHSKGHQVVDSSSLVPNNDPTLLFTNAGMNQFKDVFLGIDKRSYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + F+
Sbjct: 63  TTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAINFAWELLTGAQWFN 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY+ D+EA+ +W    G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKEKLWVTVYESDDEAYDIWANEVGVPRERIIRIGDNKGAAYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G  I GG P    E+G+RYIEIWN+VFMQF +Q+      LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGAHIAGGPPGSPDEDGDRYIEIWNIVFMQFNRQSDGTLLPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LI  + +V G+     +  + RVI DH+RS +FL++DG+L
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIAETARVIGVSD--LSSKSLRVIADHIRSCAFLVSDGVL 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NEGRGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA   L Q + ++E+ L
Sbjct: 301 PSNEGRGYVLRRIIRRAVRHGHMLGAKEAFFYKLVKPLIAVMGSAADALAQQQAMVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  LS L   + L+G+ AF+LYDT+G PLD+  D+   RGL 
Sbjct: 361 KTEEEQFARTLERGLTLLDDELSTLD-GDTLDGETAFRLYDTYGFPLDLTADVCRERGLK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F +A+E QR RAR       S      + S+    G+T F GY           
Sbjct: 420 -VDEEGFERAMEAQRRRARE------SSGFGADYNSMIRVDGSTDFTGY----------- 461

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             ++V A+   G+ V+   +G++  VV  QTPFYAE+GGQ+GD 
Sbjct: 462 ------------HLQQQDALVTALFHNGQAVDALQAGEEGVVVLAQTPFYAESGGQVGDR 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G     G R  + D QK  +    H   V +G LR    +  +ID   R ++  +HSATH
Sbjct: 510 GELTAQGCRFVVEDTQKYGQ-AIGHLGKVAQGSLRVGERVQASIDGARRERIRQSHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL ++LG HV+Q GS ++   LRFD +H++ +   +++ +ED VN  I +NLP+ T
Sbjct: 569 LMHAALRSVLGEHVAQKGSLVSDGALRFDFSHAEAMKPQQIRQVEDIVNAQIRRNLPIDT 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           + M  E+A A GA AL G KY+ +VRV+S+     G  S+ LCGGTH   TG+I L  IV
Sbjct: 629 QEMGLEEAKAKGAMALFGEKYDAQVRVLSM-----GDFSTELCGGTHAERTGDIGLFRIV 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG++A   +  + + L+  AS +K    +V  ++  + E+ R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEQALLAMHQESDMLREAASLVKGDAQSVAEKIRAVMEKSRQLE 743

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++         ++  V  +   +  V+ K L++++D L+ ++ S I++
Sbjct: 744 KALQQLKDQQAAQESASLSGKAVEVNGVKLLVSQLDGVEPKMLRTMVDDLKNQMGSCIVV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L       K S++  VT+DL  +  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATAEA-GKVSLIAGVTKDLTAKVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
           QA+A V  ++
Sbjct: 862 QALASVTDWV 871


>gi|239996387|ref|ZP_04716911.1| alanyl-tRNA synthetase [Alteromonas macleodii ATCC 27126]
          Length = 865

 Score =  917 bits (2370), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/901 (42%), Positives = 535/901 (59%), Gaps = 48/901 (5%)

Query: 3   NVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVT 62
           + + +R  F+++F+ +GH+ + SSSL+P +DPTL+FTN+GM  FK+ F G EK  Y    
Sbjct: 4   STADLRNKFIDYFKSHGHQAVASSSLVPADDPTLLFTNAGMNQFKDCFLGAEKRSYTRAV 63

Query: 63  TVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQ 122
           + Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI+ AW+ LTKE  L +
Sbjct: 64  SSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKKEAIEFAWNFLTKEIGLPK 123

Query: 123 RRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGEC 182
            +L +TVY ED+EAF +W+   G+  +KIIRI+T+DNFWSM +TGPCGPCSEIF+D G  
Sbjct: 124 EKLLVTVYSEDDEAFDIWENHIGVPKEKIIRISTSDNFWSMGDTGPCGPCSEIFYDHGAH 183

Query: 183 IPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEKT 241
           I GG P    E+G+R+IEIWNLVFMQF +Q       LPK SIDTGMGLER++ +LQ   
Sbjct: 184 IWGGPPGTPEEDGDRFIEIWNLVFMQFNKQADGTMEPLPKPSIDTGMGLERISAILQNVH 243

Query: 242 NNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYVL 301
           +NY+IDLF++LI+++  + G +       + RVI DH+RS SFLI DG++P+NEGRGYVL
Sbjct: 244 SNYEIDLFQNLIKSAASIVGSED--LENKSLRVIADHIRSCSFLICDGVMPSNEGRGYVL 301

Query: 302 RRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGKT 361
           RRI+RRA+ +   LG  +     L+ +L  EMG AYPEL+    +IE+ LR E+E+F KT
Sbjct: 302 RRIIRRAVRHGYQLGANDIFFYKLVASLAKEMGEAYPELVDQLPVIEKVLRVEEEQFSKT 361

Query: 362 LDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQA 421
           L RG+ +L+  L  L   + + GDV FKLYDT+G P D+  D+     L  ID   F  A
Sbjct: 362 LARGMAILNDTLETLE-GDTVPGDVVFKLYDTYGFPTDLTNDVAREHDLK-IDEEGFEAA 419

Query: 422 LEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKPP 481
           ++         +    +      + S       T F GY  + G                
Sbjct: 420 MQ------AQRARAQQASNFGADYNSKLAIDHTTSFTGYTDVEG---------------- 457

Query: 482 IDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIRL 541
                   + V  ++     VE+   GQ+  VV D TPFYAE+GGQ GD G         
Sbjct: 458 -------QANVVELIADNAFVEKLEDGQEGVVVLDSTPFYAESGGQAGDKGVLRVANGEF 510

Query: 542 QITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTIL 601
            +TD QK        H  + +G +    +    ID  NR  +  NHSATHLLH AL  IL
Sbjct: 511 IVTDTQKMGNAF--AHKGIAKGSVSKGDTATAAIDAANREAIKKNHSATHLLHAALREIL 568

Query: 602 GSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAIA 661
           G HV+Q GS +    +RFD +H + +T+ +L  IE  VN  I  N  + T +M+ ++A A
Sbjct: 569 GEHVTQKGSLVEAPRMRFDFSHFEAVTAEQLAEIERRVNQEIRANHTLATELMDLDEAKA 628

Query: 662 SGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGIR 721
           SGA AL G KY+++VRVV++     G  S  LCGGTHV+ TG+I L  I SE+ I +G+R
Sbjct: 629 SGAMALFGEKYDEKVRVVTM-----GPFSVELCGGTHVTRTGDIGLFKITSEAGIASGVR 683

Query: 722 RIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQL 781
           RIEA+TG+ A   +  Q   L SL++ LK    NV+ RV  +  + ++L+      K +L
Sbjct: 684 RIEAVTGEHALEVVQTQQATLSSLSALLKTDSQNVLDRVVSLQNQTKELEKALNSAKQKL 743

Query: 782 NVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKKA 836
             +       +  +I  V  +   +  V++K L+S+MD ++ +I  GI++L G++ + K 
Sbjct: 744 ASQQGADMLSNAVEINGVKVLIANLEGVEAKSLRSMMDDIKNRIGEGIVVL-GVANDAKV 802

Query: 837 SVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASFL 896
           +++  VT++L  +  A +L    A  + GG GGGRP MAQ+GG       QA+  V ++L
Sbjct: 803 NLIAGVTKNLTSKVKAGELVNFVASQV-GGKGGGRPDMAQAGGDQPENLGQALDSVNAWL 861

Query: 897 K 897
           +
Sbjct: 862 Q 862


>gi|56475970|ref|YP_157559.1| alanyl-tRNA synthetase [Aromatoleum aromaticum EbN1]
 gi|81598995|sp|Q5P7Q3|SYA_AZOSE RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|56312013|emb|CAI06658.1| Alanyl-tRNA synthetase [Aromatoleum aromaticum EbN1]
          Length = 873

 Score =  917 bits (2370), Expect = 0.0,   Method: Composition-based stats.
 Identities = 372/911 (40%), Positives = 532/911 (58%), Gaps = 56/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH+++ SSSL+P +DPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 1   MKSAEIREKFLKFFESKGHQIVASSSLVPHDDPTLLFTNAGMNQFKDVFLGFDKRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT QKCVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT+EF L 
Sbjct: 61  TTSQKCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAITYAWELLTEEFGLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY +D+EA+ +W K  G+ A+++IRI  N       DNFW M +TGPCGPC+E
Sbjct: 121 KDKLWVTVYADDDEAYDIWTKEIGVPAERVIRIGDNKGARYASDNFWMMGDTGPCGPCTE 180

Query: 175 IFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  I GG P    E+G+RYIEIWN VFMQF +        LP+ S+DTGMGLER+
Sbjct: 181 IFYDHGPEIWGGPPGSPDEDGDRYIEIWNNVFMQFNRDEAGVMHPLPRPSVDTGMGLERV 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           + VLQ   +NY+IDLF+ LI+A+ + TG      +  + +VI DH+R+ SFLIADG++P 
Sbjct: 241 SAVLQHVHSNYEIDLFQTLIRAAARETGCAD--LDSPSLKVIADHIRACSFLIADGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+P L TEMG AYPEL   +  + + L+ 
Sbjct: 299 NEGRGYVLRRIIRRAIRHGYKLGSRAAFFHRLVPDLVTEMGPAYPELKAGQARVADVLKQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGK--DEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF  T++ G+ +L+  L+ +        NG+ AFKL+DT+G PLD+  D+   R + 
Sbjct: 359 EEERFFATIENGMAILETELAAMATAGSRTFNGETAFKLHDTYGFPLDLTADVCRERDVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
                  + A+  Q+ +ARA      +        +L+ +   T+F GY+ L        
Sbjct: 419 VDAAAF-DAAMARQKEQARAAGKFRMAM-------NLEYEGPETKFHGYERLEER----- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                               V A+ + G  V E   G    VV D TPFYAE+GGQ+GD 
Sbjct: 466 ------------------GTVLALYKDGAPVVELQEGDIGVVVLDNTPFYAESGGQVGDR 507

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G     ++ D QK    ++ HH +V+ G L     L   +D + R     NHS TH
Sbjct: 508 GELRGSAGIFEVEDTQKIQAAVYGHHGVVKTGRLAVGQELGARVDGEARASTQRNHSVTH 567

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV Q GS + PD  RFD  H+ P++  E++ +ED VN  I  N+    
Sbjct: 568 LMHKALREVLGAHVQQKGSQVDPDKTRFDFAHTAPLSPEEIREVEDLVNAEILANVATEA 627

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M+ +DA  SGA  L G KY D VRV+++        S  LCGGTHV+ TG+I L  IV
Sbjct: 628 RVMSIDDAQKSGAMMLFGEKYGDEVRVLAIGS------SKELCGGTHVARTGDIGLFKIV 681

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SE  + AG+RRIEA+TG  A  +   Q+ +++ +++ LKV    V  R+  I +  R L+
Sbjct: 682 SEGGVAAGVRRIEAVTGANALRYAQEQERRVQGISALLKVQPDEVAERIAGILDNVRALE 741

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
              A+ K +L             ++     ++ ++   D   L+  +D L+ K++S +I+
Sbjct: 742 KELARMKSRLAASQGDELVAQAVEVRGAKVLAAMLEGADVATLRETLDKLKDKLKSAVIV 801

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ + + S++  VT DL  +  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 802 LAAVA-DGRVSLIAGVTSDLTAKLKAGELVNMVAQQV-GGKGGGRPDMAQAGGTDPAHLP 859

Query: 887 QAIAGVASFLK 897
            A+A V ++ +
Sbjct: 860 AALASVKAWAE 870


>gi|254714269|ref|ZP_05176080.1| alanyl-tRNA synthetase [Brucella ceti M644/93/1]
 gi|261322043|ref|ZP_05961240.1| alanyl-tRNA synthetase [Brucella ceti M644/93/1]
 gi|261294733|gb|EEX98229.1| alanyl-tRNA synthetase [Brucella ceti M644/93/1]
          Length = 885

 Score =  917 bits (2370), Expect = 0.0,   Method: Composition-based stats.
 Identities = 474/893 (53%), Positives = 622/893 (69%), Gaps = 36/893 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M+ V+ IR+TFL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG E   Y  
Sbjct: 1   MAGVNEIRSTFLDYFRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRSYNR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE AI  AW+L+T+EF L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEDAISFAWNLITREFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + +L +TVY  D++A   WKKI+GLS D+IIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 121 PKDKLLVTVYHTDDDAANFWKKIAGLSDDRIIRIPTSDNFWAMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R+IEIWNLVFMQFEQQ  + R  LP+ SIDTGMGLER+A VLQ 
Sbjct: 181 DHIWGGPPGSPEEDGDRFIEIWNLVFMQFEQQTPELRIDLPRPSIDTGMGLERIAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NYDIDLFK LI+ASE+ TG+K EG+   +HRVI DHLR+SSFLIADG+LP+NEGRGY
Sbjct: 241 VHDNYDIDLFKALIRASEEATGVKAEGDFRASHRVIADHLRASSFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  LLPAL  EMG AYPELI+A+ LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAKEPLMWRLLPALIREMGQAYPELIRAESLISETLKLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL     +L + + L+G+ AFKLYDT+G PLD+ QD L  RG   +D   FN
Sbjct: 361 KTLERGLGLLSDASENLAEGDRLDGETAFKLYDTYGFPLDLTQDALRQRG-IAVDTEGFN 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E Q++ ARA+  G G   TE IWF +K+K GAT+F+GY+                  
Sbjct: 420 VAMERQKAEARANWTGSGEAATETIWFGIKDKVGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     ++ ++V+    V     G+ + VV +QTPFY E+GGQ GDTG   G+G 
Sbjct: 462 -----TESAEGVIASLVRDSVEVPSVREGETISVVVNQTPFYGESGGQQGDTGTISGEGF 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
            + + D QKK EG+FVH   V  G  +    + L +D   R ++  NHSATHLLH AL  
Sbjct: 517 VIAVKDTQKKGEGVFVHIGEVTEGTAKAGDVVELKVDSARRTRIRSNHSATHLLHEALRE 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
            LG+HV+Q GS + PD LRFD +H KPI++ EL+++E+  N+II QN PV TR+M  +DA
Sbjct: 577 TLGTHVAQKGSLVAPDRLRFDFSHPKPISAEELEAVENLANEIILQNAPVTTRLMAVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSV-----EYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+       + G  +S  LCGGTHV  TG+I L+ I+SE 
Sbjct: 637 IAEGAMALFGEKYGDEVRVVSMGTAKHGSKAGKAYSVELCGGTHVRQTGDIGLVRIISEG 696

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
            + AG+RR+EA+TG+ AR +L  QDE++K++AS LK +  +V+ RV  + +E +KL+   
Sbjct: 697 GVAAGVRRLEALTGEAARLYLEEQDERVKAIASALKTTSADVLDRVNALIDERKKLEREL 756

Query: 775 AKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
           A  + +L +         +   +  VNF+  I++ V  ++LK + D  +K++ SG+++ +
Sbjct: 757 ADARKKLALGGGSSDGGSAVEAVNGVNFLGKIVTGVSPRDLKPLADEGKKQVGSGVVLFI 816

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPN 881
           G+ ++ KAS +  VTED++ RF+AVDL R ++  LGG GGGGRP MAQ+GGP+
Sbjct: 817 GVGEDGKASAVAAVTEDMVGRFSAVDLVRAASAALGGAGGGGRPDMAQAGGPD 869


>gi|153009317|ref|YP_001370532.1| alanyl-tRNA synthetase [Ochrobactrum anthropi ATCC 49188]
 gi|205830165|sp|A6X0E9|SYA_OCHA4 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|151561205|gb|ABS14703.1| alanyl-tRNA synthetase [Ochrobactrum anthropi ATCC 49188]
          Length = 885

 Score =  917 bits (2369), Expect = 0.0,   Method: Composition-based stats.
 Identities = 481/893 (53%), Positives = 621/893 (69%), Gaps = 36/893 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M+ V+ IR+TFL++++KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG E   Y  
Sbjct: 1   MAGVNEIRSTFLDYYRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRSYNR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE AI  AW+L+TKEF L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEDAISFAWNLITKEFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + +L +TVY  D++A   WKKI+GLS D+IIRI T+DNFW+M +TGPCGPCSEIFFD G
Sbjct: 121 PKDKLLVTVYHTDDDAANYWKKIAGLSDDRIIRIATSDNFWAMGDTGPCGPCSEIFFDHG 180

Query: 181 ECIPGGLPGS-SEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R+IEIWNLVFMQFEQ   ++R  LP+ SIDTGMGLER+A VLQ 
Sbjct: 181 DHIWGGPPGSADEDGDRFIEIWNLVFMQFEQITPEQRIDLPRPSIDTGMGLERVAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NYDIDLFK LI+ASE+ TG+K EG    +HRVI DHLR+SSFLIADG+LP+NEGRGY
Sbjct: 241 VHDNYDIDLFKALIRASEEATGVKAEGEFRASHRVIADHLRASSFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  LLPAL  EMG AYPELI+A  LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAKEPLMWRLLPALIREMGQAYPELIRADALISETLKLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTLDRGL LL      L + + L+G+ AFKLYDT+G PLD+ QD L  RG   +D   F+
Sbjct: 361 KTLDRGLGLLSDATESLVEGDRLDGETAFKLYDTYGFPLDLTQDALRQRG-IAVDTDGFS 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A++ Q++ ARA+  G G   TE IWF +K+K GAT+F+GY+                  
Sbjct: 420 AAMQRQKAEARANWAGSGEAATETIWFGIKDKVGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     ++ A+V+ G  V+ A  G  V VV +QTPFY E+GGQ GDTG   G+G 
Sbjct: 462 -----TEVAEGVITALVRDGAEVQSAAEGDVVSVVVNQTPFYGESGGQQGDTGTISGEGF 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
            + I D QKK EG+FVH   V +G  +T  ++ L +D   R ++  NHSATHLLH AL  
Sbjct: 517 AIAIKDTQKKGEGVFVHIGEVTKGTAKTGDAVELKVDSVRRTRIRSNHSATHLLHEALRE 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
            LGSHV+Q GS + PD LRFD +H KPI++ EL  +E+  N+II QN PV TR+M  +DA
Sbjct: 577 TLGSHVAQKGSLVAPDRLRFDFSHPKPISAEELTQVENLANEIILQNAPVSTRLMAVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSV-----EYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+       ++G  +S  LCGGTHV  TG+I L+ IVSE 
Sbjct: 637 IAEGAMALFGEKYGDEVRVVSMGTAKHGSKEGKAYSVELCGGTHVRQTGDIGLVRIVSEG 696

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
           ++ AG+RR+EA+TG+ AR +L  QDE++K++A  LK +    + RV  + +E +KL+   
Sbjct: 697 AVAAGVRRMEALTGEAARLYLEEQDERVKAIAGALKTTPSEALERVNALLDERKKLEREL 756

Query: 775 AKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
           A  + +L +         +   +  VNF+  I++ V  ++LK + D  +K++ SG+++ +
Sbjct: 757 ADARKKLALGGGSADGGSAVEAVNGVNFLGKIVTGVSPRDLKPLADEGKKQVGSGVVLFI 816

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPN 881
           GI ++ KAS +  VTEDL+ RF+AVDL R ++  LGG GGGGRP MAQ+GGP+
Sbjct: 817 GIGEDSKASAVAAVTEDLVGRFSAVDLVRAASVALGGAGGGGRPDMAQAGGPD 869


>gi|33597425|ref|NP_885068.1| alanyl-tRNA synthetase [Bordetella parapertussis 12822]
 gi|41018188|sp|Q7W6N4|SYA_BORPA RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|33573852|emb|CAE38162.1| alanyl-tRNA synthetase [Bordetella parapertussis]
          Length = 874

 Score =  916 bits (2368), Expect = 0.0,   Method: Composition-based stats.
 Identities = 397/911 (43%), Positives = 547/911 (60%), Gaps = 53/911 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              S IR  FL+FFQ  GH ++PSSSL+P NDPTL+FTNSGMV FK++FTG+E   Y+  
Sbjct: 1   MKSSEIRQKFLQFFQSKGHTIVPSSSLVPANDPTLLFTNSGMVQFKDVFTGKEARAYKRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT+ + L 
Sbjct: 61  TSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIQYAWELLTQVYRLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY ED+EA+ +W K  G+ A++IIRI  N       DNFW MA+TGPCGPCSE
Sbjct: 121 AEKLWVTVYQEDDEAYDIWAKEVGVPAERIIRIGDNKGARYASDNFWQMADTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGS-SEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  I GG PGS  E+G+RYIEIWNLVFMQFE+        LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPEIWGGPPGSLEEDGDRYIEIWNLVFMQFERDAAGNMERLPKPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI A+ + TG+K   +N  + +VI DH+R+ +FLI DGI+P+
Sbjct: 241 AAVLQHVHSNYEIDLFQKLIAAAARETGVKDLADN--SLKVIADHIRACAFLIVDGIIPS 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG T+P    L+P L  EMG AYPEL Q    + + LR 
Sbjct: 299 NEGRGYVLRRIVRRALRHGYKLGQTKPFFHRLVPDLVAEMGEAYPELAQVAERVAQVLRQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGI 413
           E++RFG+TL+ G+ +LDG L+ + K + L+G   F LYDT+G P+D+  DI   RG   +
Sbjct: 359 EEKRFGETLEHGMKILDGALAKVAKGDPLDGTTLFTLYDTYGFPVDLTADICRERG-VEV 417

