RPSBLAST alignment for GI: 254780193 and conserved domain: PRK13632

>gnl|CDD|184192 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional. Length = 271
 Score =  100 bits (252), Expect = 7e-22
 Identities = 72/232 (31%), Positives = 127/232 (54%), Gaps = 14/232 (6%)

Query: 288 VSFRSVSFVYPGKSKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSV 347
           +   +VSF YP  S+ + LKNV+F +  GE +A++G +G+GK++I  ++     P SG +
Sbjct: 8   IKVENVSFSYP-NSENNALKNVSFEINEGEYVAILGHNGSGKSTISKILTGLLKPQSGEI 66

Query: 348 EIEGIDLRLLSLEEIRRFIAWVPQHP--IMIAASVYDNIAIGCPHA--TRKEIQNAAMLA 403
           +I+GI +   +L+EIR+ I  + Q+P    I A+V D+IA G  +     K+++   +  
Sbjct: 67  KIDGITISKENLKEIRKKIGIIFQNPDNQFIGATVEDDIAFGLENKKVPPKKMK-DIIDD 125

Query: 404 QAHEFIGCLENGYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQ 463
            A +       G +  L     +LS GQ QR+AIA  +  +  I++ DE  S LD + ++
Sbjct: 126 LAKKV------GMEDYLDKEPQNLSGGQKQRVAIASVLALNPEIIIFDESTSMLDPKGKR 179

Query: 464 KIWKVLREQR--RGRTTIFASHRLSAIQDADMVFVLHDQVIVEKGVHEELLK 513
           +I K++ + R  R +T I  +H +     AD V V  +  ++ +G  +E+L 
Sbjct: 180 EIKKIMVDLRKTRKKTLISITHDMDEAILADKVIVFSEGKLIAQGKPKEILN 231