RPSBLAST alignment for GI: 254780191 and conserved domain: PRK00413

>gnl|CDD|179011 PRK00413, thrS, threonyl-tRNA synthetase; Reviewed. Length = 638
 Score = 55.9 bits (136), Expect = 4e-08
 Identities = 39/140 (27%), Positives = 60/140 (42%), Gaps = 37/140 (26%)

Query: 585 INHSATHLLHHAL-----STILGSHVSQNGSCITP---DGLRFDVTHSKPITSAELKSIE 636
           I HSA HLL  A+        L          I P   +G  +D    +P T  +L++IE
Sbjct: 71  IRHSAAHLLAQAVKRLYPDAKLT---------IGPVIENGFYYDFDRERPFTPEDLEAIE 121

Query: 637 DNVNDIIAQNLPVVTRIMNREDAIASGAAALLGTKY----------NDRVRV-VSVEYED 685
             + +II +N P+   +++RE+AI        G  Y          ++ + +    E+ D
Sbjct: 122 KEMKEIIKENYPIEREVVSREEAIELFKD--RGEPYKVELIEEIPEDEEISLYRQGEFVD 179

Query: 686 GGVHSSALCGGTHVSSTGEI 705
                  LC G HV STG+I
Sbjct: 180 -------LCRGPHVPSTGKI 192