Query: 414 DIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDR 473
           D+  F  A++ QR +ARA      +         L  +   T+F GY+ L  S       
Sbjct: 418 DMAGFEAAMQRQREQARAAGKFKMAEG-------LSYEGAETRFEGYESLELSGV----- 465

Query: 474 KVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGC 533
                             V A+  +G  VE+  +GQ   VV D TPFYAE+GGQ+GDTG 
Sbjct: 466 -----------------KVTALYVEGTQVEQVSAGQDAVVVLDATPFYAESGGQVGDTGL 508

Query: 534 AIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLL 593
               G+R  + D  K   G+F HH  +E G L+   +L+  +D   R +   NHSATHL+
Sbjct: 509 LEAGGVRFAVADTLKIQPGVFGHHGTLEAGALKVGDTLLARVDAVRRARTVRNHSATHLM 568

Query: 594 HHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRI 653
           H AL  +LG+HV Q GS + PD  RFD  H  P+T+ ++  +E  VN  +  N     ++
Sbjct: 569 HKALREVLGAHVQQRGSLVDPDKTRFDFAHDAPMTAEQIARVEAIVNAEVLANQATEAKV 628

Query: 654 MNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSE 713
           M  +DA+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  +VSE
Sbjct: 629 MAYDDAVKGGAMALFGEKYGDTVRVLDIG------FSRELCGGTHVRRTGDIGLFKVVSE 682

Query: 714 SSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLI 773
             + AG+RRIEAITG  A + +  Q+  L+  A  L+     +  R+ ++ E+ + L+  
Sbjct: 683 GGVAAGVRRIEAITGDNALAWVQDQNVLLQRAAGVLRAPAHELPERIAQVQEQLKALEKE 742

Query: 774 HAKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
             + + +L           +  ++  +  ++  I +VD K L+ ++D L+ +++  +++L
Sbjct: 743 LEQARTKLAASAGNDLAATATVEVKGIKVLAASIGDVDPKALRGMVDNLKDRLKPAVVLL 802

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQ 887
              S + K S++  VT DL  R  A DL    A  +GG G GGRP MA  GG +      
Sbjct: 803 AAGSADGKISLVGGVTADLTGRIKAGDLVGFVAGQVGGKG-GGRPDMAMGGGTDLAALPA 861

Query: 888 AIAGVASFLKK 898
           A+A V  ++ +
Sbjct: 862 AVASVQKWVDE 872


>gi|113868727|ref|YP_727216.1| alanyl-tRNA synthetase [Ralstonia eutropha H16]
 gi|123133735|sp|Q0K823|SYA_RALEH RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|113527503|emb|CAJ93848.1| Alanyl-tRNA synthetase [Ralstonia eutropha H16]
          Length = 874

 Score =  916 bits (2368), Expect = 0.0,   Method: Composition-based stats.
 Identities = 390/910 (42%), Positives = 535/910 (58%), Gaps = 55/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
             VS IR+ FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G +K  Y   
Sbjct: 1   MKVSDIRSKFLQFFESKGHTVVRSSSLVPANDPTLLFTNSGMVQFKDVFLGTDKRPYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLTK + L 
Sbjct: 61  TSAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAILYAWELLTKTYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY ED+EA+ +W K  G+ A++I+RI  N       DNFW MA+TGPCGPCSE
Sbjct: 121 AEKLWVTVYAEDDEAYDIWAKEVGVPAERIVRIGDNKGARYASDNFWQMADTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIE+WNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEVWNLVFMQFNRDEQGNMTPLPKPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+A+ + T +     N  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQALIKAAARETHID--NLNQNSLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG   P    ++  L  +MG AYPEL +A+  + E L++
Sbjct: 299 NEGRGYVLRRIIRRAIRHGYKLGQKTPFFHKMVADLVEQMGQAYPELAEAQSRVTEVLKA 358

Query: 354 EDERFGKTLDRGLVLLDGVLS--HLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +LD  L+   L   + L+G++AFKL+DT G PLD+ QD+   +   
Sbjct: 359 EEERFFETIENGMSILDAALADLKLKGGKTLDGELAFKLHDTFGFPLDLTQDVCREQ-EI 417

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
           G+D  +F+ A+  QR +ARA      +         L+     T F GY+ L        
Sbjct: 418 GVDEAAFDAAMNRQREQARAAGKFKMAAG-------LEYTGDKTVFHGYEKLELP----- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V     GQ   VV D TPFYAE+GGQ GD 
Sbjct: 466 -----------------QARVTALYVDGAAVNAMQPGQTGVVVLDNTPFYAESGGQAGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G          +TD  K    +F H   +E G L+   ++   +D Q R +   NHSATH
Sbjct: 509 GVLKAGNAVFAVTDTTKIQADVFGHQGTLEGGALKVGDAVSAQVDAQRRARTVRNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD +H+  +T  +++ +E+ VN  I +N     
Sbjct: 569 LMHKALREVLGSHVQQKGSLVDADKTRFDFSHNAALTDEQIRRVEEIVNAEILRNDDTHA 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM  +DA+ SGA AL G KY D VRV+S+        S  LCGGTHV  TG+I L  IV
Sbjct: 629 EIMPFDDAVKSGAMALFGEKYADDVRVLSIG------TSKELCGGTHVHRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  +L G D +L   A+ LK     +V R+ ++ ++ R L+
Sbjct: 683 VEGGVAAGIRRVEAITGDNALHYLQGLDARLNEAAAVLKAQPSELVPRIGQVQDQVRALE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K +L              I  +  ++  +   D K L+  MD L+ K++S  I+
Sbjct: 743 KELERLKSKLAASQGDELAAQAVDIKGLKVLAAQLDGADVKTLRETMDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +S + K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG    K  
Sbjct: 803 LGAVS-DGKVSLIAGVTADATGKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPAKLP 860

Query: 887 QAIAGVASFL 896
           QA+AGV  ++
Sbjct: 861 QALAGVGEWV 870


>gi|239832092|ref|ZP_04680421.1| alanyl-tRNA synthetase [Ochrobactrum intermedium LMG 3301]
 gi|239824359|gb|EEQ95927.1| alanyl-tRNA synthetase [Ochrobactrum intermedium LMG 3301]
          Length = 885

 Score =  916 bits (2368), Expect = 0.0,   Method: Composition-based stats.
 Identities = 481/893 (53%), Positives = 624/893 (69%), Gaps = 36/893 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M+ V+ IR+TFL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG E   Y  
Sbjct: 1   MAGVNEIRSTFLDYFRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRSYNR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK+ AI  AW+L+TKEF L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKDEAISFAWNLITKEFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + +L +TVY  D++A   WKKI+GLS D+IIRI T+DNFW+M +TGPCGPCSEIFFD G
Sbjct: 121 PKDKLLVTVYHTDDDAANYWKKIAGLSDDRIIRIATSDNFWAMGDTGPCGPCSEIFFDHG 180

Query: 181 ECIPGGLPGS-SEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R+IEIWNLVFMQFEQ   ++R  LP+ SIDTGMGLER+A VLQ 
Sbjct: 181 DHIWGGPPGSADEDGDRFIEIWNLVFMQFEQITPEQRIDLPRPSIDTGMGLERVAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NYDIDLFK LI+ASE+ TG+K +G    +HRVI DHLR+SSFLIADG+LP+NEGRGY
Sbjct: 241 VHDNYDIDLFKALIRASEEATGVKADGELRASHRVIADHLRASSFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  LLP L  EMG AYPELI+A+ LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAKEPLMWRLLPTLIREMGQAYPELIRAEALISETLKLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTLDRGL LL     +L + + L+G+ AFKLYDT+G PLD+ QD L  RG   +D   F+
Sbjct: 361 KTLDRGLGLLSDATENLVEGDRLDGETAFKLYDTYGFPLDLTQDALRQRG-IAVDTDGFS 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E Q++ ARA+  G G   TE IWF +K+K GAT+F+GY+                  
Sbjct: 420 AAMERQKAEARANWAGSGEAATETIWFGIKDKVGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +V A+V+ G  V+ A  G+ V VV +QTPFY E+GGQ GDTG   G+G 
Sbjct: 462 -----TESAEGVVAALVRDGAEVQSASEGEVVSVVVNQTPFYGESGGQQGDTGTISGEGF 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
            + I D QKK EG+FVH   V +G ++T  ++ L +D   R ++  NHSATHLLH AL  
Sbjct: 517 VIAIKDTQKKGEGVFVHIGEVAKGTVKTGDAVELKVDSARRTRIRSNHSATHLLHEALRE 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
            LGSHV+Q GS + PD LRFD +H KPI++ EL  +E+  N+II QN PV TR+M  +DA
Sbjct: 577 TLGSHVAQKGSLVAPDRLRFDFSHPKPISAEELAKVENLANEIILQNAPVSTRLMAVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSV-----EYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+       ++G  +S  LCGGTHV  TG+I L+ IVSE 
Sbjct: 637 IAEGAMALFGEKYGDEVRVVSMGTAKHGSKEGKAYSVELCGGTHVRQTGDIGLVRIVSEG 696

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
           ++ AG+RR+EA+TG+ AR +L  QDE++K++A  LK +    + RV  + +E +KL+   
Sbjct: 697 AVAAGVRRMEALTGEAARLYLEEQDERVKAIAGALKTTPAEALERVNALLDERKKLEREL 756

Query: 775 AKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
           A  + +L +         +   +  VNF+  I++ V  ++LK + D  +K++ SG+++ +
Sbjct: 757 ADARKKLALGGGSADGGSAVEAVNGVNFLGKIVTGVSPRDLKPLADEGKKQVGSGVVLFI 816

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPN 881
           G+ ++ KAS +  VTEDLL RF+AVDL R ++  LGG GGGGRP MAQ+GGP+
Sbjct: 817 GVGEDDKASAVAAVTEDLLGRFSAVDLVRAASAALGGAGGGGRPDMAQAGGPD 869


>gi|82545227|ref|YP_409174.1| alanyl-tRNA synthetase [Shigella boydii Sb227]
 gi|123558824|sp|Q31X62|SYA_SHIBS RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|81246638|gb|ABB67346.1| alanyl-tRNA synthetase [Shigella boydii Sb227]
 gi|320186483|gb|EFW61211.1| Alanyl-tRNA synthetase [Shigella flexneri CDC 796-83]
 gi|332091817|gb|EGI96895.1| alanyl-tRNA synthetase [Shigella boydii 3594-74]
          Length = 876

 Score =  916 bits (2368), Expect = 0.0,   Method: Composition-based stats.
 Identities = 395/910 (43%), Positives = 559/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G          + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKDANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAITTVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|15803211|ref|NP_289243.1| alanyl-tRNA synthetase [Escherichia coli O157:H7 EDL933]
 gi|12517136|gb|AAG57801.1|AE005498_2 alanyl-tRNA synthetase [Escherichia coli O157:H7 str. EDL933]
          Length = 878

 Score =  916 bits (2367), Expect = 0.0,   Method: Composition-based stats.
 Identities = 393/894 (43%), Positives = 553/894 (61%), Gaps = 56/894 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFVVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAITTVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGP 880
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG 
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGT 855


>gi|288960191|ref|YP_003450531.1| alanyl-tRNA synthetase [Azospirillum sp. B510]
 gi|288912499|dbj|BAI73987.1| alanyl-tRNA synthetase [Azospirillum sp. B510]
          Length = 889

 Score =  916 bits (2367), Expect = 0.0,   Method: Composition-based stats.
 Identities = 449/895 (50%), Positives = 587/895 (65%), Gaps = 37/895 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR TFL+FF K GH+++ SS L+P NDPTLMFTN+GMV FKN+FTG E   Y+ 
Sbjct: 1   MQTANDIRRTFLDFFAKQGHQIVDSSPLVPRNDPTLMFTNAGMVQFKNVFTGAETRPYRR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             T QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK+ AI  AW+L+TKE+ L
Sbjct: 61  AVTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKDDAIAFAWNLITKEYGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
              +L +TV+  DE+A  +W+K++GLS D+IIRI T+DNFW M +TGPCGPCSEIFFD G
Sbjct: 121 PADKLLVTVHTSDEDAAAIWRKVAGLSDDRIIRIPTDDNFWRMGDTGPCGPCSEIFFDHG 180

Query: 181 ECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
             I GG P    E+G+R+IEIWNLVFMQ+EQ        LPK SIDTGMGLER+A VLQ 
Sbjct: 181 PSIAGGPPGSPDEDGDRFIEIWNLVFMQYEQLGPDNLVPLPKPSIDTGMGLERLAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           + +NYDIDL + LI AS + T    +G + V+HRVI DHLRS+SFLIADG+LP+NEGRGY
Sbjct: 241 QHDNYDIDLMRALIMASAEATKTAADGAHAVSHRVIADHLRSTSFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A ++G  EPLM  L+PAL  +MG AYPEL +A+ LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAHMIGAREPLMHRLVPALIQQMGDAYPELNRARALIVETLKLEETRFK 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           +TL+RGL LL+  + HLG+ + L GDVAFKLYDT+G PLD+ QD+L  +   G+D   F 
Sbjct: 361 QTLERGLRLLEDEVGHLGEGQPLAGDVAFKLYDTYGFPLDLTQDVLRGQNR-GVDEAGFK 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A++EQR +AR    G G   TEK+W+ +K++ GAT+F GYD                  
Sbjct: 420 AAMDEQRRKARESWAGSGEVGTEKLWYEIKDELGATEFFGYD------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T      V AIV+    VE A  G +V VV +QTPFY E+GGQ+GD G     G 
Sbjct: 462 -----TEVAEGKVTAIVKGDTRVEAAAIGDQVMVVVNQTPFYGESGGQVGDAGVIFSAGG 516

Query: 540 -RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALS 598
             + ++D  KK   ++ H   V +GIL     + L +D   R  +  NHSATHLLH AL 
Sbjct: 517 AEVAVSDTLKKLGAVWAHVGTVTKGILSVGDVVELRVDSSRRAAIRANHSATHLLHEALR 576

Query: 599 TILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNRED 658
             LG HV+Q GS + P+ LRFD++    +T+A++ +IED VN  +  N  VVTR+M+ ++
Sbjct: 577 HRLGDHVTQKGSLVAPERLRFDISQPTGLTAADIAAIEDEVNRRVLANSEVVTRLMSPDE 636

Query: 659 AIASGAAALLGTKYNDRVRVVSVEYEDGG---VHSSALCGGTHVSSTGEIMLLYIVSESS 715
           A A GA AL G KY D VRVVS+    G     +S  LCGGTHV  TG+I +  IVSE +
Sbjct: 637 ARAQGAMALFGEKYGDEVRVVSMGGPHGELDRDYSIELCGGTHVRRTGDIGVFKIVSEGA 696

Query: 716 IRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHA 775
           + AG+RRIEA+TG  A++ L  +D  L   AS LKV    V  RV  + EE RK++   A
Sbjct: 697 VAAGVRRIEALTGTGAKAWLSERDHLLTEAASVLKVKPDEVPARVATLVEERRKMERELA 756

Query: 776 KRKLQLNVEDL-------SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
             + Q+ +              +A V   + ++  + +K+LK + D L+K++ SG+++L+
Sbjct: 757 DLRRQVAMGGGAKADGGNEAKDVAGVKLAARVVEGLPAKDLKPMADELKKQVGSGVVVLI 816

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGN 883
             S E KAS++I VT+DL    +AVDL R+ A+ LGG GGGGRP MAQ+GGP+ +
Sbjct: 817 A-SNEGKASIVIGVTDDLTGSLSAVDLVRVGAEALGGKGGGGRPDMAQAGGPDAS 870


>gi|225852697|ref|YP_002732930.1| alanyl-tRNA synthetase [Brucella melitensis ATCC 23457]
 gi|256263812|ref|ZP_05466344.1| alanyl-tRNA synthetase [Brucella melitensis bv. 2 str. 63/9]
 gi|225641062|gb|ACO00976.1| alanyl-tRNA synthetase [Brucella melitensis ATCC 23457]
 gi|263093940|gb|EEZ17874.1| alanyl-tRNA synthetase [Brucella melitensis bv. 2 str. 63/9]
 gi|326409221|gb|ADZ66286.1| alanyl-tRNA synthetase [Brucella melitensis M28]
 gi|326538929|gb|ADZ87144.1| alanyl-tRNA synthetase [Brucella melitensis M5-90]
          Length = 885

 Score =  916 bits (2367), Expect = 0.0,   Method: Composition-based stats.
 Identities = 475/893 (53%), Positives = 623/893 (69%), Gaps = 36/893 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M+ V+ IR+TFL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG E   Y  
Sbjct: 1   MAGVNEIRSTFLDYFRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRSYNR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE AI  AW+L+T+EF L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEDAISFAWNLITREFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + +L +TVY  D++A   WKKI+GLS D+IIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 121 PKGKLLVTVYHTDDDAANFWKKIAGLSDDRIIRIPTSDNFWAMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R+IEIWNLVFMQFEQQ  + R  LP+ SIDTGMGLER+A VLQ 
Sbjct: 181 DHIWGGPPGSPEEDGDRFIEIWNLVFMQFEQQTPELRIDLPRPSIDTGMGLERIAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NYDIDLFK LI+ASE+ TG+K EG+   +HRVI DHLR+SSFLIADG+LP+NEGRGY
Sbjct: 241 VHDNYDIDLFKALIRASEEATGVKAEGDFRASHRVIADHLRASSFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  LLPAL  EMG AYPELI+A+ LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAKEPLMWRLLPALIREMGQAYPELIRAESLISETLKLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL     +L + + L+G+ AFKLYDT+G PLD+ QD L  RG   +D   FN
Sbjct: 361 KTLERGLGLLSDASENLAEGDRLDGETAFKLYDTYGFPLDLTQDALRQRG-IAVDTEGFN 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E Q++ ARA+  G G   TE IWF +K+K GAT+F+GY+                  
Sbjct: 420 VAMERQKAEARANWTGSGEAATETIWFGIKDKVGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     ++ ++V+ G  V     G+ + VV +QTPFY E+GGQ GDTG   G+G 
Sbjct: 462 -----TESAEGVIASLVRDGVEVPSVREGETISVVVNQTPFYGESGGQQGDTGTISGEGF 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
            + + D QKK EG+FVH   V  G  +    + L +D   R ++  NHSATHLLH AL  
Sbjct: 517 VIAVKDTQKKGEGVFVHIGEVTEGTAKAGDVVELKVDSARRTRIRSNHSATHLLHEALRE 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
            LG+HV+Q GS + PD LRFD +H KPI++ EL+++E+  N+II QN PV TR+M  +DA
Sbjct: 577 TLGTHVAQKGSLVAPDRLRFDFSHPKPISAEELEAVENLANEIILQNAPVTTRLMAVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSV-----EYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+       + G  +S  LCGGTHV  TG+I L+ I+SE 
Sbjct: 637 IAEGAMALFGEKYGDEVRVVSMGTAKHGSKAGKAYSVELCGGTHVRQTGDIGLVRIISEG 696

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
            + AG+RR+EA+TG+ AR +L  QDE++K++AS LK +  +V+ RV  + +E +KL+   
Sbjct: 697 GVAAGVRRLEALTGEAARLYLEEQDERVKAIASALKTTSADVLDRVNALIDERKKLEREL 756

Query: 775 AKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
           A  + +L +         +   +  VNF+  I++ V  ++LK + D  +K++ SG+++ +
Sbjct: 757 ADARKKLALGGGSSDGGSAVEAVNGVNFLGKIVTGVSPRDLKPLADEGKKQVGSGVVLFI 816

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPN 881
           G+ ++ KAS +  VTED++ RF+AVDL R ++  LGG GGGGRP MAQ+GGP+
Sbjct: 817 GVGEDGKASAVAAVTEDMVGRFSAVDLVRAASAALGGAGGGGRPDMAQAGGPD 869


>gi|95928611|ref|ZP_01311358.1| alanyl-tRNA synthetase [Desulfuromonas acetoxidans DSM 684]
 gi|95135401|gb|EAT17053.1| alanyl-tRNA synthetase [Desulfuromonas acetoxidans DSM 684]
          Length = 880

