RPSBLAST alignment for GI: 254780193 and conserved domain: cd03218

>gnl|CDD|72977 cd03218, ABC_YhbG, The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids. The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis. YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein. Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli. The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.. Length = 232
 Score = 89.4 bits (222), Expect = 2e-18
 Identities = 61/227 (26%), Positives = 112/227 (49%), Gaps = 15/227 (6%)

Query: 302 KRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSL-E 360
           KR ++  V+ +V+ GE + L+G +GAGKT+ F +I+    P SG + ++G D+  L + +
Sbjct: 12  KRKVVNGVSLSVKQGEIVGLLGPNGAGKTTTFYMIVGLVKPDSGKILLDGQDITKLPMHK 71

Query: 361 EIRRFIAWVPQHP-IMIAASVYDNI-AIGCPHATRKEIQNAAMLAQAHEFIGCLENGYDT 418
             R  I ++PQ   I    +V +NI A+       K+ +   +     EF          
Sbjct: 72  RARLGIGYLPQEASIFRKLTVEENILAVLEIRGLSKKEREEKLEELLEEF------HITH 125

Query: 419 ILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALD---IENEQKIWKVLREQRRG 475
           +    A  LS G+ +R+ IARA+  +   LLLDE  + +D   +++ QKI K+L++  RG
Sbjct: 126 LRKSKASSLSGGERRRVEIARALATNPKFLLLDEPFAGVDPIAVQDIQKIIKILKD--RG 183

Query: 476 RTTIFASHRLS-AIQDADMVFVLHDQVIVEKGVHEELLKKSGFYAHY 521
              +   H +   +   D  +++++  ++ +G  EE+         Y
Sbjct: 184 IGVLITDHNVRETLSITDRAYIIYEGKVLAEGTPEEIAANELVRKVY 230