 Score =  916 bits (2367), Expect = 0.0,   Method: Composition-based stats.
 Identities = 370/909 (40%), Positives = 547/909 (60%), Gaps = 42/909 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   + IR  F+++F+K+GH  +PSSSLIP NDPTL+FTN+GM  FK++F G E   Y+ 
Sbjct: 1   MLTANEIRARFIQYFEKHGHRAVPSSSLIPHNDPTLLFTNAGMNQFKDLFLGAETRDYKR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            T+ QKCVRAGGKHNDL+NVGRT RHHTFFEMLGNFSFG YFK+ AI+  W+ LTKE  L
Sbjct: 61  ATSAQKCVRAGGKHNDLENVGRTARHHTFFEMLGNFSFGDYFKQDAIRFGWEFLTKEMKL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
               L+++V+++D+EAF +W+   G+  ++I+R+   DNFW+M +TGPCGPCSEI  DQG
Sbjct: 121 PVEDLWVSVFEDDDEAFNIWRDEIGVREERILRLGEKDNFWAMGDTGPCGPCSEIHIDQG 180

Query: 181 ECIPGGLP--GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQ 238
           E +  G        + +R++E+WNLVFMQ+E+        LPK SIDTGMGLER+  V+Q
Sbjct: 181 EEMTCGPDCALGVCDCDRFLELWNLVFMQYERSADGTLSPLPKPSIDTGMGLERITAVVQ 240

Query: 239 EKTNNYDIDLFKHLIQASEQVTGMKYEGNN--IVNHRVIVDHLRSSSFLIADGILPANEG 296
              +NYD D  + +I   EQ+ G  Y  N    V+ RVI DH R+++FLIADG+LP+NEG
Sbjct: 241 GVKSNYDTDSLRAIIAHIEQLAGKTYGDNEDADVSMRVIADHSRATAFLIADGVLPSNEG 300

Query: 297 RGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDE 356
           RGYVLRRIMRRA  +A++LG+ EP++      +   M  AYPEL +    + + +++E+E
Sbjct: 301 RGYVLRRIMRRAARHAKMLGFDEPVLFKTATFVMESMKDAYPELEERLDYVAKVVKNEEE 360

Query: 357 RFGKTLDRGLVLLDGVLSHLGK--DEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGID 414
           RF +TL  GL +L+  +  L      ++ GD  F+LYDT G P+D+  DI+       +D
Sbjct: 361 RFIQTLGNGLRILNEEIDTLKSKGQTVIPGDTVFRLYDTFGFPVDLTADIV-EGQNFTLD 419

Query: 415 IISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRK 474
              F   +E+QR +AR +  G G      ++  L E+  + +F GYD             
Sbjct: 420 EAGFETCMEQQRQKARENWKGSGEEGIGAVYKQLAEQGMSCEFTGYD------------- 466

Query: 475 VLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCA 534
                            V A+++ G+ VE   +G+ VE++   TPFY E+GGQ GD G  
Sbjct: 467 ----------KCDDFGTVLALLKDGQQVESVSAGETVEIITSITPFYGESGGQSGDGGTL 516

Query: 535 IGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLH 594
             +G++  I++  K    + VH A ++ G L    +  L +D + R   ++NHSATH+L 
Sbjct: 517 TAEGVKATISETLKPLPNLHVHVATIDEGTLSVGQAAELHVDVEQRTACALNHSATHILQ 576

Query: 595 HALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIM 654
             L  +LG HV Q GS +TPD LRFD  H   +T  E++ +E+ VN  I +N  V+T +M
Sbjct: 577 AVLCEVLGDHVKQAGSQVTPDRLRFDFIHFSALTPEEIQQVEEKVNQRIRENAGVMTDVM 636

Query: 655 NREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           N +DA+ +GA AL G KY D VRVV +     G  S  LCGGTHVS+TG I L  IV E+
Sbjct: 637 NTDDAVKAGATALFGEKYGDSVRVVRM-----GDFSMELCGGTHVSATGNIGLFKIVQEA 691

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
            I AG+RRIEA+TG  A S +  Q++ +  LA+ +K     +  R++++ E  ++L+   
Sbjct: 692 GIAAGVRRIEAVTGSGALSTVREQEQMIGDLAALVKSDPSQLATRLKKLMEHQKELERQV 751

Query: 775 AKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVG 829
           +  + +L+ +           I +V  ++  I  +D K+L+   D L+ ++QSG+I+L G
Sbjct: 752 STLEDRLSADRAGNLMDQVQTIDNVKLLAVRIDNLDGKQLREQADKLRDQLQSGVIVLGG 811

Query: 830 ISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAI 889
           +  + K ++L+ VT+DL +   A +L +  A+++ GG GGGRP +AQ+GG    + + A+
Sbjct: 812 V-NDGKVALLVSVTKDLTNTLKAGNLIKPLAEMV-GGRGGGRPDLAQAGGSQPEQLNNAL 869

Query: 890 AGVASFLKK 898
              A  + +
Sbjct: 870 EAAAGIVGE 878


>gi|209519489|ref|ZP_03268284.1| alanyl-tRNA synthetase [Burkholderia sp. H160]
 gi|209500090|gb|EEA00151.1| alanyl-tRNA synthetase [Burkholderia sp. H160]
          Length = 874

 Score =  916 bits (2366), Expect = 0.0,   Method: Composition-based stats.
 Identities = 378/911 (41%), Positives = 539/911 (59%), Gaps = 55/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAESRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTGVYQLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           + +L++TVY ED+EA  +W K  G+  ++IIRI  N       DNFW MA+TGPCGPCSE
Sbjct: 121 KDKLWVTVYQEDDEAHDIWAKEVGVPVERIIRIGDNKGARYASDNFWQMADTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTPLPKQCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LIQA+ + TG+   GNN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQALIQAAGRETGVTDLGNN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG        L+  L  +MG AYPEL QA+  + + L  
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGKKGSFFHRLVADLVAQMGEAYPELAQAEQRVTDVLYQ 358

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKD--EILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+  L+ L     + L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIENGMSILEAALADLDAKGGKTLDGELAFKLHDTYGFPLDLTADVCRERGVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F++A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDEAMARQREQARAAGKFKMAQG-------LEYSGAKTTFHGYEEIVFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+   G  V++  +GQ+  VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVDGASVQQVQAGQQAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G L+    +   ID   R + + NHSATH
Sbjct: 509 GVLANASTRFAVVDTLKVQADVVGHHGTLEQGTLKVGDIVKAEIDAMRRARTARNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD  H+ P+T  +++ +E+ VN  +  N P + 
Sbjct: 569 LMHKALREVLGSHVQQKGSLVDADKTRFDFAHNAPMTDEQIRRVEEIVNAEVLANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M+ +DA+  GA AL G KY D VRV+ +        S  LCGGTHV+ +G+I    IV
Sbjct: 629 RVMSYDDAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVNRSGDIGFFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
            E  + AGIRR+EAITG  A  ++   + ++ + A+ LK     +  R+ ++ ++ + L+
Sbjct: 683 MEGGVAAGIRRVEAITGDNAVRYVQELEGRVNAAAAVLKAQPAELTQRIGQVQDQVKALE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
              +  K ++             +I  V+ ++  +   D K L+  +D L+ K++S  I+
Sbjct: 743 KELSALKSKMASSQGDELAGQAVEIGGVHVLAATLEGADVKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  + +  K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG    +  
Sbjct: 803 LASV-EGGKVSLIAGVTADASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPAQLP 860

Query: 887 QAIAGVASFLK 897
            A+AGV ++++
Sbjct: 861 AALAGVKAWVE 871


>gi|114562241|ref|YP_749754.1| alanyl-tRNA synthetase [Shewanella frigidimarina NCIMB 400]
 gi|122300463|sp|Q085Z9|SYA_SHEFN RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|114333534|gb|ABI70916.1| alanyl-tRNA synthetase [Shewanella frigidimarina NCIMB 400]
          Length = 874

 Score =  916 bits (2366), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/909 (42%), Positives = 544/909 (59%), Gaps = 54/909 (5%)

Query: 3   NVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVT 62
             + +R+ FL++F+ NGH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   T
Sbjct: 4   TTAELRSAFLKYFEDNGHQVVDSSSLVPTNDPTLLFTNAGMNQFKDVFLGMDKRNYTRAT 63

Query: 63  TVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQ 122
           T Q+CVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE AI+ AW  LT+   L +
Sbjct: 64  TSQRCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEDAIRFAWTFLTETLKLPK 123

Query: 123 RRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSEI 175
            RL +T+Y+ D+EA+ LW +  G+ A+ +IRI  N       DNFW M +TGPCGPCSEI
Sbjct: 124 ERLCVTIYETDDEAYDLWTQKIGVPAENMIRIGDNKGGAFASDNFWQMGDTGPCGPCSEI 183

Query: 176 FFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMA 234
           F+D G+ I GG P    E+G+R+IEIWN+VFMQ+ +Q   E   LPK S+DTGMG+ER+A
Sbjct: 184 FYDHGDHIWGGRPGTPEEDGDRFIEIWNIVFMQYNRQADGEMLPLPKPSVDTGMGIERIA 243

Query: 235 TVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPAN 294
            ++Q   +NY+ID+FK LI  + ++ G+        + RVI DH+RS +FLIADG++P+N
Sbjct: 244 AIMQGVHSNYEIDIFKQLIAKTAEIIGVTD--LENKSLRVIADHIRSCAFLIADGVMPSN 301

Query: 295 EGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSE 354
           EGRGYVLRRI+RRA+ +   LG  +     L+P L + MG A   L Q + ++E+ L++E
Sbjct: 302 EGRGYVLRRIIRRAVRHGNKLGANDAFFYKLVPTLISVMGDAAIGLKQTQAIVEKALKAE 361

Query: 355 DERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGID 414
           +E+F +TL+RGLV+LDG L+ L   + L+GD  FKLYDT+G P+D+  D+   R    +D
Sbjct: 362 EEQFARTLERGLVILDGALNSLQ-GDTLDGDTLFKLYDTYGFPVDLTADVCRERD-INVD 419

Query: 415 IISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRK 474
              F  A+ EQRSRA+A       G     + S       T F GY  L G         
Sbjct: 420 EAGFESAMAEQRSRAQAA------GNFGADYNSQLIIDAETAFSGYTELTGQPN------ 467

Query: 475 VLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCA 534
                            V A+   G+ V+   +GQ   VV D TPFYAE+GGQ+GD G  
Sbjct: 468 -----------------VIALYVDGKAVDTVKAGQDAVVVLDNTPFYAESGGQVGDKGLL 510

Query: 535 IGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLH 594
             DG+   + D QK           + +G L     L   +D + R +  +NHS THLLH
Sbjct: 511 TADGVVFTVADTQKFGPATGHQ-GQLAQGQLVIGQQLTAQVDKKLRHRTQLNHSVTHLLH 569

Query: 595 HALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIM 654
            AL  +LGSHVSQ GS + P+ LRFD  H + +  +ELK++ED VN  I +N  + T  M
Sbjct: 570 AALRQVLGSHVSQKGSLVNPERLRFDFAHFEAVKPSELKAVEDLVNTQIRRNHELCTAEM 629

Query: 655 NREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
             ++A   GA AL G KY+D+VRVV++     G  S  LCGGTHV  TG+I L  I SE+
Sbjct: 630 AIDEAKEKGAMALFGEKYDDQVRVVTM-----GDFSIELCGGTHVGRTGDIGLFKITSEN 684

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
            I AG+RRIEA+TG  A +++  Q   L   A  LK    +VV +++   ++ ++L+   
Sbjct: 685 GIAAGVRRIEAVTGIAAMAYIAEQQAMLDEAAQLLKSDSASVVVKLKAQLDKVKQLEKDL 744

Query: 775 AKRKLQLNVEDLSCH-----KIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVG 829
           ++ K +L     +       +I  V  +   +  +D   L+ + D L++K++S II+L G
Sbjct: 745 SQLKDKLAAAASADMAGDAVEINGVKLLVKQLDGIDPGSLRGLQDELKQKLKSAIIVL-G 803

Query: 830 ISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAI 889
            +K+ K +++  V+ DL  +  A +L  + A+ + GG GGGRP MAQ+GG        A+
Sbjct: 804 TAKDGKVNLIAGVSNDLTKKVKAGELVAMVAQHV-GGKGGGRPDMAQAGGTQPENLAAAL 862

Query: 890 AGVASFLKK 898
           A V  ++ +
Sbjct: 863 ALVEPWVNE 871


>gi|149915205|ref|ZP_01903733.1| alanyl-tRNA synthetase [Roseobacter sp. AzwK-3b]
 gi|149810926|gb|EDM70765.1| alanyl-tRNA synthetase [Roseobacter sp. AzwK-3b]
          Length = 887

 Score =  916 bits (2366), Expect = 0.0,   Method: Composition-based stats.
 Identities = 445/912 (48%), Positives = 592/912 (64%), Gaps = 41/912 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M  ++ IR+TFL FF+KN H+++ SS L+P NDPTLMFTNSGMV FKN+FTG E   Y  
Sbjct: 1   MPTLNDIRSTFLNFFEKNDHQIVDSSPLVPRNDPTLMFTNSGMVQFKNLFTGVEHRDYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             T QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE+AI  AWDLLTK+F +
Sbjct: 61  AATSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEQAIPYAWDLLTKDFGI 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
           D+ +L +TVY  D+EA  +WKK +GL  ++IIRI T+DNFWSM  TGPCGPC+EIF+D G
Sbjct: 121 DKSKLLVTVYHTDDEAADIWKKYAGLPEERIIRIATDDNFWSMGATGPCGPCTEIFYDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
             I GG PGS  E+G+R+IEIWNLVFMQ E+     +  L   SIDTGMGLER+  +LQ 
Sbjct: 181 PHIWGGPPGSPEEDGDRFIEIWNLVFMQNERFEDGTQRDLDMQSIDTGMGLERIGALLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           K +NYD DL + LI+AS  +T    +G   V+HRVI DHLRS+SFLIADG++P+NEGRGY
Sbjct: 241 KHDNYDTDLLRALIEASANITDGAPDGPGNVHHRVIADHLRSTSFLIADGVMPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A  LG  +P+M  L+P+L T+MG AYPEL +A+ LIEETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAHQLGAADPVMHRLVPSLVTQMGQAYPELGRAQALIEETLKLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           +TLDRGL LLD  L  L  D  L G+ AFKLYDT G PLD+ QD L  +G + +D+  F+
Sbjct: 361 QTLDRGLRLLDDELDKLASDAPLPGEAAFKLYDTFGFPLDLTQDALREKGRS-VDVAGFD 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
           +A+ EQ+++ARA   G G      IW+ + E  G T F+GYD                  
Sbjct: 420 EAMSEQKAKARAAWSGSGEAADATIWYDIAEDKGTTDFLGYD------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T      + A+V+ G+ +E A  G++V++V +QTPFYAE+GGQ+GDTG    +G 
Sbjct: 462 -----TERAEGQIMALVRDGQRIEAASQGEEVQIVLNQTPFYAESGGQVGDTGVVRTEGG 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
             +ITD  +K  G+F+H A V  G +    +  L +D+  R  +  NHSA HLLH AL  
Sbjct: 517 AARITDT-RKVAGVFLHVAEVTEGRIVAGEAAQLEVDHTRRTAIRANHSAMHLLHEALRE 575

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
            LG HV+Q GS   PD LRFD +H+K +++ EL+ +E +VN  I QN  V TRIM  +DA
Sbjct: 576 ALGDHVAQRGSLNAPDRLRFDFSHAKALSAEELERVEADVNGFIRQNASVDTRIMTPDDA 635

Query: 660 IASGAAALLGTKYNDRVRVVSVE-------YEDGGVHSSALCGGTHVSSTGEIMLLYIVS 712
            A GA AL G KY D VRVVS+          DG  +S  LCGGTHV  TG+I +  +  
Sbjct: 636 RALGAQALFGEKYGDEVRVVSMGKLDGSGKGSDGRTYSIELCGGTHVRQTGDIGVFVVTG 695

Query: 713 ESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQL 772
           + +  AG+RRIEA+TG+ AR +L  Q  ++ +LA+ LK    +VV RV+ + +E ++L  
Sbjct: 696 DQASSAGVRRIEALTGEAARQYLSAQAHRVDALAAELKARPDDVVTRVKALMDERKQLAN 755

Query: 773 IHAKRKLQLNVEDLSCH-------KIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
             A+ + +L +   +         +I  V F++ ++  V  K+L +++D  + ++ SG +
Sbjct: 756 EVAQLRRELAMAGGAGQGDGPEMREIGGVPFLAQVLRGVSGKDLPAIIDEHKARMGSGAV 815

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +L+    + KA+V   VT+DL  R +AVDL R +  VLGG GGGGRP MAQ GGP+   A
Sbjct: 816 LLIA-DADGKAAVAAGVTQDLTGRVSAVDLVRAAVPVLGGKGGGGRPDMAQGGGPDAGNA 874

Query: 886 DQAIAGVASFLK 897
           + AI      L+
Sbjct: 875 EAAIKAAEQILE 886


>gi|118588631|ref|ZP_01546039.1| Alanyl-tRNA synthetase, class IIc:Phosphoesterase,
           DHHA1:Alanyl-transfer RNA synthetase [Stappia aggregata
           IAM 12614]
 gi|118438617|gb|EAV45250.1| Alanyl-tRNA synthetase, class IIc:Phosphoesterase,
           DHHA1:Alanyl-transfer RNA synthetase [Stappia aggregata
           IAM 12614]
          Length = 885

 Score =  915 bits (2365), Expect = 0.0,   Method: Composition-based stats.
 Identities = 466/907 (51%), Positives = 629/907 (69%), Gaps = 36/907 (3%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M+ V+ IR+ FL++F+ NGHE++ S  L+P NDPTLMF N+GM  FKN+FTG EK  Y  
Sbjct: 1   MTGVNEIRSAFLDYFKTNGHEVVESGPLVPRNDPTLMFANAGMNQFKNVFTGLEKRDYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             T QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK+RAI+LAW+L+TKEF L
Sbjct: 61  AVTAQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKDRAIELAWNLVTKEFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + +L +TV+ ED++AF LWKKI+GLS D+IIRI T+DNFWSM +TGPCGPCSEIF+D G
Sbjct: 121 PKEKLLVTVFAEDDQAFDLWKKIAGLSEDRIIRIPTSDNFWSMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R+IEIWNLVFMQ+EQ  ++ R  LP+ SIDTGMG+ER+A V+Q 
Sbjct: 181 DHIWGGPPGSPEEDGDRFIEIWNLVFMQYEQTPEK-RLDLPRPSIDTGMGIERIAAVMQG 239

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             NNYDIDLFK LI AS   TG++ EG+   +HRVI DHLRS+SFLIADG+LP+NEGRGY
Sbjct: 240 VHNNYDIDLFKALIAASVNATGVEAEGDATGSHRVIADHLRSTSFLIADGVLPSNEGRGY 299

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRR M +A LLG +EPLM  L+PAL  EMG AYPEL +A+ LI ETL+ E+ RF 
Sbjct: 300 VLRRIMRRGMRHAHLLGASEPLMHKLVPALVREMGRAYPELSRAEDLITETLKLEETRFR 359

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LLD     L     L+G+ AFKLYDT+G PLD+ QD L       +D   FN
Sbjct: 360 KTLERGLGLLDTATEGLEAGGRLDGETAFKLYDTYGFPLDLTQDALR-TRDISVDTDGFN 418

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E Q++ ARA   G GS  TE +WF+LKEK+GAT F+GY+                  
Sbjct: 419 AAMERQKAEARAAWSGSGSAATEAVWFALKEKHGATDFLGYE------------------ 460

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +V  +    + V++  +G+   VV +QTPFY E+GGQ+GDTG  +  G+
Sbjct: 461 -----TETAEGVVAGLAADDKEVDKLSAGESGFVVLNQTPFYGESGGQVGDTGWMLASGV 515

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           +  +T+ QKKA+G+FVH   VE G L   ++L L +D+  R+ +  NHSATHL+H AL  
Sbjct: 516 KAAVTNTQKKADGLFVHSVTVEEGELVPGLALELKVDHSRRKAIRSNHSATHLVHEALRE 575

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG+HV+Q GS +TP+ LRFD +H KP++  EL ++E   N+I+ QN PV TR+M  +DA
Sbjct: 576 VLGNHVAQKGSLVTPERLRFDFSHPKPVSDEELATVESFANEIVLQNAPVDTRLMAVDDA 635

Query: 660 IASGAAALLGTKYNDRVRVVSV-----EYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           I +GA AL G KY + VRVVS+       + G  +S  LCGGTHV  TG+I L+ +VSE 
Sbjct: 636 IEAGAMALFGEKYGEEVRVVSMGTALHGPKQGKPYSLELCGGTHVKRTGDIGLVTLVSEG 695

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
           ++ AG+RRIEA+TG  AR +L  QD++++ LAS LK+S  +V  RV ++ E+ +KL+   
Sbjct: 696 AVAAGVRRIEALTGSEAREYLDAQDKRMRELASLLKISADDVPARVAQLVEDRKKLEREL 755

Query: 775 AKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVG 829
           A  K +L +   +       +      M+ ++  ++ K+LK + D  + ++ SG+++L+ 
Sbjct: 756 ADAKKKLAMGGGADGGTPVKEAGSFKLMARVVEGINPKDLKGMADEAKTQLGSGVVVLIS 815

Query: 830 ISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAI 889
           ++++ KA+++  VT+DL D+ +AVDL R+ ++ LGG GGGGRP MAQ+GGP+G KA QA+
Sbjct: 816 VAEDDKAAIVTAVTQDLTDKVSAVDLVRIGSEALGGRGGGGRPDMAQAGGPDGAKAAQAV 875

Query: 890 AGVASFL 896
           A + + L
Sbjct: 876 AVIEAHL 882


>gi|304310760|ref|YP_003810358.1| Alanyl-tRNA synthetase [gamma proteobacterium HdN1]
 gi|301796493|emb|CBL44701.1| Alanyl-tRNA synthetase [gamma proteobacterium HdN1]
          Length = 876

 Score =  915 bits (2365), Expect = 0.0,   Method: Composition-based stats.
 Identities = 388/910 (42%), Positives = 549/910 (60%), Gaps = 54/910 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              S IR  FL++F  NGH+++PSSSLIP NDPTL+FTN+GMV FK++F G++   Y+  
Sbjct: 1   MKTSEIRKAFLDYFAVNGHQIVPSSSLIPGNDPTLLFTNAGMVQFKDVFLGRDARDYRRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW+ LT  +   
Sbjct: 61  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKPDAIRFAWEFLTGERWLK 120

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY  D+EA+ +W +  G+  D+++RI  N       DNFW M +TGPCGPC
Sbjct: 121 LPKEKLWVTVYATDDEAYDIWTQQVGVPVDRVVRIGDNKGAPYASDNFWQMGDTGPCGPC 180

Query: 173 SEIFFDQGECIPGGLPGS-SEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D GE I GG PGS  E+G+RYIEIWN+VFMQF++        LPK S+DTGMGLE
Sbjct: 181 TEIFYDHGEEIFGGPPGSKDEDGDRYIEIWNIVFMQFDRHPDGTLNPLPKPSVDTGMGLE 240

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NY+IDLF HL+ A  +VTG K       + RV+ DH+R+ +FLIADG++
Sbjct: 241 RIAAVLQHVHSNYEIDLFAHLLDAVAKVTGAKD--LQDKSLRVVADHIRACAFLIADGVV 298

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NEGRGYVLRRIMRRA+ +   LG  EP    L+ AL  EMG AYPEL + +  IE+T+
Sbjct: 299 PSNEGRGYVLRRIMRRAIRHGNKLGAQEPFFYKLVAALAAEMGDAYPELRKLQAQIEKTI 358

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
             E+E+F +TLD+GL +L+  L+   +   + GD+ FKLYDT+G P D+  DI   R L+
Sbjct: 359 LQEEEQFARTLDQGLRILEQELT-AHQLTEIPGDLVFKLYDTYGFPADLTADIARERDLS 417

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D+  F Q +  Q+ R++  S   G+      +    +    T F GY    G      
Sbjct: 418 -LDMGGFEQRMAAQKERSQKSSQFAGN------YHDALDISTQTVFSGYSDTSG------ 464

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V+A+  QG+ V    +GQ   VV DQTPFYAE+GGQ+GD 
Sbjct: 465 -----------------QAKVEALFFQGKPVSSVSAGQDAIVVLDQTPFYAESGGQVGDV 507

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G     G   ++ D  K+     +HH ++  G +     +   ++ + R+ + +NHSATH
Sbjct: 508 GLIRKAGACFEVADTHKQGG-AHLHHGVLVSGQISVGDVVEAEVNAELRQAIRLNHSATH 566

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV Q GS +T   LRFD ++   ++ AEL+ IE  VND +  N  ++T
Sbjct: 567 LLHAALRQVLGEHVHQKGSMVTAGRLRFDFSNPSALSPAELEQIERIVNDQVRGNSEIIT 626

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM  + A A GA AL G KY D VRV+++        S  LCGGTH   TG+I L  ++
Sbjct: 627 EIMPIDQARAKGAMALFGEKYEDEVRVLTMGT---DCFSVELCGGTHARRTGDIGLFQLI 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SE  + AG+RRIEA+TG  A + +  + ++L +++S +K +  NVVG+V  + E  R+L+
Sbjct: 684 SEGGVAAGVRRIEAVTGAAALALITNRHQQLVAISSAVKGNDENVVGKVTALVERVRQLE 743

Query: 772 LIHAKRKLQLNV---EDLSCH--KIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               K+  Q      E++     ++A V  ++ ++   D+K L+ + D L+ K+   I++
Sbjct: 744 KELEKQSAQRASRAGEEIISQSFELAGVKVLAAVLENQDTKALREMCDKLRDKLGDAIVV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L G S+E K +++  V++ L  +  A DL    A  + GG GGGRP MA +GG       
Sbjct: 804 L-GASQEGKVNLVAGVSKTLSSKVKAGDLVNHVASQV-GGKGGGRPDMATAGGSQPENLG 861

Query: 887 QAIAGVASFL 896
            AIA V  +L
Sbjct: 862 LAIASVRDWL 871


>gi|283786756|ref|YP_003366621.1| alanyl-tRNA synthetase [Citrobacter rodentium ICC168]
 gi|282950210|emb|CBG89846.1| alanyl-tRNA synthetase [Citrobacter rodentium ICC168]
          Length = 875

 Score =  915 bits (2364), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/910 (43%), Positives = 564/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT    F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQYAWELLTGENWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+   +IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYETDDEAYEIWEKEVGIPRARIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ + GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHVWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LI A  +VTG      +  + RVI DH+RS +FL+ADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIDAVAKVTGATD--LSNKSLRVIADHIRSCAFLVADGVV 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  EL + + L+E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKEAFFYKLVGPLIEVMGSAGEELKRQQALVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLT-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++     A++F GY+ L        
Sbjct: 420 -VDEAGFEAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYEHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ VE   +GQ+  VV DQTPFYAE+GGQ+GDT
Sbjct: 466 ----------------LNGKVTALFVDGKAVEAINAGQQAVVVLDQTPFYAESGGQVGDT 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G G    ++D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGAGFTFAVSDTQKYG-QAIGHIGTLSAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV+Q GS +    LRFD +H++ +  +E++++ED VN  I +NLPV T
Sbjct: 569 LMHAALRQVLGTHVAQKGSLVNDKLLRFDFSHNEAMKPSEIRAVEDLVNAQIRRNLPVET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            +M+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NVMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +  Q ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAMATVHAQSDRLNEIAHLLKGDSQNLGDKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          I  V  +   ++ V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAVDINGVKLLVSELAGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELVGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V +++
Sbjct: 862 AALASVEAWV 871


>gi|220934463|ref|YP_002513362.1| alanyl-tRNA synthetase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995773|gb|ACL72375.1| alanyl-tRNA synthetase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 865

 Score =  915 bits (2364), Expect = 0.0,   Method: Composition-based stats.
 Identities = 378/903 (41%), Positives = 541/903 (59%), Gaps = 47/903 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + +RT+FLE+F+  GHE++PSS LIP NDPTL+FTN+GMV FK++F G+E+  Y   
Sbjct: 1   MKSADLRTSFLEYFRSKGHEVVPSSPLIPGNDPTLLFTNAGMVQFKDVFLGREQRPYVRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           T+ Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+ LT+   L 
Sbjct: 61  TSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIQYAWEYLTQVLKLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQ-G 180
           + +L++TV++ED+EA  +W K  G++ ++  RI  +DNFWSM +TGPCGPC+EIF+D   
Sbjct: 121 EEKLWVTVFEEDDEAADIWLKDVGVNPERFSRIGASDNFWSMGDTGPCGPCTEIFYDHGP 180

Query: 181 ECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEK 240
           E   G       +G+RYIEIWNLVFMQ+++        LP+ S+DTGMGLER+A V+Q  
Sbjct: 181 EVPGGPPGTPEADGDRYIEIWNLVFMQYDRAKDGTLTPLPRPSVDTGMGLERLAAVMQGV 240

Query: 241 TNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYV 300
            +NY+IDLF++LI+A   +           + RVI DH+RS SFL+ADG++PANEGRGYV
Sbjct: 241 HSNYEIDLFQNLIRAIRDMAKGAD--PTSPSLRVIADHIRSCSFLVADGVMPANEGRGYV 298

Query: 301 LRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGK 360
           LRRI+RRA  +   LG  EP    L+  L  EMG AYPEL++A+ ++E  LR E+ERF +
Sbjct: 299 LRRIIRRAARHGHKLGLDEPFFHRLVGPLVAEMGEAYPELVKAQPMVERVLRQEEERFAE 358

Query: 361 TLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQ 420
           TL++GL +L+  +  L   EI  G   F LYDT+G P+D+  DI   RGL  +D+  F  
Sbjct: 359 TLEKGLRILEEDIDGLKGTEI-PGKTIFVLYDTYGFPVDLTGDIARERGLT-LDMAGFEA 416

Query: 421 ALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKP 480
            +E QR RARA          +  +    +  G + F GY+ L G               
Sbjct: 417 EMEIQRERARAA------SHFDADYHRKLKIEGESAFTGYEHLDG--------------- 455

Query: 481 PIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIR 540
                      V A+ + GE V+   SG+   VV D+TPFYAE+GGQ+GDTG  + +G+ 
Sbjct: 456 --------QGRVTALFKDGEPVDALASGEHGLVVLDETPFYAESGGQVGDTGELLAEGVI 507

Query: 541 LQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTI 600
            ++TD +K       H   V  G +     L   ++   R+ + +NHSATHL+H AL  I
Sbjct: 508 FEVTDTRKHGA-AHAHMGRVVEGRIAQGDVLGAKVNQARRQAVVLNHSATHLMHAALREI 566

Query: 601 LGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAI 660
           LG HV Q GS + PD LRFD +H +P+++ EL+ IE  VN+ I  N     RIM  + A+
Sbjct: 567 LGDHVQQKGSLVAPDRLRFDFSHFQPVSAEELERIERRVNEAIRANAEAEARIMPIDQAL 626

Query: 661 ASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGI 720
            SGA AL G KY D VRV+S+        S+ LCGGTHV  TG+I +  I+SES + +GI
Sbjct: 627 ESGAMALFGEKYGDEVRVLSMGG-----FSTELCGGTHVRRTGDIGVFKILSESGVASGI 681

Query: 721 RRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQ 780
           RRIEA+TG+ A +++   ++ L  +A  +K  +G++  +V  + E  R+L+      K +
Sbjct: 682 RRIEAVTGENALNYIGETEKNLSRIAEMVKAGRGDLDEKVALLVERSRQLEKELEALKGK 741

Query: 781 LNVE-----DLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKK 835
           L             ++  +  ++  +   D K L+  +D L+ K+    ++L  + K+ K
Sbjct: 742 LASAAGSSLADQAVEVNGIKVLAANLEGADPKSLRDTVDQLKNKLGEAAVVLATV-KDGK 800

Query: 836 ASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASF 895
            S++  VT+    R  A +L    A+ + GG GGGRP MA +GG + +    A+A V  +
Sbjct: 801 VSLVAGVTQGQTARLKAGELVNAVAQQV-GGKGGGRPDMAMAGGTDPSGLPGALASVPDW 859

Query: 896 LKK 898
           +++
Sbjct: 860 VRE 862


>gi|33152493|ref|NP_873846.1| alanyl-tRNA synthetase [Haemophilus ducreyi 35000HP]
 gi|38372509|sp|Q7VLK0|SYA_HAEDU RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|33148716|gb|AAP96235.1| alanyl-tRNA synthetase [Haemophilus ducreyi 35000HP]
          Length = 874

 Score =  915 bits (2364), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/911 (41%), Positives = 543/911 (59%), Gaps = 56/911 (6%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M   S IR +FL+FF   GH ++PSS+L+P NDPTL+FTN+GM  FK++F G EK  Y  
Sbjct: 1   MKTTSEIRQSFLDFFNSKGHTVVPSSALVPENDPTLLFTNAGMNQFKDVFLGLEKRPYTR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEF 118
            TT Q+CVRAGGKHNDL+NVG T RHHTFFEM+GNFSFG YFK  AIQ AW+ LT  K  
Sbjct: 61  ATTAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKHDAIQFAWEFLTSEKWL 120

Query: 119 DLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGP 171
            L + +LY+TVY+ D+EA+ +W K  G+ ++ IIRI  N       DNFW+M +TGPCGP
Sbjct: 121 HLPKEKLYVTVYETDDEAYDIWHKTVGVPSEHIIRIGDNKGVPYASDNFWAMGDTGPCGP 180

Query: 172 CSEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGL 230
           C+EIF+D GE   GGLPG++ E+G+RYIE+WN+VFMQF +Q       LPK S+DTGMGL
Sbjct: 181 CTEIFYDHGESFWGGLPGTAEEDGDRYIEVWNIVFMQFNRQADGTLAKLPKPSVDTGMGL 240

Query: 231 ERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGI 290
           ERM  V+Q   +NY+ D+F+ LI+    +  +     +  + RVI DH+R+ S+LI DG+
Sbjct: 241 ERMTAVMQHVNSNYETDIFQTLIKEVATLLHVAD--LDNKSLRVIADHIRACSYLIVDGV 298

Query: 291 LPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEET 350
           +P+NEGRGYVLRRI+RRA+ +  LLG  E     L+P L   MG A   L   +  I++T
Sbjct: 299 IPSNEGRGYVLRRIIRRAVRHGNLLGAKEAFFYKLVPTLAKVMGQAGEILTDKQSYIQKT 358

Query: 351 LRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGL 410
           L++E+E+F +TL+RGL LL+  L+ +  ++ L+G+VAFKLYDT+G PLD+  D+   R  
Sbjct: 359 LKTEEEQFARTLERGLALLEEALTKVE-NQTLSGEVAFKLYDTYGFPLDLTADVCRERD- 416

Query: 411 AGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMK 470
             ID  SF   +  QR RA++ S           + S+ +    T FIGYD         
Sbjct: 417 IVIDEASFEIEMTAQRERAKSSSNFG------ADYNSVIKVEAETAFIGYDCF------- 463

Query: 471 EDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGD 530
                              + V A+   G+ V++  SG+   VV D+TPFYAE GGQ+GD
Sbjct: 464 ----------------NAEAKVIALFSNGQAVDKVQSGESAVVVLDKTPFYAEMGGQVGD 507

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           +G       +  + D QK    +F H   V  G L     +   +D   R+ ++ NHSAT
Sbjct: 508 SGLITTAFCQFAVADTQKYG-QVFGHIGQVVSGSLAIGDIISAQVDIARRQAITANHSAT 566

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           HLLH AL  +LG HV Q GS ++ + LRFD + S+ ++ A+L+ IE  VN  I QNL V 
Sbjct: 567 HLLHSALRQVLGEHVVQKGSLVSENVLRFDFSQSQAVSKAQLEEIERIVNRQIRQNLAVT 626

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYI 710
              M+ E A   G  AL G KY D VRVV +        S  LCGGTHV  TGEI L  +
Sbjct: 627 IETMDIETAKEKGTVALFGEKYGDVVRVVGMT-----DFSIELCGGTHVKHTGEIGLFKL 681

Query: 711 VSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKL 770
           +SES++ AGIRR+EA+T + A + L  Q + +   A  LK    ++V ++ ++ ++ ++ 
Sbjct: 682 ISESAVAAGIRRVEALTAENAINWLHNQQKIIHQSAELLKTDSLSLVDKIYQLQDKIKRN 741

Query: 771 QLIHAKRKLQLNVE-----DLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGII 825
           +      K +L  +          +I  +N +   +  ++SK L++++D L+ ++ S I+
Sbjct: 742 EKELQHFKDKLAAQAGAELAKQVVQINGINVVIQKLEGIESKSLRTMVDDLKNQLSSVIV 801

Query: 826 MLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKA 885
           +   +S + K ++++ VT+DL ++ NA +L  L A+ + GG GGGRP MA +GG      
Sbjct: 802 VFGSVSAD-KVNLIVGVTKDLSNKVNAGELVGLIAQQV-GGKGGGRPDMAMAGGTEPQHL 859

Query: 886 DQAIAGVASFL 896
           D A+A    ++
Sbjct: 860 DTALAFAKQWI 870


>gi|315122762|ref|YP_004063251.1| alanyl-tRNA synthetase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496164|gb|ADR52763.1| alanyl-tRNA synthetase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 906

 Score =  915 bits (2364), Expect = 0.0,   Method: Composition-based stats.
 Identities = 661/901 (73%), Positives = 776/901 (86%), Gaps = 4/901 (0%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M N+ SIR TFL+FFQK  H++L SSSLIP NDPTLMFTN+GMV FKNIFT QEK  Y+ 
Sbjct: 1   MRNLGSIRKTFLDFFQKREHKILDSSSLIPHNDPTLMFTNAGMVQFKNIFTSQEKRSYKT 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             TVQKCVRAGGKHNDLDNVGRT RHHTFFEMLGNFSFG YFKERAI+LAW+LLTKEFD+
Sbjct: 61  AATVQKCVRAGGKHNDLDNVGRTTRHHTFFEMLGNFSFGDYFKERAIKLAWELLTKEFDI 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
           D RR+ +TVYD DEEAF LWKKISGL ++KIIR+   DNFWSMA+TGPCGPCSEIFFDQG
Sbjct: 121 DCRRIVVTVYDGDEEAFNLWKKISGLPSNKIIRVAGKDNFWSMADTGPCGPCSEIFFDQG 180

Query: 181 ECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEK 240
           E   GGLPGS+E G+RY+EIWNLVFMQFEQ++++ER ILP MSIDTGMGLER++ VLQ K
Sbjct: 181 EGFLGGLPGSAEAGDRYLEIWNLVFMQFEQKSQKERCILPSMSIDTGMGLERISAVLQGK 240

Query: 241 TNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYV 300
           T+NYDIDLFK LIQASEQ+TG+KY+G++I+NHRVIVDHLRSSSFLIADGILP NEGRGYV
Sbjct: 241 TDNYDIDLFKTLIQASEQITGVKYKGDDIINHRVIVDHLRSSSFLIADGILPTNEGRGYV 300

Query: 301 LRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGK 360
           LRRIMRRAMCYARLLGY +PLMM L P LC+EMGSAYPELIQA+LLIEETL+ ED RF K
Sbjct: 301 LRRIMRRAMCYARLLGYEDPLMMRLFPVLCSEMGSAYPELIQAQLLIEETLKVEDMRFSK 360

Query: 361 TLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQ 420
           TLD+G+ LLD V S L K+ IL+G VAFKLYDTHGLPLDIMQDIL ARGL G+D+ SF Q
Sbjct: 361 TLDKGIYLLDEVSSSLEKNAILDGSVAFKLYDTHGLPLDIMQDILWARGLGGVDVASFKQ 420

Query: 421 ALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRK----VL 476
           +LEEQRS+AR+H LGLG   TEKIWFSLKEKYG TQF+GY++  GSK +  D K     L
Sbjct: 421 SLEEQRSKARSHCLGLGEKITEKIWFSLKEKYGTTQFVGYNIHHGSKVIAGDEKKGDYSL 480

Query: 477 CQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIG 536
            QKP +D T G+ +IVKAIV Q  IV+ A +GQKVEV+FDQTPFYAE+GGQ+GDTG A+G
Sbjct: 481 SQKPSVDFTQGIPAIVKAIVLQDSIVDVARAGQKVEVLFDQTPFYAESGGQVGDTGIAVG 540

Query: 537 DGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHA 596
           +G+ LQITDVQKK  GIFVHHA +E G+LRTEM ++LTI+YQ+RRQLSINHSATHLLH A
Sbjct: 541 EGVSLQITDVQKKVGGIFVHHATIEHGVLRTEMPIILTINYQDRRQLSINHSATHLLHAA 600

Query: 597 LSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNR 656
           L TILG HVSQ GS I P+ LRFD+ HSKPIT  E+K I+D++ND+IAQN  ++TRIMN 
Sbjct: 601 LRTILGPHVSQKGSHIIPERLRFDIVHSKPITREEIKLIQDHINDVIAQNYSIITRIMNI 660

Query: 657 EDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSI 716
           +DAIASG++AL G KY+D+VRVVS+E +DG V++S LCGGTHVSSTGEIML++IVSES++
Sbjct: 661 DDAIASGSSALFGKKYSDKVRVVSIESDDGRVYASELCGGTHVSSTGEIMLVHIVSESAV 720

Query: 717 RAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAK 776
            AGIRRIEA++GQRARS+L+ QDEK++SLASFLKV   NVV RVEEIWEE R+L LI+AK
Sbjct: 721 SAGIRRIEAVSGQRARSYLVEQDEKVRSLASFLKVQPSNVVKRVEEIWEERRELHLINAK 780

Query: 777 RKLQLNVEDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKKA 836
            KL+LNV+DLSCH IA+VNFMSH+I + D KELK ++D LQKKI+SGIIML+G+SKEKKA
Sbjct: 781 HKLKLNVDDLSCHTIANVNFMSHVIPDADFKELKGLIDMLQKKIKSGIIMLIGVSKEKKA 840

Query: 837 SVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASFL 896
           SV+I VT+DL+DRFNA++L RL+AKVLGG GGGGRP+MAQSGGP+GNK DQ+IA + SFL
Sbjct: 841 SVVIAVTQDLIDRFNAINLVRLAAKVLGGSGGGGRPNMAQSGGPDGNKVDQSIANIVSFL 900

Query: 897 K 897
           K
Sbjct: 901 K 901


>gi|89075063|ref|ZP_01161504.1| alanyl-tRNA synthetase [Photobacterium sp. SKA34]
 gi|89049150|gb|EAR54715.1| alanyl-tRNA synthetase [Photobacterium sp. SKA34]
          Length = 874

 Score =  915 bits (2364), Expect = 0.0,   Method: Composition-based stats.
 Identities = 380/909 (41%), Positives = 536/909 (58%), Gaps = 55/909 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            +   IR  +L FF+  GH+++ SSSL+P NDPTL+FTN+GM  FK+ F G EK  Y   
Sbjct: 3   MSTDEIRRAYLAFFESKGHQIVESSSLVPANDPTLLFTNAGMNQFKDTFLGLEKRSYTRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+ LT    L 
Sbjct: 63  TTAQRCVRAGGKHNDLENVGFTARHHTFFEMLGNFSFGDYFKHDAIGYAWEFLTSVLKLP 122

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN--------DNFWSMAETGPCGPCS 173
             RL +TVY+ D+EAF +W K  G+ AD+I+RI           DNFW M +TGPCGPC+
Sbjct: 123 ADRLVVTVYETDDEAFDIWNKEIGIPADRIVRIGDKKGGKPFESDNFWQMGDTGPCGPCT 182

Query: 174 EIFFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLER 232
           EIF+D G+ I GG P    E+G+R+IEIWN VFMQF +Q       LPK S+DTGMG+ER
Sbjct: 183 EIFYDHGDHIWGGRPGTPEEDGDRFIEIWNNVFMQFNRQVDGTMEPLPKPSVDTGMGIER 242

Query: 233 MATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILP 292
           +A ++Q   +NY+ID+F+ LI+ + +V G +    +  + RV+ DH+RS ++LI+DG++P
Sbjct: 243 IAAIMQGVHSNYEIDIFQTLIKEAAKVIGFED--LSNQSLRVVADHIRSCAYLISDGVMP 300

Query: 293 ANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLR 352
           +NEGRGYVLRRI+RRA+ +   LG        L+  L   MG+A  EL   + L+E+ L+
Sbjct: 301 SNEGRGYVLRRIIRRAVRHGNKLGAEGAFFYKLVGPLAEIMGTAGEELKAQQELVEKVLK 360

Query: 353 SEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAG 412
            E++ FG+TLDRGL +L+  L  L   ++L+G+  FKLYDT+G P D+  D+   RG   
Sbjct: 361 IEEDNFGRTLDRGLTILNEALDKLD-GKVLDGETVFKLYDTYGFPADLTNDVARERGFT- 418

Query: 413 IDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKED 472
           ID   F  A+EEQR RAR       +G     + +  +    T F GY    G       
Sbjct: 419 IDEDGFEAAMEEQRQRAR------DAGNFGVDYNNAIKVDAETVFCGYSATDG------- 465

Query: 473 RKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTG 532
                            S + A+ + G  V+   +G++  VV   TPFYAE+GGQ GD+G
Sbjct: 466 ----------------ESEIVALYRDGVAVDSVNAGEEALVVLTNTPFYAESGGQCGDSG 509

Query: 533 CAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHL 592
               + +   + D QK       H   V  G L     L  ++D   R  +S+NHSATHL
Sbjct: 510 ILTAEAVLFNVDDTQKFGA-AIGHKGQVAEGSLTVGQKLTASVDSARRAAISLNHSATHL 568

Query: 593 LHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTR 652
           +H AL TILG HVSQ GS +  DGLRFD ++ + +   +L+++E  VND I  N  + T 
Sbjct: 569 MHAALRTILGEHVSQKGSLVKADGLRFDFSNLEAVKPEQLRAVETMVNDQIRANHVIETN 628

Query: 653 IMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVS 712
           IM+ E A A GA AL G KY+D VRV+S+     G  S+ LCGG H + TG+I L  I+S
Sbjct: 629 IMDIEAAKAKGAMALFGEKYDDEVRVLSM-----GEFSTELCGGIHATRTGDIGLFKILS 683

Query: 713 ESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQL 772
           ES I AGIRRIEA+TG  +   +  +D  L   A  +K    +VV +VE +    ++L+ 
Sbjct: 684 ESGIAAGIRRIEAVTGAASIEEMHNEDVMLAKTARLVKSDSASVVSKVEALVSHSKQLEK 743

Query: 773 IHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
              + K +L  ++ +       +I  V  +   ++  D+K L+ ++D L+ ++ SG+++L
Sbjct: 744 EIQQLKDKLAAQEGANLINQAQEINGVKVLIAKLNGADNKALRGMVDELKNQLGSGVVLL 803

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQ 887
             +S + K  ++  VT+DL+ +  A +L  L A+ + GG GGGRP MAQ+GG +      
Sbjct: 804 GNVS-DDKVGLIAGVTKDLVGKVKAGELVNLVAQQV-GGKGGGRPDMAQAGGTDAAALPA 861

Query: 888 AIAGVASFL 896
           A+  VA +L
Sbjct: 862 ALETVAPWL 870


>gi|260460847|ref|ZP_05809097.1| alanyl-tRNA synthetase [Mesorhizobium opportunistum WSM2075]
 gi|259033424|gb|EEW34685.1| alanyl-tRNA synthetase [Mesorhizobium opportunistum WSM2075]
          Length = 888

 Score =  915 bits (2364), Expect = 0.0,   Method: Composition-based stats.
 Identities = 470/910 (51%), Positives = 633/910 (69%), Gaps = 37/910 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+TFL++F++ GHE++ SS L+P NDPTLMFTN+GMV FKN+FTG EK  Y  
Sbjct: 1   MSGVNEIRSTFLDYFRREGHEVVASSPLVPRNDPTLMFTNAGMVQFKNVFTGLEKRPYSR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QK VRAGGKHNDLDNVG T RH TFFEMLGNFSFG YFKERAI+LAW+L+TKEF L
Sbjct: 61  ATTAQKSVRAGGKHNDLDNVGYTARHLTFFEMLGNFSFGDYFKERAIELAWNLITKEFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + +L +TVY  D+EA   WKKI+G S D+IIRI T+DNFW+M +TGPCGPCSEIF D+G
Sbjct: 121 KKDKLLVTVYHTDDEAAGFWKKIAGFSDDRIIRIPTSDNFWAMGDTGPCGPCSEIFIDRG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           E I GG PGS  E+G+R++E WNLVFMQ+EQ  K+ER  LP+ SIDTGMGLERMA++LQ 
Sbjct: 181 EHIWGGPPGSPEEDGDRFLEFWNLVFMQYEQVTKEERIDLPRPSIDTGMGLERMASILQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             + ++ DLF+HLI  +    G   +   + ++RVI DHLRSSSFL+ADG+LP+NEGRGY
Sbjct: 241 VESVFETDLFRHLIDVASSALGRAPDAETVASYRVIADHLRSSSFLVADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  L+PAL  EMG AYPEL++ + LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGANEPLMWKLVPALVREMGQAYPELLRGEQLITETLKLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL RGL LL      L   ++L+G+ AFKLYDT+G PLD+ QD L  +    +D+  F 
Sbjct: 361 KTLVRGLGLLSEATETLTAGDMLDGETAFKLYDTYGFPLDLTQDALR-QRSISVDLAGFT 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E+Q++ AR H  G G   TE +WFS++EK GAT+F+GY+                  
Sbjct: 420 NAMEQQKAEARKHWTGSGEAATETVWFSVREKTGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +V+A+V+ G+ V+ A  G  V VV +QTPFY E+GGQ+GDTG   G+G 
Sbjct: 462 -----TEQAEGLVQALVKDGKTVDSAGKGDAVAVVVNQTPFYGESGGQMGDTGIISGEGF 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
            ++I+D QKKA+G+FVH   V  G ++   ++ L +D+  R +L  NHSATHL+H AL  
Sbjct: 517 SIEISDTQKKADGLFVHLGTVASGTVKVGAAVELKVDHARRSRLRANHSATHLIHEALRE 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG+HV+Q GS + P+ LRFD++H+KPI+  +L+ +E   N+I+ QN PV TR+++ +DA
Sbjct: 577 VLGTHVAQKGSLVAPERLRFDISHNKPISPEDLEEVERMANEIVVQNGPVTTRLISVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSVEYEDGG-----VHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+     G      +S  LCGGTHV +TG+I L+ +VS+S
Sbjct: 637 IAEGAMALFGEKYGDEVRVVSMGTGVHGAKANRPYSVELCGGTHVRATGDIGLVRVVSDS 696

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
           ++ AG+RRIEA+TG+ AR HL  QD +LK+ A+ LK+S  +V  RVE + EE +KL+   
Sbjct: 697 AVAAGVRRIEALTGEAARKHLDEQDRRLKATAAVLKISPADVPARVETLLEERKKLEKEL 756

Query: 775 AKRKLQLNVEDL-------SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
            + + +L +              +A V F+  ++S V  K+LK + DA +  + SG+++ 
Sbjct: 757 TEARKKLALGGGAAAGAPSENETVAGVGFLGKMVSGVSPKDLKPLADAGKTSLGSGVVVF 816

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQ 887
           VG  ++ KASV++ VT+DL+ RF+AVDL R+++  LGG GGGGRP MAQ+GGP+ +KA  
Sbjct: 817 VGAGEDNKASVVVAVTDDLVGRFSAVDLVRVASAALGGQGGGGRPDMAQAGGPDASKAGD 876

Query: 888 AIAGVASFLK 897
           AIA V + L+
Sbjct: 877 AIAAVRAALE 886


>gi|254719259|ref|ZP_05181070.1| alanyl-tRNA synthetase [Brucella sp. 83/13]
 gi|265984258|ref|ZP_06096993.1| alanyl-tRNA synthetase [Brucella sp. 83/13]
 gi|306838009|ref|ZP_07470867.1| alanyl-tRNA synthetase [Brucella sp. NF 2653]
 gi|264662850|gb|EEZ33111.1| alanyl-tRNA synthetase [Brucella sp. 83/13]
 gi|306406933|gb|EFM63154.1| alanyl-tRNA synthetase [Brucella sp. NF 2653]
          Length = 885

 Score =  914 bits (2363), Expect = 0.0,   Method: Composition-based stats.
 Identities = 475/893 (53%), Positives = 622/893 (69%), Gaps = 36/893 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M+ V+ IR+TFL++F+KNGHE++PSS L+P NDPTLMFTN+GMV FKN+FTG E   Y  
Sbjct: 1   MAGVNEIRSTFLDYFRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRSYNR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE AI  AW+L+T+EF L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEDAINFAWNLITREFGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + +L +TVY  D++A   WKKI+GLS D+IIRI T+DNFW+M +TGPCGPCSEIF+D G
Sbjct: 121 PKDKLLVTVYHTDDDAANFWKKIAGLSDDRIIRIPTSDNFWAMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R+IEIWNLVFMQFEQQ  + R  LP+ SIDTGMGLER+A VLQ 
Sbjct: 181 DHIWGGPPGSPEEDGDRFIEIWNLVFMQFEQQTPELRIDLPRPSIDTGMGLERIAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NYDIDLFK LI+ASE+ TG+K EG+   +HRVI DHLR+SSFLIADG+LP+NEGRGY
Sbjct: 241 VHDNYDIDLFKALIRASEEATGVKAEGDFRASHRVIADHLRASSFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A+LLG  EPLM  LLPAL  EMG AYPELI+A+ LI ETL+ E+ RF 
Sbjct: 301 VLRRIMRRAMRHAQLLGAKEPLMWRLLPALIREMGQAYPELIRAEALISETLKLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL LL     +L + + L+G+ AFKLYDT+G PLD+ QD L  RG   +D   FN
Sbjct: 361 KTLERGLGLLSDASENLAEGDRLDGETAFKLYDTYGFPLDLTQDALRQRG-IAVDTEGFN 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A+E Q++ ARA+  G G   TE IWF +K+K GAT+F+GY+                  
Sbjct: 420 AAMERQKAEARANWTGSGEAATETIWFGIKDKVGATEFLGYE------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     ++ ++V+ G  V     G+ + VV +QTPFY E+GGQ GDTG   G+  
Sbjct: 462 -----TESAEGVIASLVRDGVEVPSVREGETISVVVNQTPFYGESGGQQGDTGTISGEDF 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
            + + D QKK EG+FVH   V +G  +    + L +D   R ++  NHSATHLLH AL  
Sbjct: 517 VIAVKDTQKKGEGVFVHIGEVTKGTAKAGDVVELKVDSARRTRIRSNHSATHLLHEALRE 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
            LG+HV+Q GS + PD LRFD +H KPI++ EL+++E+  N+II QN PV TR+M  +DA
Sbjct: 577 TLGTHVAQKGSLVAPDRLRFDFSHPKPISAEELEAVENLANEIILQNAPVTTRLMAVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSV-----EYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           IA GA AL G KY D VRVVS+       + G  +S  LCGGTHV  TG+I L+ IVSE 
Sbjct: 637 IAEGAMALFGEKYGDEVRVVSMGTAKHGSKAGKAYSVELCGGTHVRQTGDIGLVRIVSEG 696

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
            + AG+RR+EA+TG+ AR +L  QDE++K++AS LK +  +V+ RV  + +E +KL+   
Sbjct: 697 GVAAGVRRLEALTGEAARLYLEEQDERVKAIASALKTTSADVLDRVNALIDERKKLEREL 756

Query: 775 AKRKLQLNV------EDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
           A  + +L +         +   +  VNF+  I++ V   +LK + D  +K++ SG+++ +
Sbjct: 757 ADARKKLALGGGSSDGGSAVEAVNGVNFLGKIVTGVLPHDLKPLADEGKKQVGSGVVLFI 816

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPN 881
           G+ ++ KAS +  VTED++ RF+AVDL R ++  LGG GGGGRP MAQ+GGP+
Sbjct: 817 GVGEDGKASAVAAVTEDMVGRFSAVDLVRAASAALGGTGGGGRPDMAQAGGPD 869


>gi|116048827|ref|YP_792373.1| alanyl-tRNA synthetase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|122257933|sp|Q02I63|SYA_PSEAB RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|115584048|gb|ABJ10063.1| alanyl-tRNA synthetase [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 874

 Score =  914 bits (2362), Expect = 0.0,   Method: Composition-based stats.
 Identities = 399/912 (43%), Positives = 552/912 (60%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL FF++ GH  + SSSLIP NDPTL+FTN+GM  FK+ F G EK  Y   
Sbjct: 1   MKSAEIREAFLRFFEEKGHTRVASSSLIPANDPTLLFTNAGMNQFKDCFLGLEKRAYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT QKCVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+ LT  K  +
Sbjct: 61  TTSQKCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWEFLTGEKWLN 120

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY  D+EA+ +W K  G+ A++++RI  N       DNFW+M +TGPCGPC
Sbjct: 121 LPKEKLWVTVYATDDEAYDIWTKEVGVPAERMVRIGDNKGAPYASDNFWAMGDTGPCGPC 180

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIFFD G  I GG PGS  E+G+RYIEIWN VFMQF +        LP  S+DTGMGLE
Sbjct: 181 TEIFFDHGPEIWGGPPGSPEEDGDRYIEIWNNVFMQFNRTADGVMHPLPAPSVDTGMGLE 240

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R++ VLQ   +NY+IDLF++L++AS +  G     ++  + +V+ DH+RS SFLIADG+L
Sbjct: 241 RVSAVLQHVHSNYEIDLFQNLLKASAEAIGCA--NDDAPSLKVVADHIRSCSFLIADGVL 298

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NEGRGYVLRRI+RRA  +   LG        ++ AL  EMG A+PEL Q +  IE  L
Sbjct: 299 PSNEGRGYVLRRIIRRACRHGNKLGARGTFFHKIVAALVAEMGDAFPELKQQQAHIERVL 358

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F KTL++GL +L+  L+ L    ++ G+V FKLYDT+G P+D+  DI   R L 
Sbjct: 359 KTEEEQFAKTLEQGLKILEQDLAELQ-GSVIPGNVVFKLYDTYGFPVDLTNDIARERELT 417

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            ID   F + +E QR RARA S           + SL +  G T+F+GY  + G+     
Sbjct: 418 -IDEDGFEREMEAQRERARASSAFGM------DYNSLVKVDGETRFLGYQGVSGA----- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                               + A+ + G+ VE    G++  VV DQTPFYAE+GGQ+GD+
Sbjct: 466 ------------------GQIVALFRDGQAVERLEEGEEGVVVLDQTPFYAESGGQVGDS 507

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G     G+R  + D  K      +HH +V RG L    ++   +D   R+  ++NHSATH
Sbjct: 508 GYLEAAGVRFDVRDTTKAGG-AHLHHGVVARGNLSVGAAVKAEVDASVRQATALNHSATH 566

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV Q GS +    LRFD +H + I + +LK++ED VN  I +N  V T
Sbjct: 567 LLHAALRQVLGDHVQQKGSLVDSQRLRFDFSHFEAIKAEQLKALEDIVNAEIRRNTEVET 626

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
              + + A A GA AL G KY D+VRV+S+    GG  S  LCGGTHVS TG+I L  I 
Sbjct: 627 EETDIDTAKAKGAMALFGEKYGDQVRVLSM----GGDFSVELCGGTHVSRTGDIGLFKIT 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SE  + AG+RRIEA+TG  A ++L G +E+LK  AS +K S+ N++ ++  + E  R L+
Sbjct: 683 SEGGVAAGVRRIEAVTGAAALAYLNGAEEQLKEAASLVKGSRDNLLDKLGALLERNRSLE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K +           +  +I     ++  +  +D K L +++D L+ K+   +I+
Sbjct: 743 KELEQLKAKAASAAGDDLSAAAVEIKGAKVLAARLDGLDGKALLALVDQLKNKLGRAVIL 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L G   + K  ++  VT+DL  +  A +L + +A  +GG G GGRP MAQ GG N  K D
Sbjct: 803 LGG-ELDGKVVLVAGVTQDLTGQLKAGELMKQAAAAVGGKG-GGRPDMAQGGGTNAAKLD 860

Query: 887 QAIAGVASFLKK 898
           +A+A    F+++
Sbjct: 861 EALALAQRFVEQ 872


>gi|91976212|ref|YP_568871.1| alanyl-tRNA synthetase [Rhodopseudomonas palustris BisB5]
 gi|123735560|sp|Q13AB9|SYA_RHOPS RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|91682668|gb|ABE38970.1| alanyl-tRNA synthetase [Rhodopseudomonas palustris BisB5]
          Length = 891

 Score =  914 bits (2362), Expect = 0.0,   Method: Composition-based stats.
 Identities = 466/901 (51%), Positives = 612/901 (67%), Gaps = 41/901 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           MS V+ IR+ FL +F KNGH+++PSS L+P NDPTLMFTN+GMV FKN+FTG EK  Y  
Sbjct: 1   MSGVNEIRSAFLNYFAKNGHDIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEKRPYHR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            TT QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK+RAI+LAW+L+TKE+ L
Sbjct: 61  ATTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKDRAIELAWNLITKEYGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + RL +TVY ED+EAF LWKKI+GL   KIIRI T+DNFW M +TGPCGPCSEIFFD G
Sbjct: 121 PKDRLLVTVYSEDDEAFGLWKKIAGLPESKIIRIPTSDNFWQMGDTGPCGPCSEIFFDHG 180

Query: 181 ECIPGGLPGS-SEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           + I GG PGS  E+G+R+IEIWNLVFMQFEQ     R  LPK SIDTGMGLER+A VLQ 
Sbjct: 181 DHIFGGPPGSLEEDGDRFIEIWNLVFMQFEQVAPGNRTPLPKPSIDTGMGLERIAAVLQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
           K +NY+IDLF+ LI+A  ++TG   +G    + RVI DHLR++SFLIADG+LP+NEGRGY
Sbjct: 241 KHDNYEIDLFQALIRAIAELTGADPQGEQKGSLRVIADHLRAASFLIADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM + +LLG  EPLM  L+ AL  EMG AYPEL++A+ +IEETLR E+ RF 
Sbjct: 301 VLRRIMRRAMRHGQLLGAREPLMWRLVWALVREMGQAYPELVRAEAMIEETLRLEETRFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTL+RGL +LD     L K ++ +GD AF LYDT+G PLD+ QD L  RG   +DI SF 
Sbjct: 361 KTLERGLTILDEKSGSLKKGDMFDGDTAFTLYDTYGFPLDLTQDALRNRG-ISVDIASFT 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
            A++ QR++ARA   G G   TE +WF L++K GAT+F+GYD                  
Sbjct: 420 DAMDRQRAKARASWAGSGEAATETVWFGLRDKLGATEFLGYD------------------ 461

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                T     +V A+V+ G+ VE   +G    +V +QTPFYAE+GGQ+GDTG   G+G+
Sbjct: 462 -----TETAEGVVTALVKDGKEVEALKAGDAGAIVLNQTPFYAESGGQVGDTGVLTGEGV 516

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           R ++TD  KKA  +FVH   VE G ++ E +L L +D+  R  +  NHSATHLLH AL  
Sbjct: 517 RFRVTDTLKKAGDLFVHFGTVEEGTVKPEAALALEVDHSRRSSIRANHSATHLLHEALRQ 576

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG H++Q GS + PD LRFD  H KPIT  EL+ +ED  NDI+ +N  V TR+M  +DA
Sbjct: 577 VLGDHIAQKGSMVAPDRLRFDFVHQKPITQDELRRVEDIANDIVLENDEVTTRLMAVDDA 636

Query: 660 IASGAAALLGTKYNDRVRVVSVE------YEDGGVHSSALCGGTHVSSTGEIMLLYIVSE 713
             +GA AL G KY D VRVVS+         +    S  LCGGTHV  TG+I L+ +  E
Sbjct: 637 REAGARALFGEKYGDEVRVVSMGKASREHGSNAFGWSVELCGGTHVRRTGDIGLISVTGE 696

Query: 714 SSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLI 773
           S++ +G+RRIEA+TG+ AR          K+ A+ L+ +  ++  R+  + +E +KL+  
Sbjct: 697 SAVASGVRRIEALTGRHARQSANAAMATAKAAAAELRTTLDDMPARIASLMDERKKLERE 756

Query: 774 HAKRKLQLNVEDLS----------CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSG 823
            +  + +L +                 +  V  ++  +  ++ K+LKS++D  +K++ SG
Sbjct: 757 LSDARKKLAMGGSGAAGAADGGADVRDVGGVKLLARAVEGIEIKDLKSLVDQGKKQLGSG 816

Query: 824 IIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGN 883
           +I LV  S++ K S+++ VT DL+ RF+AVDL R +++VLGG GGGG+P MAQ+GGP+G+
Sbjct: 817 VIALVAKSEDGKGSIVVGVTPDLVARFSAVDLVRKASEVLGGKGGGGKPDMAQAGGPDGS 876

Query: 884 K 884
           K
Sbjct: 877 K 877


>gi|237809468|ref|YP_002893908.1| alanyl-tRNA synthetase [Tolumonas auensis DSM 9187]
 gi|237501729|gb|ACQ94322.1| alanyl-tRNA synthetase [Tolumonas auensis DSM 9187]
          Length = 874

 Score =  914 bits (2362), Expect = 0.0,   Method: Composition-based stats.
 Identities = 387/910 (42%), Positives = 541/910 (59%), Gaps = 53/910 (5%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              S IRT FLE+F+  GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +   Y   
Sbjct: 3   MTTSEIRTAFLEYFRSQGHQVVDSSSLVPHNDPTLLFTNAGMNQFKDVFLGGDIRPYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+CVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFK  AI+ AWD LTK   L 
Sbjct: 63  TTAQRCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKHDAIRFAWDFLTKVLQLP 122

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
           Q +L +TVY  D+EA+ +W    G+SAD+I+RI  N       DNFW M +TGPCGPC+E
Sbjct: 123 QEKLLVTVYATDDEAYGIWANEIGVSADRIVRIGDNKGAPYASDNFWQMGDTGPCGPCTE 182

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  I GG PGS  E+G+R+IEIWN+VFMQF +Q       LPK S+DTGMG+ER+
Sbjct: 183 IFYDHGADIWGGPPGSPEEDGDRFIEIWNVVFMQFNRQADGTLEPLPKPSVDTGMGIERV 242

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           + ++Q   +NY+ID+FK LIQ + ++ G+        + RVI DH+RS SFLI+DG++P+
Sbjct: 243 SAIMQGVHSNYEIDIFKTLIQNAAKIVGVTD--LENKSLRVIADHIRSCSFLISDGVMPS 300

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ + R LG T+     L+ AL   MG AYPEL   + ++E  L+ 
Sbjct: 301 NEGRGYVLRRIIRRAVRHGRKLGATDTFFYQLVGALVALMGEAYPELKSQQPVVERVLKL 360

Query: 354 EDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGI 413
           E+E+F +TLDRGL LL+  L  LG    + G V FKLYDT+G P D+  D++  RG   I
Sbjct: 361 EEEQFVRTLDRGLSLLEEELVRLGDVREIPGSVVFKLYDTYGFPADLTADVVRDRGYT-I 419

Query: 414 DIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDR 473
           D  +F Q +E+QR RA+       +      +    +    + F GY+            
Sbjct: 420 DEAAFQQEMEKQRERAK------DASHFAVDYNKQLKIEQTSDFCGYERT---------- 463

Query: 474 KVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGC 533
                          ++ + AI    ++V     G +  +V + TPFYAE+GGQ+GD G 
Sbjct: 464 -------------IANTTITAIYLADQLVSTLKDGDQALIVLENTPFYAESGGQMGDAGL 510

Query: 534 AIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLL 593
                    +TD  K  + I      VE+G  +T  ++   +D   R   +++HSATHLL
Sbjct: 511 LRVGDALFAVTDTHKIGQAIVHK-GFVEQGSFKTGDTVEAIVDNTRRNATALHHSATHLL 569

Query: 594 HHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRI 653
           H AL   LG HV+Q GS + PD LRFD +H + I  A L+ IE +VN  I +N+ + T++
Sbjct: 570 HAALRNALGEHVAQKGSQVGPDRLRFDFSHFEAINPAALRQIEQSVNAEIRKNVLIDTQL 629

Query: 654 MNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSE 713
           M+ +DA  SGA AL G KY D VRVV +     G  S+ LCGGTH   TG+I    I+SE
Sbjct: 630 MSLDDAKTSGAMALFGEKYGDEVRVVKM-----GDFSTELCGGTHAKHTGDIGFFKIISE 684

Query: 714 SSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLI 773
           + + AG+RRIEA+ G+ A +H+    E+L   AS +K    +VV ++ ++ E  R L+  
Sbjct: 685 NGVAAGVRRIEAVAGEAALAHIHQLGEQLDEAASIVKADALSVVSKIRQMQERSRLLERE 744

Query: 774 HAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLV 828
               K +L  +          +I     +   +  VD+K L++ MD L+ ++QS ++ML+
Sbjct: 745 IETLKAKLASQAGNDLLSQIMQINGQQVLVAQVEGVDAKSLRTTMDDLKNRLQS-VVMLL 803

Query: 829 GISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQA 888
               + K S++  VT DL  +  A +L  L A+ + GG GGGRP MAQ+GG +      A
Sbjct: 804 AAVNDGKVSLIAGVTADLTSKVKAGELVNLVAQQV-GGKGGGRPDMAQAGGTDATALPGA 862

Query: 889 IAGVASFLKK 898
           +  V S+L++
Sbjct: 863 LKSVQSWLEE 872


>gi|313105787|ref|ZP_07792050.1| alanyl-tRNA synthetase [Pseudomonas aeruginosa 39016]
 gi|310878552|gb|EFQ37146.1| alanyl-tRNA synthetase [Pseudomonas aeruginosa 39016]
          Length = 874

 Score =  914 bits (2362), Expect = 0.0,   Method: Composition-based stats.
 Identities = 399/912 (43%), Positives = 552/912 (60%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL FF++ GH  + SSSLIP NDPTL+FTN+GM  FK+ F G EK  Y   
Sbjct: 1   MKSAEIREAFLRFFEEKGHTRVASSSLIPANDPTLLFTNAGMNQFKDCFLGLEKRAYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT QKCVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+ LT  K  +
Sbjct: 61  TTSQKCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWEFLTGEKWLN 120

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY  D+EA+ +W K  G+ A++++RI  N       DNFW+M +TGPCGPC
Sbjct: 121 LPKEKLWVTVYATDDEAYDIWTKEVGVPAERMVRIGDNKGAPYASDNFWAMGDTGPCGPC 180

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIFFD G  I GG PGS  E+G+RYIEIWN VFMQF +        LP  S+DTGMGLE
Sbjct: 181 TEIFFDHGPEIWGGPPGSPEEDGDRYIEIWNNVFMQFNRTADGVMHPLPAPSVDTGMGLE 240

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R++ VLQ   +NY+IDLF++L++AS +  G     ++  + +V+ DH+RS SFLIADG+L
Sbjct: 241 RVSAVLQHVHSNYEIDLFQNLLKASAEAIGCA--NDDAPSLKVVADHIRSCSFLIADGVL 298

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NEGRGYVLRRI+RRA  +   LG        ++ AL  EMG A+PEL Q +  IE  L
Sbjct: 299 PSNEGRGYVLRRIIRRACRHGNKLGARGTFFHKIVAALVAEMGDAFPELKQQQAHIERVL 358

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F KTL++GL +L+  L+ L    ++ G+V FKLYDT+G P+D+  DI   R L 
Sbjct: 359 KTEEEQFAKTLEQGLKILEQDLAELQ-GSVIPGNVVFKLYDTYGFPVDLTNDIARERELT 417

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            ID   F + +E QR RARA S           + SL +  G T+F+GY  + G+     
Sbjct: 418 -IDEDGFEREMEAQRERARASSAFGM------DYNSLVKVDGETRFLGYQGVSGA----- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                               + A+ + G+ VE    G++  VV DQTPFYAE+GGQ+GD+
Sbjct: 466 ------------------GQIVALFRDGQAVERLEEGEEGVVVLDQTPFYAESGGQVGDS 507

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G     G+R  + D  K      +HH +V RG L    ++   +D   R+  ++NHSATH
Sbjct: 508 GYLEAAGVRFDVRDTTKAGG-AHLHHGVVARGNLSVGAAVKAEVDASVRQATALNHSATH 566

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV Q GS +    LRFD +H + I + +LK++ED VN  I +N  V T
Sbjct: 567 LLHAALRQVLGEHVQQKGSLVDSQRLRFDFSHFEAIKAEQLKALEDIVNAEIRRNTEVET 626

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
              + + A A GA AL G KY D+VRV+S+    GG  S  LCGGTHVS TG+I L  I 
Sbjct: 627 EETDIDTAKAKGAMALFGEKYGDQVRVLSM----GGDFSVELCGGTHVSRTGDIGLFKIT 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SE  + AG+RRIEA+TG  A ++L G +E+LK  AS +K S+ N++ ++  + E  R L+
Sbjct: 683 SEGGVAAGVRRIEAVTGAAALAYLNGAEEQLKEAASLVKGSRDNLLDKLGALLERNRSLE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K +           +  +I     ++  +  +D K L +++D L+ K+   +I+
Sbjct: 743 KELEQLKAKAASAAGDDLSAAAVEIKGAKVLAARLDGLDGKALLALVDQLKNKLGRAVIL 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L G   + K  ++  VT+DL  +  A +L + +A  +GG G GGRP MAQ GG N  K D
Sbjct: 803 LGG-ELDGKVVLVAGVTQDLTGQLKAGELMKQAAAAVGGKG-GGRPDMAQGGGTNAAKLD 860

Query: 887 QAIAGVASFLKK 898
           +A+A    F+++
Sbjct: 861 EALALAQRFVEQ 872


>gi|15596100|ref|NP_249594.1| alanyl-tRNA synthetase [Pseudomonas aeruginosa PAO1]
 gi|107100361|ref|ZP_01364279.1| hypothetical protein PaerPA_01001386 [Pseudomonas aeruginosa PACS2]
 gi|218893128|ref|YP_002441997.1| alanyl-tRNA synthetase [Pseudomonas aeruginosa LESB58]
 gi|20532264|sp|Q9I553|SYA_PSEAE RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|9946804|gb|AAG04292.1|AE004524_9 alanyl-tRNA synthetase [Pseudomonas aeruginosa PAO1]
 gi|218773356|emb|CAW29168.1| alanyl-tRNA synthetase [Pseudomonas aeruginosa LESB58]
          Length = 874

 Score =  914 bits (2362), Expect = 0.0,   Method: Composition-based stats.
 Identities = 398/912 (43%), Positives = 552/912 (60%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL FF++ GH  + SSSLIP NDPTL+FTN+GM  FK+ F G EK  Y   
Sbjct: 1   MKSAEIREAFLRFFEEKGHTRVASSSLIPANDPTLLFTNAGMNQFKDCFLGLEKRAYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT QKCVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+ LT  K  +
Sbjct: 61  TTSQKCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWEFLTGEKWLN 120

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY  D+EA+ +W K  G+ A++++RI  N       DNFW+M +TGPCGPC
Sbjct: 121 LPKEKLWVTVYATDDEAYDIWTKEVGVPAERMVRIGDNKGAPYASDNFWAMGDTGPCGPC 180

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIFFD G  I GG PGS  E+G+RYIEIWN VFMQF +        LP  S+DTGMGLE
Sbjct: 181 TEIFFDHGPEIWGGPPGSPEEDGDRYIEIWNNVFMQFNRTADGVMHPLPAPSVDTGMGLE 240

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R++ VLQ   +NY+IDLF++L++AS +  G     ++  + +V+ DH+RS SFLIADG+L
Sbjct: 241 RVSAVLQHVHSNYEIDLFQNLLKASAEAIGCA--NDDAPSLKVVADHIRSCSFLIADGVL 298

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NEGRGYVLRRI+RRA  +   LG        ++ AL  EMG A+PEL Q +  IE  L
Sbjct: 299 PSNEGRGYVLRRIIRRACRHGNKLGARGTFFHKIVAALVAEMGDAFPELKQQQAHIERVL 358

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F KTL++GL +L+  L+ L    ++ G+V FKLYDT+G P+D+  DI   R L 
Sbjct: 359 KTEEEQFAKTLEQGLKILEQDLAELQ-GSVIPGNVVFKLYDTYGFPVDLTNDIARERELT 417

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            ID   F + +E QR RARA S           + SL +  G T+F+GY  + G+     
Sbjct: 418 -IDEDGFEREMEAQRERARASSAFGM------DYNSLVKVDGETRFLGYQGVSGA----- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                               + A+ + G+ VE    G++  VV DQTPFYAE+GGQ+GD+
Sbjct: 466 ------------------GQIVALFRDGQAVERLEEGEEGVVVLDQTPFYAESGGQVGDS 507

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G     G+R  + D  K      +HH +V RG L    ++   +D   R+  ++NHSATH
Sbjct: 508 GYLEAAGVRFDVRDTTKAGG-AHLHHGVVARGNLSVGGAVKAEVDASVRQATALNHSATH 566

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV Q GS +    LRFD +H + I + +LK++ED VN  I +N  V T
Sbjct: 567 LLHAALRQVLGDHVQQKGSLVDSQRLRFDFSHFEAIKAEQLKALEDIVNAEIRRNTEVET 626

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
              + + A A GA AL G KY D+VRV+S+    GG  S  LCGGTHVS TG+I L  I 
Sbjct: 627 EETDIDTAKAKGAMALFGEKYGDQVRVLSM----GGDFSVELCGGTHVSRTGDIGLFKIT 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SE  + AG+RRIEA+TG  A ++L G +E+LK  AS +K S+ N++ ++  + E  R L+
Sbjct: 683 SEGGVAAGVRRIEAVTGAAALAYLNGAEEQLKEAASLVKGSRDNLLDKLGALLERNRSLE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K +           +  +I     ++  +  +D K L +++D L+ K+   +I+
Sbjct: 743 KELEQLKAKAASAAGDDLSAAAVEIKGAKVLAARLDGLDGKALLALVDQLKNKLGRAVIL 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L G   + K  ++  VT+DL  +  A +L + +A  +GG G GGRP MAQ GG +  K D
Sbjct: 803 LGG-ELDGKVVLVAGVTQDLTGQLKAGELMKQAAAAVGGKG-GGRPDMAQGGGTDAAKLD 860

Query: 887 QAIAGVASFLKK 898
           +A+A    F+++
Sbjct: 861 EALALAQRFVEQ 872


>gi|296390743|ref|ZP_06880218.1| alanyl-tRNA synthetase [Pseudomonas aeruginosa PAb1]
          Length = 874

 Score =  914 bits (2362), Expect = 0.0,   Method: Composition-based stats.
 Identities = 398/912 (43%), Positives = 552/912 (60%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL FF++ GH  + SSSLIP NDPTL+FTN+GM  FK+ F G EK  Y   
Sbjct: 1   MKSAEIREAFLRFFEEKGHTRVASSSLIPANDPTLLFTNAGMNQFKDCFLGLEKRAYTRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT QKCVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+ LT  K  +
Sbjct: 61  TTSQKCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWEFLTGEKWLN 120

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY  D+EA+ +W K  G+ A++++RI  N       DNFW+M +TGPCGPC
Sbjct: 121 LPKEKLWVTVYATDDEAYDIWTKEVGVPAERMVRIGDNKGAPYASDNFWAMGDTGPCGPC 180

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIFFD G  I GG PGS  E+G+RYIEIWN VFMQF +        LP  S+DTGMGLE
Sbjct: 181 TEIFFDHGPEIWGGPPGSPEEDGDRYIEIWNNVFMQFNRTADGVMHPLPAPSVDTGMGLE 240

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R++ VLQ   +NY+IDLF++L++AS +  G     ++  + +V+ DH+RS SFLIADG+L
Sbjct: 241 RVSAVLQHVHSNYEIDLFQNLLKASAEAIGCA--NDDAPSLKVVADHIRSCSFLIADGVL 298

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NEGRGYVLRRI+RRA  +   LG        ++ AL  EMG A+PEL Q +  IE  L
Sbjct: 299 PSNEGRGYVLRRIIRRACRHGNKLGARGTFFHKIVAALVAEMGDAFPELKQQQAHIERVL 358

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F KTL++GL +L+  L+ L    ++ G+V FKLYDT+G P+D+  DI   R L 
Sbjct: 359 KTEEEQFAKTLEQGLKILEQDLAELQ-GSVIPGNVVFKLYDTYGFPVDLTNDIARERELT 417

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            ID   F + +E QR RARA S           + SL +  G T+F+GY  + G+     
Sbjct: 418 -IDEDGFEREMEAQRERARASSAFGM------DYNSLVKVDGETRFLGYQGVSGA----- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                               + A+ + G+ VE    G++  VV DQTPFYAE+GGQ+GD+
Sbjct: 466 ------------------GQIVALFRDGQAVERLEEGEEGVVVLDQTPFYAESGGQVGDS 507

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G     G+R  + D  K      +HH +V RG L    ++   +D   R+  ++NHSATH
Sbjct: 508 GYLEAAGVRFDVRDTTKAGG-AHLHHGVVARGNLSVGAAVKAEVDASVRQATALNHSATH 566

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV Q GS +    LRFD +H + I + +LK++ED VN  I +N  V T
Sbjct: 567 LLHAALRQVLGEHVQQKGSLVDSQRLRFDFSHFEAIKAEQLKALEDIVNAEIRRNTEVET 626

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
              + + A A GA AL G KY D+VRV+S+    GG  S  LCGGTHVS TG+I L  I 
Sbjct: 627 EETDIDTAKAKGAMALFGEKYGDQVRVLSM----GGDFSVELCGGTHVSRTGDIGLFKIT 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SE  + AG+RRIEA+TG  A ++L G +E+LK  AS +K S+ N++ ++  + E  R L+
Sbjct: 683 SEGGVAAGVRRIEAVTGAAALAYLNGAEEQLKEAASLVKGSRDNLLDKLGALLERNRSLE 742

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K +           +  +I     ++  +  +D K L +++D L+ K+   +I+
Sbjct: 743 KELEQLKAKAASAAGDDLSAAAVEIKGAKVLAARLDGLDGKALLALVDQLKNKLGRAVIL 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L G   + K  ++  VT+DL  +  A +L + +A  +GG G GGRP MAQ GG +  K D
Sbjct: 803 LGG-ELDGKVVLVAGVTQDLTGQLKAGELMKQAAAAVGGKG-GGRPDMAQGGGTDAAKLD 860

Query: 887 QAIAGVASFLKK 898
           +A+A    F+++
Sbjct: 861 EALALAQRFVEQ 872


>gi|88798293|ref|ZP_01113879.1| Alanyl-tRNA synthetase [Reinekea sp. MED297]
 gi|88779069|gb|EAR10258.1| Alanyl-tRNA synthetase [Reinekea sp. MED297]
          Length = 868

 Score =  914 bits (2361), Expect = 0.0,   Method: Composition-based stats.
 Identities = 371/903 (41%), Positives = 539/903 (59%), Gaps = 45/903 (4%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              S IR  FLEFF+K+ H ++P+ SL+P +DPTL+FTN+GM  FK++F G ++  Y   
Sbjct: 1   MKTSEIRRRFLEFFEKHEHRVVPAGSLVPGDDPTLLFTNAGMNQFKDVFLGTDRRDYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK+ AI+ AW  LT+E  L 
Sbjct: 61  TTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAIRFAWTFLTEELGLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGE 181
           + +L++TVY +D+EA  +W    G+  +++ R+   DNFW M +TGPCGPCSEIF+D GE
Sbjct: 121 KEKLWVTVYQDDDEAADIWINDIGVDPNRLSRLGDKDNFWMMGDTGPCGPCSEIFYDHGE 180

Query: 182 CIPGGLPGSSEEG-ERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEK 240
            +PGG PGS ++  +RYIEIWNLVFMQF+      R  LPK S+DTGMGLER+A +LQ  
Sbjct: 181 EVPGGPPGSPDDDLDRYIEIWNLVFMQFDTLADGSRVPLPKPSVDTGMGLERLAAILQGV 240

Query: 241 TNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYV 300
            +NY+IDLF+ LI+A+ +VTG         + RVI DH+RS++FLIADG++P+NEGRGYV
Sbjct: 241 HSNYEIDLFQALIRAAMRVTGCTDI--ENRSLRVIADHIRSTAFLIADGVIPSNEGRGYV 298

Query: 301 LRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGK 360
           LRRI+RRA+ +   LG  +  +  L+  L  +MG AYPEL +    + + L+ E+E+F +
Sbjct: 299 LRRIIRRAVRHGYKLGCQDLFLFKLVDDLVDQMGEAYPELAEQADHVRKVLKIEEEQFAR 358

Query: 361 TLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQ 420
           TL+ G+ +L+  ++ +    ++ G++ FKLYDT+G P D+  D+   +GL  ID   F  
Sbjct: 359 TLENGMTILEQGIADIE-GNVIPGELVFKLYDTYGFPADLTADVAREKGL-DIDQDGFES 416

Query: 421 ALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKP 480
            + EQR RA++ +        +          GAT F+GY+ L                 
Sbjct: 417 RMAEQRKRAQSANKFKMDRDLD------LALDGATNFLGYETL----------------- 453

Query: 481 PIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIR 540
                      V  +++  + V +   G +  V+ DQTPFYAE+GGQ GD G    +   
Sbjct: 454 ------AAEGQVIRLLRGEDTVSQLSVGDEGVVILDQTPFYAESGGQAGDRGVITTEAAS 507

Query: 541 LQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTI 600
           L++ D QK     F+H   V  G+L+T+  +   +    R   + +HSATHLLH AL  +
Sbjct: 508 LEVIDCQKHQGH-FLHQVRVTDGVLKTDDRVAAKVQRNERENTARHHSATHLLHAALREV 566

Query: 601 LGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAI 660
           LG+HV Q GS +T D LRFD +H + +T+ EL  IE  VN  I  N  V T +M+ + A 
Sbjct: 567 LGTHVQQRGSLVTHDKLRFDFSHLEAVTAEELVQIETLVNHHIMANAEVTTELMDIDSAK 626

Query: 661 ASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGI 720
           A+GA AL G KY+D+VRV+++       +S  LCGGTHV  TG+I L  IV+ES I AGI
Sbjct: 627 AAGAVALFGEKYDDQVRVLTMGE---DAYSKELCGGTHVQRTGDIGLFRIVAESGIAAGI 683

Query: 721 RRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQ 780
           RR+EA+ G  A + +  +D  +  L+   K S   +  +V++     + L+   +K K +
Sbjct: 684 RRVEAVAGPYALAEIRQRDAVVNRLSGQFKCSVDQLESKVQQAVAHSKDLEKELSKLKDK 743

Query: 781 LNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKK 835
           L              +  V  ++  +  VD+K L+S MD ++ K+ S +I++V +  E K
Sbjct: 744 LASAAAGDLTSEVKDVQGVKVLAVRLDGVDAKSLRSTMDQMKSKLGSAVILIVAVDGE-K 802

Query: 836 ASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASF 895
             +   VT+DL   F A +L +     L G  GGG+P MA +GG + NK   A+  V ++
Sbjct: 803 VQLAAGVTKDLTATFKAGNLIKDVGA-LMGAKGGGKPDMAMAGGGDINKIPDALQAVPTW 861

Query: 896 LKK 898
           +++
Sbjct: 862 VEQ 864


>gi|254448289|ref|ZP_05061751.1| alanyl-tRNA synthetase [gamma proteobacterium HTCC5015]
 gi|198262156|gb|EDY86439.1| alanyl-tRNA synthetase [gamma proteobacterium HTCC5015]
          Length = 868

 Score =  914 bits (2361), Expect = 0.0,   Method: Composition-based stats.
 Identities = 374/904 (41%), Positives = 548/904 (60%), Gaps = 45/904 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M++ ++IR  FL++F   GH ++PSSSL+P  D TL+FTN+GMVPFK++F GQE+  Y  
Sbjct: 1   MTSSANIRKQFLDYFASKGHAVVPSSSLVPAGDDTLLFTNAGMVPFKHVFLGQEQRDYNR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            T+ Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI   W+ LT+   L
Sbjct: 61  ATSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYGWEFLTQVVGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
            + +L++TV++ED+EA  +W K  G+  D++ RI   DNFW M +TGPCGPC+EIF+D G
Sbjct: 121 PKEKLWVTVFEEDDEAADIWLKEIGVDPDRLSRIGAKDNFWQMGDTGPCGPCTEIFYDHG 180

Query: 181 ECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           E I GG P    E+G+RYIE+WNLVFMQ+ +        LPK S+DTGMGLER+A +LQ 
Sbjct: 181 EHIWGGPPGTPEEDGDRYIEVWNLVFMQYNRSQDGTLTPLPKPSVDTGMGLERLAAILQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NY+IDLF+ LI A+ +  G++   + I +  VI DH+RS +FL+ DG+LP+NEGRGY
Sbjct: 241 VHSNYEIDLFQALIHAAGKAVGVEKPSHEISSLNVIADHIRSCAFLVVDGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRI+RRA  +   LG  +P    L+  L  +MG AYPEL +++  +E+ L+ E+ERF 
Sbjct: 301 VLRRIIRRACRHGYKLGQNQPFFYTLVEELVAQMGEAYPELSESQARVEQVLKKEEERFA 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           +TL +G+ +L+  +  L  + I  G+  F+LYDT+G P+D+  DI     L  ID+  + 
Sbjct: 361 ETLSQGMGILNQAIDSLDGERI-PGETVFQLYDTYGFPVDLTADIAREHEL-DIDLEGYE 418

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
             +EEQR RARA S                E    ++F GY+ L                
Sbjct: 419 ACMEEQRQRARAASQFG------ADLSERIEFSEESEFTGYEHLNH-------------- 458

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                     +++  ++  G  VE    GQ+  VV + TPFYAE+GGQ+GD G  + +G+
Sbjct: 459 ---------EAVISHLIVDGSEVERIAEGQQGMVVLNSTPFYAESGGQVGDRGVLVSEGV 509

Query: 540 RLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALST 599
           R ++ D QK+     VH   +E G L    +++  +D   RR   +NHSATHL+H AL  
Sbjct: 510 RFRVDDTQKQGG-AIVHIGHLECGELSLNDNILAEVDMAKRRATELNHSATHLMHWALRE 568

Query: 600 ILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDA 659
           +LG HV Q GS +  + LRFD +H +P+T +EL  +ED VN  I +N    TR+M  EDA
Sbjct: 569 VLGDHVQQKGSLVNEEYLRFDFSHFQPMTDSELAQVEDLVNAEILKNRATQTRLMTMEDA 628

Query: 660 IASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAG 719
            A+GA AL G KY D VRV+++     G HS  LCGGTHV  TG+I L  ++ E  + +G
Sbjct: 629 KAAGAMALFGEKYGDEVRVLNI-----GDHSIELCGGTHVDRTGDIGLFKLIGEGGVASG 683

Query: 720 IRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKL 779
           +RR+EAITG  A+  +   D+ ++ LA+ L+  +G+V  +VE++ ++ R+L+    + K 
Sbjct: 684 VRRVEAITGIAAQQWVRQTDDTVRQLAARLRTDRGSVADKVEQLADKNRQLEKELERLKS 743

Query: 780 QLNVE-----DLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEK 834
           +L  +          +I  +  ++  +   D+K L+S +D L+ K+ +  I+L     + 
Sbjct: 744 KLASQAGGDIASQAVEIDGIKVLATALEGADTKVLRSTLDQLKDKLGAAAIVLGAADGD- 802

Query: 835 KASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVAS 894
           K  ++  VT+    R  A +L    A  +GG G GGRP MAQ+GG +    + A+A V +
Sbjct: 803 KVRLVAGVTKSETSRIKAGELVNHVAVQVGGRG-GGRPDMAQAGGSDPAALEGALASVET 861

Query: 895 FLKK 898
           ++++
Sbjct: 862 WVRE 865


>gi|167623167|ref|YP_001673461.1| alanyl-tRNA synthetase [Shewanella halifaxensis HAW-EB4]
 gi|205830204|sp|B0TK15|SYA_SHEHH RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|167353189|gb|ABZ75802.1| alanyl-tRNA synthetase [Shewanella halifaxensis HAW-EB4]
          Length = 874

 Score =  914 bits (2361), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/907 (42%), Positives = 549/907 (60%), Gaps = 54/907 (5%)

Query: 3   NVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVT 62
             +++R+ FLE+F+ NGH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   T
Sbjct: 4   TTAALRSAFLEYFRTNGHQVVDSSSLVPANDPTLLFTNAGMNQFKDVFLGADKRSYSRAT 63

Query: 63  TVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQ 122
           + Q+CVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE AI  AW  LT+E  L +
Sbjct: 64  SSQRCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEEAIHFAWTFLTEELKLPK 123

Query: 123 RRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSEI 175
            RL +T+Y+ D+EAF++W K  G++A+ IIRI  N       DNFW M +TGPCGPCSEI
Sbjct: 124 ERLCVTIYETDDEAFEIWNKKIGVAAENIIRIGDNKGAAYASDNFWQMGDTGPCGPCSEI 183

Query: 176 FFDQGECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMA 234
           F+D G+ I GG P    E+G+R+IEIWN+VFMQ+ +Q   E   LPK S+DTGMG+ER+A
Sbjct: 184 FYDHGDHIWGGRPGTPEEDGDRFIEIWNIVFMQYNRQADGEMKPLPKPSVDTGMGIERIA 243

Query: 235 TVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPAN 294
            ++Q   +NY+ID+F+ LI+ +  + G+        + RVI DH+RS +FLIADG++P+N
Sbjct: 244 AIMQGVHSNYEIDIFQALIKKTAAILGVTD--LENKSLRVIADHIRSCAFLIADGVMPSN 301

Query: 295 EGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSE 354
           EGRGYVLRRI+RRA+ +   LG TE     L+P L   MG A   L + + ++E++L++E
Sbjct: 302 EGRGYVLRRIIRRAVRHGNKLGATESFFYKLVPTLIEVMGDAAKGLQETQAIVEKSLKAE 361

Query: 355 DERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGID 414
           +E+F +TL+RGL +LD  L+ L   ++L+G+ AFKLYDT+G P+D+  D+   R +  +D
Sbjct: 362 EEQFARTLERGLGILDAALNELT-TKVLDGETAFKLYDTYGFPVDLTADVCREREIT-VD 419

Query: 415 IISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRK 474
              F  A+ EQR RA+A       G  +  +    +    + F GY  L           
Sbjct: 420 EAGFEAAMAEQRKRAQAA------GQFDTDYNEGLKIDEQSSFTGYTEL----------- 462

Query: 475 VLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCA 534
                          + V AI + GE  E   +G +  +V D TPFY E+GGQ GD G  
Sbjct: 463 ------------NNQATVTAIFKSGEAAETITAGDEAVIVLDNTPFYGESGGQSGDKGVL 510

Query: 535 IGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLH 594
           I DGI   + D QK       H   V  G ++   SL   +D + R +  +NHS THLLH
Sbjct: 511 IADGIEFTVIDTQKYG-QAIGHIGRVVTGEIKAGQSLTANVDKKLRHRTELNHSVTHLLH 569

Query: 595 HALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIM 654
            AL  +LG+HVSQ GS + P+ LRFD +H + + + ELK +E+ VN  I +N  +   +M
Sbjct: 570 AALRQVLGAHVSQKGSLVDPERLRFDFSHFEGVKANELKEVEELVNTQIRRNHELTAEVM 629

Query: 655 NREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
           + E A   GA AL G KY+  VRVV++     G  S  LCGGTHV  TG+I L  I SE 
Sbjct: 630 DIETAKEKGAMALFGEKYDSEVRVVTM-----GDFSIELCGGTHVGRTGDIGLFKITSEG 684

Query: 715 SIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIH 774
            I AGIRRIEA+TG  A +++  Q  +L+  A+ LK    +VV +++   ++ ++L+   
Sbjct: 685 GIAAGIRRIEAVTGAAAMAYVAKQQAQLEEAATLLKGDSASVVAKLKAQLDKTKQLEKEL 744

Query: 775 AKRKLQLNVE-----DLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVG 829
           ++ K +L             ++  V  +   +  VD+  L+ + D L++K+QSGI++L  
Sbjct: 745 SQLKDKLAAATSADLAGEAVEVNGVKVLVKKLEGVDAGALRGLQDELKQKLQSGIVVLA- 803

Query: 830 ISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAI 889
           I+ E K ++++ VT+DL  +  A +L    A  + GG GGGRP MAQ+GG      D A+
Sbjct: 804 IAGEDKVNLIVGVTKDLTGKVKAGELVASIAVQV-GGKGGGRPDMAQAGGSQPENLDGAL 862

Query: 890 AGVASFL 896
             V  ++
Sbjct: 863 EQVIPWI 869


>gi|320173452|gb|EFW48651.1| Alanyl-tRNA synthetase [Shigella dysenteriae CDC 74-1112]
          Length = 876

 Score =  914 bits (2361), Expect = 0.0,   Method: Composition-based stats.
 Identities = 395/910 (43%), Positives = 560/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT  K F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTSEKWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K   +  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYESDDEAYEIWEKEVEIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F+ A+EEQR RAR              + ++     A++F GYD L        
Sbjct: 420 -VDEAGFDAAMEEQRRRAREA------SGFGADYNAMIRVDSASEFKGYDHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ+  VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G      + D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGANFSFAVEDTQKYG-QAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HVSQ GS +    LRFD +H++ +   E++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY++RVRV+S+     G  S+ LCGGTH S TG+I L  I+
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDERVRVLSM-----GDFSTELCGGTHASRTGDIGLFRII 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A + +    ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAITTVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          +  V  +   +S V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  ++ E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVA-EGKVSLIAGVSKDVTDRVKAGELIGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|283835574|ref|ZP_06355315.1| alanine--tRNA ligase [Citrobacter youngae ATCC 29220]
 gi|291068784|gb|EFE06893.1| alanine--tRNA ligase [Citrobacter youngae ATCC 29220]
          Length = 875

 Score =  914 bits (2361), Expect = 0.0,   Method: Composition-based stats.
 Identities = 394/910 (43%), Positives = 563/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT    F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQFAWELLTGENWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYETDDEAYEIWEKEVGIPRERIIRIGDNKGAAYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS+ E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSAEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NY+IDLF+ LI++  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYEIDLFRSLIESVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVV 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  +     L+  L   MGSA  EL + + ++E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKDTFFYKLVGPLVEVMGSAGDELKRQQAMVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F  A+EEQR RAR              + ++    GA++F GY+ L        
Sbjct: 420 -VDEEGFEAAMEEQRRRAREA------SGFGADYNAMIRVDGASEFKGYEHLE------- 465

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                           ++  V A+   G+ V+   +GQ   VV DQTPFYAE+GGQ+GD 
Sbjct: 466 ----------------LNGKVTALFVDGKAVDAINAGQDAVVVLDQTPFYAESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G   G G    ++D QK       H   +  G L+   ++   +D   R ++ +NHSATH
Sbjct: 510 GELKGAGFAFAVSDTQKYG-QAIGHIGKLSAGSLKIGDAVQADVDEARRARIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LG+HV+Q GS +    LRFD +H++ +  AE++++ED VN  I +NLP+ T
Sbjct: 569 LMHAALRQVLGTHVAQKGSLVNDKVLRFDFSHTEAMKPAEIRAVEDLVNAQIRRNLPIET 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ E A A GA AL G KY+D VRV+S+     G  S+ LCGGTH S TG+I L  IV
Sbjct: 629 NIMDLEAAKAKGAMALFGEKYDDHVRVLSM-----GDFSTELCGGTHASRTGDIGLFRIV 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIEA+TG+ A   +  Q ++L  +A  LK    N+  +V  + E  R+L+
Sbjct: 684 SESGTAAGVRRIEAVTGEGAIHTVHAQSDRLNDIAQLLKGDSQNIGDKVRSVLERTRQLE 743

Query: 772 LIHAKRKLQLNVED-----LSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++          I  V  +   +++V+ K L++++D L+ ++ S +I+
Sbjct: 744 KELQQLKEQAAAQESANLSSKAVDINGVKLLVSELADVEPKMLRTMVDDLKNQLGSTVIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +  E K S++  V++D+ DR  A +L  + A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATVV-EGKVSLIAGVSKDVTDRVKAGELVGMVAQQV-GGKGGGRPDMAQAGGTDAAALP 861

Query: 887 QAIAGVASFL 896
            A+A V  ++
Sbjct: 862 AALASVKGWV 871


>gi|114775361|ref|ZP_01450929.1| alanyl-tRNA synthetase [Mariprofundus ferrooxydans PV-1]
 gi|114553472|gb|EAU55853.1| alanyl-tRNA synthetase [Mariprofundus ferrooxydans PV-1]
          Length = 871

 Score =  913 bits (2360), Expect = 0.0,   Method: Composition-based stats.
 Identities = 399/903 (44%), Positives = 549/903 (60%), Gaps = 42/903 (4%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              S IR  FL++F   GH ++ SSSL+P  DPTLMFTN+GMV FK++F G E   Y+  
Sbjct: 1   MRTSEIRKKFLDYFAAEGHTIVDSSSLVPHGDPTLMFTNAGMVQFKHVFLGNESRPYRTA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT QKCVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW  LT E  LD
Sbjct: 61  TTSQKCVRAGGKHNDLENVGHTARHHTFFEMLGNFSFGDYFKHDAIRYAWQFLTGELKLD 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGE 181
             RL+ITV++ED+EA+ +W K  G+ AD+I RI   DNFWSM +TGPCGPCSEIF+D G 
Sbjct: 121 PARLFITVFEEDDEAYDIWTKEVGIPADRIARIGAKDNFWSMGDTGPCGPCSEIFYDHGA 180

Query: 182 CIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEK 240
            + GG PG++ E+G+RYIEIWNLVFMQ+++        LP  S+DTGMGLER+A V+Q  
Sbjct: 181 DVWGGPPGTAEEDGDRYIEIWNLVFMQYDRDEDGTLTPLPHPSVDTGMGLERVAAVMQGV 240

Query: 241 TNNYDIDLFKHLIQASEQVTGMK--YEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRG 298
            NNYDIDLF  LI A+  +TG++   +  + V+ RV+ DHLRS SFL+ADG+LP+NEGRG
Sbjct: 241 HNNYDIDLFARLIDAAGALTGVRMGDDPVSDVSLRVLADHLRSVSFLLADGVLPSNEGRG 300

Query: 299 YVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERF 358
           +VLRRI+RRA  + RLLG  E  +  L+ AL  EMG  + EL +++  IE+ +R E+ERF
Sbjct: 301 FVLRRILRRACRHGRLLGMYEAFIYKLVDALVAEMGDHFAELKESQGNIEQVIRIEEERF 360

Query: 359 GKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISF 418
            KTLD+GL L++   +  GK   + G+  F LYDT G P D+  DIL       +D+  F
Sbjct: 361 IKTLDKGLKLVEQAAASAGKGGTIPGETLFALYDTFGFPTDLTADILKGTD-ISLDMDGF 419

Query: 419 NQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQ 478
            + +EEQR+RARA   G G     K  F L+E +G T+F+GYD L               
Sbjct: 420 ERCMEEQRTRARAAWGGSGESALPKALFELREHHGPTEFLGYDTLSS------------- 466

Query: 479 KPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDG 538
                       ++  +++ GE V+   +G++  ++ +QTPFYAE+GGQ GDTG      
Sbjct: 467 ----------EGVITGLIRDGEAVDTLHAGEEGWLIANQTPFYAESGGQAGDTGLITIGD 516

Query: 539 IRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALS 598
              +++D +K    +FVH   V +G       +   +D   R  +  NH+ATHL+H  L 
Sbjct: 517 AIFEVSDTRKMLSDLFVHTGKVVKGSFEAGSVVHFAVDEDRRAAIRRNHTATHLMHAVLR 576

Query: 599 TILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNRED 658
            +LG HV Q GS +    LRFD  H KP++  E K IE  VN  I  N PV T++M++++
Sbjct: 577 KVLGEHVKQAGSLVNEQRLRFDFNHFKPVSEEERKVIEAEVNAAIWANDPVETKLMSQDE 636

Query: 659 AIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRA 718
           A+ASGA AL G KY D VRVVS         S+ LCGGTHVS+TG+I    IVSE+ I A
Sbjct: 637 AVASGAMALFGEKYGDEVRVVSAG------FSTELCGGTHVSATGDIGPFRIVSEAGIAA 690

Query: 719 GIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRK 778
           G+RRIEA+TG  A   L+     L+  A  LKV        V  +  + +  +      +
Sbjct: 691 GVRRIEAVTGSAAYQSLVADIHTLEEAAGHLKVRPFEAADAVVTLQGKLKDAEKELTSLR 750

Query: 779 LQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKE 833
            + +   L        ++  V  ++  +S V  K+++  MD  + K++SG I++ G+   
Sbjct: 751 AKQSTGLLDDLIKQAVEVNGVKLLAVEVSGV--KDMRDFMDKAKGKLKSG-ILVFGMKNG 807

Query: 834 KKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVA 893
            K  ++  VT+DLL  ++A ++ R  A ++ GG GGG+P MA +GG   +K  QA+AGVA
Sbjct: 808 PKVQLIAGVTQDLLGSYHAGNIVREVA-MICGGKGGGKPDMAMAGGTEPDKLKQALAGVA 866

Query: 894 SFL 896
           + +
Sbjct: 867 ALI 869


>gi|85712448|ref|ZP_01043497.1| Alanyl-tRNA synthetase [Idiomarina baltica OS145]
 gi|85693726|gb|EAQ31675.1| Alanyl-tRNA synthetase [Idiomarina baltica OS145]
          Length = 867

 Score =  913 bits (2360), Expect = 0.0,   Method: Composition-based stats.
 Identities = 373/902 (41%), Positives = 546/902 (60%), Gaps = 48/902 (5%)

Query: 3   NVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVT 62
             + IR  F++FF++ GH+ +PS+S+IP NDPTL+FTN+GMVPFK++F G +K  Y   T
Sbjct: 4   TSAEIREKFIQFFEQRGHQRVPSASMIPANDPTLLFTNAGMVPFKDVFLGTDKRNYTRAT 63

Query: 63  TVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQ 122
           + Q+C+RAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI+ AW  LT+E  L  
Sbjct: 64  SAQRCLRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKTEAIEFAWHFLTQELQLPA 123

Query: 123 RRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGEC 182
            +L++TV++ED+EA+ +W K  G+  D+I RI   DNFWSM +TGPCGPCSE+F+D G  
Sbjct: 124 EKLWVTVFEEDDEAYDIWAKHIGVPEDRISRIGVKDNFWSMGDTGPCGPCSEVFYDHGPE 183

Query: 183 IPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEKT 241
           + GG P    E+G+RYIEIWNLVFMQ+ +Q       LP  SIDTGMGLER+A +LQ   
Sbjct: 184 VWGGPPGTPEEDGDRYIEIWNLVFMQYNRQADGTMEPLPNPSIDTGMGLERIAAILQGVH 243

Query: 242 NNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYVL 301
           +NY+ID F+ LI+ S  + G+     +  + RVI DH+RS SFLIADG++P+NEGRGYVL
Sbjct: 244 SNYEIDTFQALIKRSADIIGVSD--LSSKSLRVIADHIRSCSFLIADGVMPSNEGRGYVL 301

Query: 302 RRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGKT 361
           RRI+RRA+ +  LLG  +     L+  L   MG AYPEL++ + +IE+ L+ E+++F KT
Sbjct: 302 RRIIRRAVRHGNLLGAKQTFFYQLVDELVKLMGEAYPELVEKRHIIEDALKREEQQFEKT 361

Query: 362 LDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQA 421
           L+RGL +L+  +  L     LNG+V FKLYDT+G P+D+  DI        ID   FN A
Sbjct: 362 LERGLAILNDEIKQLS-GNTLNGEVVFKLYDTYGFPMDLTADIARE-NELVIDEEGFNAA 419

Query: 422 LEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKPP 481
           ++ QR RA+  S           + +  +    + F GY                     
Sbjct: 420 MQAQRERAQKASQFG------VDYNAQVKATTKSVFDGYTE------------------- 454

Query: 482 IDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIRL 541
               +   + V  +  +G  VE   +GQ+  VV   TPFYAE+GGQ+GDTG  + +  R 
Sbjct: 455 ----DKAQTTVVELFHEGTAVESLEAGQQGVVVLANTPFYAESGGQVGDTGVLLANQGRF 510

Query: 542 QITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTIL 601
           ++TD Q   +    HH   +   ++   ++   ID + R  +  NHSATHLLH AL  IL
Sbjct: 511 EVTDTQYIGK-AIAHHGQADC-TIKLGDAVTAEIDSERRANIRRNHSATHLLHAALRDIL 568

Query: 602 GSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAIA 661
           G HV Q GS +  + +RFD  H +P+T A++  +E  VN+ I +N+ + T++MN ++A  
Sbjct: 569 GDHVQQKGSLVEAERMRFDFAHFEPLTKAQITELERVVNEQIRKNVRLTTQVMNIDEAKK 628

Query: 662 SGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGIR 721
           +GA AL G KY+D VRVV +     G  S  LCGGTHV++TG+I L  I  E+ I +G+R
Sbjct: 629 AGAMALFGEKYDDDVRVVRM-----GEFSMELCGGTHVAATGDIGLFRITHETGIASGVR 683

Query: 722 RIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQL 781
           R+E +TG  A   +  Q   L  L +  K  +  ++G+V+++  +YR+L+    + + +L
Sbjct: 684 RLEVVTGAAAFEFMANQQAILNQLTADFKTDETGLLGKVDQLQSKYRELERKAEQLQQKL 743

Query: 782 NVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKKA 836
             +          ++     +   + + ++K L+ ++D L+ ++ SG+++L   ++  K 
Sbjct: 744 AQQAGGGLVQQAVEMNGHKVIVAQLEDTEAKALRGIVDDLKNQLGSGVVLLA-TAQGSKV 802

Query: 837 SVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASFL 896
           S++  VT+DL     A DL   +A V+ GG GGGRP MAQ+GG N     +A+A   S+L
Sbjct: 803 SLIAGVTKDLTSIVKAGDLVNQAANVV-GGKGGGRPDMAQAGGSNPEHLSEALATATSWL 861

Query: 897 KK 898
           ++
Sbjct: 862 EQ 863


>gi|83719349|ref|YP_443176.1| alanyl-tRNA synthetase [Burkholderia thailandensis E264]
 gi|167620352|ref|ZP_02388983.1| alanyl-tRNA synthetase [Burkholderia thailandensis Bt4]
 gi|257139409|ref|ZP_05587671.1| alanyl-tRNA synthetase [Burkholderia thailandensis E264]
 gi|123536505|sp|Q2SV73|SYA_BURTA RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA
           ligase; Short=AlaRS
 gi|83653174|gb|ABC37237.1| alanyl-tRNA synthetase [Burkholderia thailandensis E264]
          Length = 874

 Score =  913 bits (2360), Expect = 0.0,   Method: Composition-based stats.
 Identities = 380/912 (41%), Positives = 537/912 (58%), Gaps = 55/912 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
              + IR  FL+FF+  GH ++ SSSL+P NDPTL+FTNSGMV FK++F G E   Y   
Sbjct: 1   MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA 60

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLD 121
           TT Q+ VRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT  + L 
Sbjct: 61  TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTTVYKLP 120

Query: 122 QRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPCSE 174
             +L++TVY +D+EA+ +W K  G+ A++IIRI  N       DNFW M +TGPCGPCSE
Sbjct: 121 ADKLWVTVYHDDDEAYDIWAKEVGVPAERIIRIGDNKGARYASDNFWQMGDTGPCGPCSE 180

Query: 175 IFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERM 233
           IF+D G  + GG PGS  E+G+RYIEIWNLVFMQF +  +     LPK  +DTGMGLER+
Sbjct: 181 IFYDHGPGVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKPCVDTGMGLERI 240

Query: 234 ATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPA 293
           A VLQ   +NY+IDLF+ LI+AS + TG+    NN  + +VI DH+R+ SFLI DG++P 
Sbjct: 241 AAVLQHVHSNYEIDLFQQLIKASARETGVADLANN--SLKVIADHIRACSFLIVDGVIPG 298

Query: 294 NEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRS 353
           NEGRGYVLRRI+RRA+ +   LG   P    L+  L  EMG+AYPEL +A+  + + LR 
Sbjct: 299 NEGRGYVLRRIVRRAIRHGYKLGRKGPFFHKLVADLVAEMGAAYPELKEAEQRVTDVLRQ 358

Query: 354 EDERFGKTLDRGLVLLD--GVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           E+ERF +T++ G+ +L+           + L+G++AFKL+DT+G PLD+  D+   RG+ 
Sbjct: 359 EEERFFETIEHGMSILEAALADLDAAGGKTLDGELAFKLHDTYGFPLDLTADVCRERGVT 418

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D  +F+ A+  QR +ARA      +         L+     T F GY+ +        
Sbjct: 419 -VDEPAFDDAMARQREQARAAGKFKATQG-------LEYTGAKTTFHGYEEIAFDD---- 466

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             + V A+  +G  V E  +G+   VV D TPFYAE+GGQ+GD 
Sbjct: 467 ------------------AKVVALYVEGASVGEVKAGESAVVVLDHTPFYAESGGQVGDQ 508

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G       R  + D  K    +  HH  +E+G+L+   ++   ID   R + + NHSATH
Sbjct: 509 GVLANAATRFAVADTLKVQADVIGHHGELEQGVLKVGDAVRAEIDAARRARTARNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           L+H AL  +LGSHV Q GS +  D  RFD  H+ P+T  E++ +E  VN+ +  N P + 
Sbjct: 569 LMHKALRDVLGSHVQQKGSLVDADKTRFDFAHNAPLTDDEIRRVEAIVNEQVLANAPGIV 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
           R+M  +DA+  GA AL G KY D VRV+ +        S  LCGGTHV  TG+I L  IV
Sbjct: 629 RVMPYDDAVKGGAMALFGEKYGDEVRVLDLG------FSRELCGGTHVHRTGDIGLFKIV 682

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           +E  + AGIRR+EAITG  A  ++   D ++ + A+ LK     ++ R+ ++ ++ + L+
Sbjct: 683 AEGGVAAGIRRVEAITGDNAVRYVQALDARVNAAAAALKAQPSELIQRIGQVQDQVKSLE 742

Query: 772 LIHAKRKLQLNVEDL-----SCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
                 K +L             ++  V+ ++  +   D+K L+  +D L+ K++S  I+
Sbjct: 743 KELGALKSKLASSQGDELAQQAVEVGGVHVLAATLDGADAKTLRETVDKLKDKLKSAAIV 802

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  +    K S++  VT D   +  A +L    A+ + GG GGGRP MAQ+GG       
Sbjct: 803 LAAVD-GGKVSLIAGVTADASKKVKAGELVNFVAQQV-GGKGGGRPDMAQAGGTEPANLP 860

Query: 887 QAIAGVASFLKK 898
            A+AGV  ++++
Sbjct: 861 AALAGVKGWVEE 872


>gi|322831421|ref|YP_004211448.1| alanyl-tRNA synthetase [Rahnella sp. Y9602]
 gi|321166622|gb|ADW72321.1| alanyl-tRNA synthetase [Rahnella sp. Y9602]
          Length = 875

 Score =  913 bits (2360), Expect = 0.0,   Method: Composition-based stats.
 Identities = 390/911 (42%), Positives = 549/911 (60%), Gaps = 56/911 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH ++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHNIVSSSSLVPTNDPTLLFTNAGMNQFKDVFLGLDKRDYNRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW+LLT    F+
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAINYAWELLTGENWFN 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + +L++TVY+ D+EAF++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKEKLWVTVYETDDEAFEIWEKEVGVPKERIIRIGDNKGGAFASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS+ E+G+RYIEIWNLVFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSAEEDGDRYIEIWNLVFMQFNRQADGTMLPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+  V+Q   +NYDIDLF+ LI A  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RITAVMQHVNSNYDIDLFQKLIAAVAEVTGATD--LSNKSLRVIADHIRSCAFLIADGVI 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  +     L+  L   MG A  EL + + ++E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAIRHGNMLGAQDTFFYKLVAPLIEVMGPAATELKEQQAMVEQLL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G++AF+LYDT G PLD+  D+   R L 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAALK-GDTLDGEIAFRLYDTFGFPLDLTADVCRERNLK 419

Query: 412 GIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKE 471
            +D   F +A++ QR RAR       S      + S+    G TQF GY+ L+       
Sbjct: 420 -VDEAGFEKAMDVQRRRARE------SSGFSADYNSMVRVDGVTQFSGYEHLQRH----- 467

Query: 472 DRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDT 531
                             S V A+   G+ V +  +G    VV D TPFY E+GGQ+GD 
Sbjct: 468 ------------------SKVVALFVDGQPVNDIQAGVNAIVVLDDTPFYGESGGQVGDK 509

Query: 532 GCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATH 591
           G          ++D QK  +    H   +  G L    S+   +D   R ++ +NHSATH
Sbjct: 510 GILKTTTGVFSVSDTQKYGK-AIGHQGALSAGKLSIGDSVEAEVDVARRDRIRLNHSATH 568

Query: 592 LLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVT 651
           LLH AL  +LG HV+Q GS +  + LRFD +H + +   E++ +ED VN  I +NLP+ T
Sbjct: 569 LLHAALRQVLGKHVAQKGSLVNDNYLRFDFSHFEAMKPEEIRQVEDLVNAQIRRNLPIQT 628

Query: 652 RIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIV 711
            IM+ ++A   GA AL G KY D VRV+S+     G  S+ LCGGTH S TG+I L  I 
Sbjct: 629 TIMDLDEAKEKGAMALFGEKYEDSVRVLSM-----GDFSTELCGGTHASRTGDIGLFRIQ 683

Query: 712 SESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQ 771
           SES   AG+RRIE ITG+ A + L  Q + L+ +A  +K    ++  ++  + E  R L+
Sbjct: 684 SESGTAAGVRRIEGITGENAINALHQQSDLLQDVAHLVKGDVNSITDKIRSLIERSRTLE 743

Query: 772 LIHAKRKLQLNVEDLS-----CHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIM 826
               + K Q   ++ +       ++  V  +      V+ K L++++D L+ ++ S II+
Sbjct: 744 KELQQVKGQQAAQESASLSSQAKEVKGVKLLVRQFDNVEPKMLRTMVDDLKNQLGSVIIV 803

Query: 827 LVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKAD 886
           L  I+ + K S++  VT+DL DR  A +L    A+ + GG GGGRP MAQ+GG +     
Sbjct: 804 LATIA-DDKVSLIAGVTKDLTDRVKAGELIASVAQQV-GGKGGGRPDMAQAGGSDVQALP 861

Query: 887 QAIAGVASFLK 897
            A+A V ++++
Sbjct: 862 AALATVEAWVE 872


>gi|85708967|ref|ZP_01040033.1| AlaS, alanyl-tRNA synthetase [Erythrobacter sp. NAP1]
 gi|85690501|gb|EAQ30504.1| AlaS, alanyl-tRNA synthetase [Erythrobacter sp. NAP1]
          Length = 887

 Score =  913 bits (2359), Expect = 0.0,   Method: Composition-based stats.
 Identities = 445/910 (48%), Positives = 593/910 (65%), Gaps = 38/910 (4%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M++ + IR +FL+FF    H  + S+ L+P NDPTLMF N+GMVPFKN+FTG E P    
Sbjct: 1   MTSTNDIRRSFLDFFASEDHVEVQSAPLVPHNDPTLMFVNAGMVPFKNVFTGLETPPGPR 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
            T+ QKCVRAGGKHNDLDNVG T RHHTFFEMLGNFSFG YFKE+AI  AW LLTKE+ L
Sbjct: 61  ATSSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEQAILNAWTLLTKEWGL 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
              +L  TVY  D+EAF LW+KISGL  ++IIRI T DNFWSM +TGPCGPCSEIF+D G
Sbjct: 121 APEKLTATVYHTDDEAFDLWRKISGLPEERIIRIATADNFWSMGDTGPCGPCSEIFYDHG 180

Query: 181 ECIPGGLP-GSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQE 239
           E IPGG P    E+G+R+IEIWNLVFMQF+Q     R  LP  SIDTGMGLER+A V+Q 
Sbjct: 181 EHIPGGPPGSPDEDGDRFIEIWNLVFMQFDQAADGTRRDLPSPSIDTGMGLERIAAVMQG 240

Query: 240 KTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGY 299
             +NYD D FK LI ASE +T +   G N  +HRVI DHLRS+SFL+ADG+LP+NEGRGY
Sbjct: 241 VHDNYDTDTFKALIAASENLTEVPASGENTASHRVIADHLRSTSFLMADGVLPSNEGRGY 300

Query: 300 VLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFG 359
           VLRRIMRRAM +A LLG +EPLM  L+PAL +EMG AYP L + + LIEE L  E+ +F 
Sbjct: 301 VLRRIMRRAMRHAHLLGASEPLMHRLVPALVSEMGQAYPGLQRGQSLIEEVLLREETQFR 360

Query: 360 KTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFN 419
           KTLD+GL LLD     + +   L+G+ AFKLYDT+G P D+ +D L ARG   +D   F+
Sbjct: 361 KTLDKGLKLLDEATGSMSEGGELDGETAFKLYDTYGFPYDLTEDALRARG-ISVDRGGFD 419

Query: 420 QALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQK 479
           +A+  Q++ ARA   G G   +++IWF + E+ GAT+F GY    G              
Sbjct: 420 EAMARQKAAARAAWKGSGEAASDEIWFDIAEREGATEFTGYSTTSG-------------- 465

Query: 480 PPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGI 539
                       V A+V+ G  V+ A +G +V V+ +QTPFY E+GGQ GDTG       
Sbjct: 466 ---------EGTVVALVKDGAEVDSASAGDEVVVLTNQTPFYGESGGQTGDTGTISTPTG 516

Query: 540 R-LQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALS 598
               +TD  K    +  H A +  G ++   ++ L +D + R Q+  NHSATHL+H AL 
Sbjct: 517 LAADVTDTSKPLGRLHAHQARITAGKVKVGDNVQLDVDAERRTQIRANHSATHLVHAALR 576

Query: 599 TILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNRED 658
             LG HV+Q GS ++ + LRFD +H KP+++ ++ +IED VN  I  N PV TR+M+ +D
Sbjct: 577 NQLGDHVTQKGSLVSQERLRFDFSHPKPLSAEDIVAIEDEVNAEILANEPVGTRLMSPDD 636

Query: 659 AIASGAAALLGTKYNDRVRVVSVE--YEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSI 716
           A+ +GA AL G KY D VRV+S+      G  +S  LCGGTHVS+TG+I L  IVSE ++
Sbjct: 637 AVEAGALALFGEKYGDEVRVLSMGRSGGSGRNYSVELCGGTHVSATGDIGLFRIVSEGAV 696

Query: 717 RAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAK 776
            +G+RRIEA+TG  AR+ L+ ++E LKS+A  ++ +   V  RV  + +E ++L+   A+
Sbjct: 697 SSGVRRIEALTGDAARNWLVAREEALKSVAGAIRATPEEVPARVAALLDERKRLEKELAE 756

Query: 777 RKLQLNVEDLSC---------HKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIML 827
            K  L +               ++A V F   ++  ++ KEL+ ++D  + ++ +G+  +
Sbjct: 757 AKKALALGGGGSGGGPAASADEQVAGVAFSGQVLEGLNPKELRPLLDEAKARLGTGVAAI 816

Query: 828 VGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQ 887
           V +  + KAS+   VT+DL D+F+AVDL R   + LGG GGGGRP MAQ GGP+G+KA +
Sbjct: 817 VAV-NDGKASIAAAVTDDLTDKFSAVDLVRAGVEALGGKGGGGRPDMAQGGGPDGSKAAE 875

Query: 888 AIAGVASFLK 897
           AIA V S L+
Sbjct: 876 AIASVKSVLE 885


>gi|237729651|ref|ZP_04560132.1| alanyl-tRNA synthetase [Citrobacter sp. 30_2]
 gi|226908257|gb|EEH94175.1| alanyl-tRNA synthetase [Citrobacter sp. 30_2]
          Length = 875

 Score =  913 bits (2359), Expect = 0.0,   Method: Composition-based stats.
 Identities = 393/910 (43%), Positives = 564/910 (61%), Gaps = 56/910 (6%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 3   KSTAEIRQAFLDFFHSKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 62

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AIQ AW+LLT    F 
Sbjct: 63  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIQYAWELLTGENWFA 122

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 123 LPKERLWVTVYETDDEAYEIWEKEVGIPRERIIRIGDNKGAAYASDNFWQMGDTGPCGPC 182

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS+ E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 183 TEIFYDHGDHIWGGPPGSAEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 242

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NY+IDLF+ LI++  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 243 RIAAVLQHVNSNYEIDLFRSLIESVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVV 300

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  +     L+  L   MGSA  EL + ++++E+ L
Sbjct: 301 PSNENRGYVLRRIIRRAVRHGNMLGAKDTFFYKLVGPLVDVMGSAGEELKRQQVMVEQVL 360

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 361 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGE