Query gi|254780196|ref|YP_003064609.1| hypothetical protein CLIBASIA_00405 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 125 No_of_seqs 126 out of 939 Neff 5.3 Searched_HMMs 39220 Date Mon May 23 11:24:04 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780196.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR00810 secG preprotein tran 99.9 4.9E-23 1.2E-27 131.0 7.2 67 2-68 1-77 (77) 2 PRK06870 secG preprotein trans 99.9 6.2E-22 1.6E-26 125.6 7.4 68 1-68 1-74 (74) 3 COG1314 SecG Preprotein transl 99.8 2E-21 5.2E-26 123.0 7.4 72 1-72 1-77 (86) 4 pfam03840 SecG Preprotein tran 99.8 2.6E-21 6.7E-26 122.5 6.3 68 2-69 1-74 (74) 5 PRK09510 tolA cell envelope in 92.5 0.13 3.3E-06 26.0 3.2 34 3-36 16-49 (402) 6 COG3064 TolA Membrane protein 86.1 0.89 2.3E-05 21.9 3.4 36 2-37 15-50 (387) 7 TIGR02794 tolA_full protein To 77.2 2.6 6.6E-05 19.6 3.1 28 4-31 6-34 (452) 8 pfam08229 SHR3_chaperone ER me 74.7 2 5.2E-05 20.1 2.0 23 4-26 61-84 (196) 9 smart00786 SHR3_chaperone ER m 72.3 2.3 5.8E-05 19.9 1.8 23 4-26 61-84 (196) 10 pfam05568 ASFV_J13L African sw 66.1 5.9 0.00015 17.9 2.8 23 1-23 31-53 (189) 11 pfam05961 Chordopox_A13L Chord 59.0 8.6 0.00022 17.0 2.6 14 8-21 6-19 (68) 12 COG4881 Predicted membrane pro 51.4 15 0.00039 15.8 4.7 60 4-63 232-291 (371) 13 PRK13855 type IV secretion sys 46.0 19 0.00049 15.3 7.6 26 47-72 29-54 (377) 14 pfam02157 Man-6-P_recep Cation 40.9 18 0.00045 15.5 1.9 22 3-24 192-213 (278) 15 PRK11677 cytochrome d ubiquino 40.7 18 0.00046 15.5 1.9 23 46-68 45-67 (134) 16 pfam11874 DUF3394 Domain of un 38.7 25 0.00065 14.7 2.4 28 37-64 16-43 (183) 17 COG2322 Predicted membrane pro 37.5 27 0.00068 14.6 2.8 16 53-68 85-100 (177) 18 pfam07423 DUF1510 Protein of u 36.0 28 0.00072 14.5 2.8 13 10-22 20-32 (214) 19 PRK04778 septation ring format 34.5 30 0.00076 14.4 2.5 24 1-24 2-25 (569) 20 pfam04272 Phospholamban Phosph 34.3 30 0.00077 14.4 3.2 19 4-22 32-50 (52) 21 TIGR01941 nqrF NADH:ubiquinone 33.4 31 0.0008 14.3 2.2 23 4-26 3-25 (425) 22 pfam04202 Mfp-3 Foot protein 3 33.4 23 0.00059 14.9 1.5 23 7-29 5-27 (71) 23 TIGR01192 chvA glucan exporter 32.5 28 0.00071 14.5 1.8 42 11-56 254-296 (592) 24 pfam06873 SerH Cell surface im 32.4 24 0.00061 14.8 1.4 26 1-26 1-26 (407) 25 PRK02655 psbI photosystem II r 27.4 39 0.001 13.8 1.8 27 48-74 5-31 (38) 26 pfam11087 DUF2881 Protein of u 27.2 39 0.001 13.8 1.8 27 3-29 7-33 (54) 27 TIGR00867 deg-1 degenerin; Int 26.2 43 0.0011 13.6 3.5 36 38-73 13-51 (757) 28 PRK12452 cardiolipin synthetas 25.9 36 0.00092 14.0 1.4 27 42-68 52-78 (509) 29 PRK04335 cell division protein 25.4 44 0.0011 13.6 2.8 22 1-23 1-22 (319) 30 pfam04238 DUF420 Protein of un 25.0 45 0.0011 13.5 3.2 12 15-26 19-30 (133) 31 KOG1094 consensus 24.9 45 0.0012 13.5 3.0 20 4-23 394-413 (807) 32 pfam07359 LEAP-2 Liver-express 23.2 49 0.0013 13.3 1.8 19 10-28 5-23 (77) 33 PRK05464 Na(+)-translocating N 22.6 45 0.0011 13.5 1.4 26 1-26 1-28 (408) 34 pfam08285 DPM3 Dolichol-phosph 21.6 53 0.0014 13.2 2.7 23 46-68 1-23 (91) No 1 >TIGR00810 secG preprotein translocase, SecG subunit; InterPro: IPR004692 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway. Proteins are produced in the cytoplasm as precursors, and require a chaperone subunit to direct them to the translocase component. . From there, the mature proteins are either targeted to the outer membrane, or remain as periplasmic proteins. The translocase protein subunits are encoded on the bacterial chromosome. The translocase itself comprises 7 proteins, including a chaperone protein (SecB), an ATPase (SecA), an integral membrane complex (SecCY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD and SecF) . The chaperone protein SecB is a highly acidic homotetrameric protein that exists as a "dimer of dimers" in the bacterial cytoplasm. SecB maintains preproteins in an unfolded state after translation, and targets these to the peripheral membrane protein ATPase SecA for secretion . Together with SecY and SecG, SecE forms a multimeric channel through which preproteins are translocated, using both proton motive forces and ATP-driven secretion. The latter is mediated by SecA. SecG has two transmembrane domains, both of which contribute to the recognition of preprotein signal sequences by the translocation complex . The protein also undergoes membrane topology inversion when coupled to the SecA cycle . ; GO: 0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity, 0009306 protein secretion, 0016021 integral to membrane. Probab=99.88 E-value=4.9e-23 Score=130.96 Aligned_cols=67 Identities=27% Similarity=0.489 Sum_probs=60.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHCCCCCCCC-----CCCC--CCCC---CCCHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 35998999999999999997147764422-----2223--3334---665666899999999999999999999972 Q gi|254780196|r 2 QIFLMVVHLIVVVGLVCVILIQSSDSSAF-----GSSS--NFTS---VRSTAHSLGRFTAILAFFFFATSIALGMIS 68 (125) Q Consensus 2 ~~~llvi~vi~~~~Li~~VLlQ~~kg~g~-----G~~~--~~~~---~~g~~~~L~k~T~~la~~F~~~sl~l~~~s 68 (125) |++++++|+++|++||++||||++||+|. |+++ ++|+ +||++|||+|+|||+|++||++|+.|+|++ T Consensus 1 ~~~l~~l~~~~~~~Li~~VLlQ~~Kg~g~g~~fggg~~~~~~Fg~~Ka~g~~~~L~k~T~~la~lF~~~~l~L~~l~ 77 (77) T TIGR00810 1 YTVLLILLIVVALLLIILVLLQPSKGGGLGGSFGGGSGGVSLFGKQKARGAENFLSKITAVLAGLFLVLSLLLAFLS 77 (77) T ss_pred CHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 85999999999999988773247740245676304432104421565541006889999999999999999999629 No 2 >PRK06870 secG preprotein translocase subunit SecG; Reviewed Probab=99.86 E-value=6.2e-22 Score=125.56 Aligned_cols=68 Identities=37% Similarity=0.617 Sum_probs=61.4 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC----CC--CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9359989999999999999971477644222----22--33334665666899999999999999999999972 Q gi|254780196|r 1 MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG----SS--SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMIS 68 (125) Q Consensus 1 M~~~llvi~vi~~~~Li~~VLlQ~~kg~g~G----~~--~~~~~~~g~~~~L~k~T~~la~~F~~~sl~l~~~s 68 (125) ||++++++|+++|++||++||+|++||+|+| ++ +++|++||++|||+|+||++|++|+++|+.|+|++ T Consensus 1 M~~~l~ii~vi~s~~Li~~VLlQ~~kg~gl~~~fggg~s~~~f~~rg~~~~L~k~T~~la~~F~~~sl~l~~~~ 74 (74) T PRK06870 1 MYTLLLVLLLIVAILLIILVLLQSGKGAGLGGLFGGGASSTLFGARGAENFLTRLTAVLAVLFFVLSLVLGYLS 74 (74) T ss_pred CHHHHHHHHHHHHHHHHHHHEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 92179999999999999883213688766313557876677616753100999999999999999999999859 No 3 >COG1314 SecG Preprotein translocase subunit SecG [Intracellular trafficking and secretion] Probab=99.85 E-value=2e-21 Score=123.00 Aligned_cols=72 Identities=28% Similarity=0.536 Sum_probs=64.6 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC----C-CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC Q ss_conf 93599899999999999999714776442222----2-333346656668999999999999999999999726677 Q gi|254780196|r 1 MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS----S-SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTS 72 (125) Q Consensus 1 M~~~llvi~vi~~~~Li~~VLlQ~~kg~g~G~----~-~~~~~~~g~~~~L~k~T~~la~~F~~~sl~l~~~s~~~~ 72 (125) |+++++++++++|++||++||+|++||+|+|+ + +++|++||.+|||+|+|+||+++||++++.|+++.+++. T Consensus 1 m~~~ll~i~i~~a~~LI~~VLlQ~~kg~g~gas~gggs~~lFgarG~~~~L~r~T~iLa~lF~i~~i~L~~~~~~~~ 77 (86) T COG1314 1 MMTLLLVILIVVALALIILVLLQRGKGAGLGASFGGGSGQLFGARGVENFLTRTTAILAVLFFIISLVLALLNSKKG 77 (86) T ss_pred CHHHHHHHHHHHHHHHHHHEEEECCCCCCCCCCCCCCCHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC T ss_conf 98999999999999999761453589998534427971435403326689999999999999999999999873013 No 4 >pfam03840 SecG Preprotein translocase SecG subunit. Probab=99.84 E-value=2.6e-21 Score=122.48 Aligned_cols=68 Identities=32% Similarity=0.560 Sum_probs=60.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHCCCCCCCCC----C--CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 359989999999999999971477644222----2--2333346656668999999999999999999999726 Q gi|254780196|r 2 QIFLMVVHLIVVVGLVCVILIQSSDSSAFG----S--SSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISR 69 (125) Q Consensus 2 ~~~llvi~vi~~~~Li~~VLlQ~~kg~g~G----~--~~~~~~~~g~~~~L~k~T~~la~~F~~~sl~l~~~s~ 69 (125) |++++++|+++|++||.+||+|++||+|+| + ++++|+.|++.|||+|+||++|++||++|+.|+++++ T Consensus 1 ~~~llii~~iisi~LI~~VLlQ~~Kg~gl~~~fggg~~~~~fg~~~~~~~L~k~T~~la~lF~~~sl~L~~l~~ 74 (74) T pfam03840 1 YTILLVLHVIVAILLIILVLLQPGKGAGLGGAFGGGASQSLFGSRGARGFLTKLTAVLAVLFFVLSLALAYLSS 74 (74) T ss_pred CEEHHHHHHHHHHHHHHHEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCC T ss_conf 96548999999999998625036888753234567765667377650108999999999999999999999719 No 5 >PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional Probab=92.51 E-value=0.13 Score=25.97 Aligned_cols=34 Identities=21% Similarity=0.305 Sum_probs=23.7 Q ss_pred HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC Q ss_conf 5998999999999999997147764422222333 Q gi|254780196|r 3 IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF 36 (125) Q Consensus 3 ~~llvi~vi~~~~Li~~VLlQ~~kg~g~G~~~~~ 36 (125) .|-+++|+|+-.+||+--|.++-..+|+|+++++ T Consensus 16 iiSv~LHiiLi~lLIwgS~~~~~e~~ggG~gG~~ 49 (402) T PRK09510 16 IISAVLHIILFALLIWSSFDENVEASGGGGGGSV 49 (402) T ss_pred HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCE T ss_conf 9999999999999998001113214689998773 No 6 >COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Probab=86.06 E-value=0.89 Score=21.86 Aligned_cols=36 Identities=22% Similarity=0.261 Sum_probs=26.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC Q ss_conf 359989999999999999971477644222223333 Q gi|254780196|r 2 QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT 37 (125) Q Consensus 2 ~~~llvi~vi~~~~Li~~VLlQ~~kg~g~G~~~~~~ 37 (125) .+|-+|+|+|+--+||+--|-+..+-.|+|+|++++ T Consensus 15 iiiS~vLH~iLfalLIwgS~~~~~e~~~gG~gg~vi 50 (387) T COG3064 15 IIISAVLHIILFALLIWGSLDETIEASGGGGGGSVI 50 (387) T ss_pred HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEE T ss_conf 769999999999999983002203556888876400 No 7 >TIGR02794 tolA_full protein TolA; InterPro: IPR014161 TolA couples the inner membrane complex of itself with TolQ and TolR to the outer membrane complex of TolB and OprL (also called Pal). Most of the length of the protein consists of low-complexity sequence that may differ in both length and composition from one species to another, complicating efforts to discriminate TolA (the most divergent gene in the tol-pal system) from paralogs such as TonB. Selection of members of the seed alignment and criteria for setting scoring cut-offs are based largely on conserved operon structure. The Tol-Pal complex is required for maintaining outer membrane integrity, and is also involved in transport (uptake) of colicins and filamentous DNA, and implicated in pathogenesis. Transport is energized by the proton motive force. TolA is an inner membrane protein that interacts with periplasmic TolB and with outer membrane porins OmpC, PhoE and LamB.. Probab=77.21 E-value=2.6 Score=19.58 Aligned_cols=28 Identities=21% Similarity=0.324 Sum_probs=20.5 Q ss_pred HHHHHHHHHHHHHHHH-HHHCCCCCCCCC Q ss_conf 9989999999999999-971477644222 Q gi|254780196|r 4 FLMVVHLIVVVGLVCV-ILIQSSDSSAFG 31 (125) Q Consensus 4 ~llvi~vi~~~~Li~~-VLlQ~~kg~g~G 31 (125) +=++||||+-++|++. .+.+..+-.+.| T Consensus 6 ~s~~lH~~l~~~L~~~~~~~~~~~~~p~~ 34 (452) T TIGR02794 6 LSVLLHILLLGLLILGASLTHSSEPEPGG 34 (452) T ss_pred HHHHHHHHHHHHHHHHHHHHCCCCCCCCC T ss_conf 99999999999999712330131678775 No 8 >pfam08229 SHR3_chaperone ER membrane protein SH3. This family of proteins are membrane localized chaperones that are required for correct plasma membrane localisation of amino acid permeases (AAPs). SH3 prevents AAPs proteins from aggregating and assists in their correct folding. In the absence of SH3, AAPs are retained in the ER. Probab=74.70 E-value=2 Score=20.11 Aligned_cols=23 Identities=17% Similarity=0.437 Sum_probs=17.3 Q ss_pred HHHHHHHHHHHHHHHH-HHHCCCC Q ss_conf 9989999999999999-9714776 Q gi|254780196|r 4 FLMVVHLIVVVGLVCV-ILIQSSD 26 (125) Q Consensus 4 ~llvi~vi~~~~Li~~-VLlQ~~k 26 (125) +.-++|.++.+.+|+. +=+-+.. T Consensus 61 V~~~Lh~V~~lGliG~~ikL~kp~ 84 (196) T pfam08229 61 VHYILHIVIGLGLIGHFIKLYKPS 84 (196) T ss_pred HHHHHHHHHHHHHHHHHHHHCCCC T ss_conf 999999999986687676310797 No 9 >smart00786 SHR3_chaperone ER membrane protein SH3. This family of proteins are membrane localised chaperones that are required for correct plasma membrane localisation of amino acid permeases (AAPs) PUBMED:15623581. Shr3 prevents AAPs proteins from aggregating and assists in their correct folding. In the absence of Shr3, AAPs are retained in the ER. Probab=72.28 E-value=2.3 Score=19.87 Aligned_cols=23 Identities=17% Similarity=0.580 Sum_probs=16.2 Q ss_pred HHHHHHHHHHHHHHHHHH-HCCCC Q ss_conf 998999999999999997-14776 Q gi|254780196|r 4 FLMVVHLIVVVGLVCVIL-IQSSD 26 (125) Q Consensus 4 ~llvi~vi~~~~Li~~VL-lQ~~k 26 (125) +.-++|.++.+.||+.+. +-+.. T Consensus 61 v~~iLh~Vi~lGliG~~iKL~kp~ 84 (196) T smart00786 61 VLYILHIVIGLGLIGFFIKLYKPS 84 (196) T ss_pred HHHHHHHHHHHHHHHHHHEEECCC T ss_conf 999999999985465420022697 No 10 >pfam05568 ASFV_J13L African swine fever virus J13L protein. This family consists of several African swine fever virus J13L proteins. Probab=66.07 E-value=5.9 Score=17.86 Aligned_cols=23 Identities=17% Similarity=0.470 Sum_probs=12.2 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 93599899999999999999714 Q gi|254780196|r 1 MQIFLMVVHLIVVVGLVCVILIQ 23 (125) Q Consensus 1 M~~~llvi~vi~~~~Li~~VLlQ 23 (125) ||++|+.|-|++-+.+|.+-|.- T Consensus 31 mytiliaivvliiiiivliylfs 53 (189) T pfam05568 31 MYTILIAIVVLIIIIIVLIYLFS 53 (189) T ss_pred HHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999999972 No 11 >pfam05961 Chordopox_A13L Chordopoxvirus A13L protein. This family consists of A13L proteins from the Chordopoxviruses. A13L or p8 is one of the three most abundant membrane proteins of the intracellular mature Vaccinia virus. Probab=59.01 E-value=8.6 Score=17.03 Aligned_cols=14 Identities=21% Similarity=0.608 Sum_probs=6.5 Q ss_pred HHHHHHHHHHHHHH Q ss_conf 99999999999997 Q gi|254780196|r 8 VHLIVVVGLVCVIL 21 (125) Q Consensus 8 i~vi~~~~Li~~VL 21 (125) +.+++|+++|++|+ T Consensus 6 lLi~ICVavi~lIv 19 (68) T pfam05961 6 ILVIICVAIIGLIV 19 (68) T ss_pred HHHHHHHHHHHHHH T ss_conf 99999999999999 No 12 >COG4881 Predicted membrane protein [Function unknown] Probab=51.42 E-value=15 Score=15.79 Aligned_cols=60 Identities=15% Similarity=0.179 Sum_probs=38.9 Q ss_pred HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 998999999999999997147764422222333346656668999999999999999999 Q gi|254780196|r 4 FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIA 63 (125) Q Consensus 4 ~llvi~vi~~~~Li~~VLlQ~~kg~g~G~~~~~~~~~g~~~~L~k~T~~la~~F~~~sl~ 63 (125) -++-+|-..++++..+-++|-+-=...|++..++-.-....|.-..-.+++.+-|+.++. T Consensus 232 sll~ihG~AAi~i~~iliLqv~~w~~~~gg~~y~av~~~~~~~m~a~~il~litfi~~li 291 (371) T COG4881 232 SLLMIHGLAAILITEILILQVGYWLLPGGGIEYYAVLRGSMFIMNAYYILALITFISLLI 291 (371) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHCCHHHHHHHHHHHHHHHHHHHHH T ss_conf 899997699999999999999998177888016876322388887999999999999987 No 13 >PRK13855 type IV secretion system protein VirB10; Provisional Probab=45.97 E-value=19 Score=15.34 Aligned_cols=26 Identities=23% Similarity=0.202 Sum_probs=17.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHCCCC Q ss_conf 99999999999999999999726677 Q gi|254780196|r 47 GRFTAILAFFFFATSIALGMISRYTS 72 (125) Q Consensus 47 ~k~T~~la~~F~~~sl~l~~~s~~~~ 72 (125) .|....++.+-.+.+|.|.|+..+.. T Consensus 29 g~~~l~i~gvi~a~~l~l~Wl~~~~~ 54 (377) T PRK13855 29 GSQKLIVAGVVLALSLSLIWLGGRSK 54 (377) T ss_pred CHHHHHHHHHHHHHHHHHHHHCCCCC T ss_conf 06899999999999999998555786 No 14 >pfam02157 Man-6-P_recep Cation-dependent mannose-6-phosphate receptor. Probab=40.91 E-value=18 Score=15.50 Aligned_cols=22 Identities=27% Similarity=0.380 Sum_probs=16.4 Q ss_pred HHHHHHHHHHHHHHHHHHHHCC Q ss_conf 5998999999999999997147 Q gi|254780196|r 3 IFLMVVHLIVVVGLVCVILIQS 24 (125) Q Consensus 3 ~~llvi~vi~~~~Li~~VLlQ~ 24 (125) .+|+|+.+++++.||+-+|.|+ T Consensus 192 IllIif~~l~a~Ylv~G~lyqr 213 (278) T pfam02157 192 ILLVIFASLVAVYIIGGFLYQR 213 (278) T ss_pred EEHHHHHHHHHHHHHHHHHHHH T ss_conf 3014589999999999999999 No 15 >PRK11677 cytochrome d ubiquinol oxidase subunit III; Provisional Probab=40.75 E-value=18 Score=15.48 Aligned_cols=23 Identities=17% Similarity=0.219 Sum_probs=10.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999972 Q gi|254780196|r 46 LGRFTAILAFFFFATSIALGMIS 68 (125) Q Consensus 46 L~k~T~~la~~F~~~sl~l~~~s 68 (125) |.+--.=+.--|.-++=.+.-|+ T Consensus 45 l~~Yr~ev~~HF~~tA~Ll~~l~ 67 (134) T PRK11677 45 LEEYRQELVDHFARSAELLDTMA 67 (134) T ss_pred HHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999999999 No 16 >pfam11874 DUF3394 Domain of unknown function (DUF3394). This domain is functionally uncharacterized. This domain is found in bacteria. This presumed domain is about 190 amino acids in length. This domain is found associated with pfam06808. Probab=38.74 E-value=25 Score=14.74 Aligned_cols=28 Identities=7% Similarity=-0.055 Sum_probs=23.9 Q ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 3466566689999999999999999999 Q gi|254780196|r 37 TSVRSTAHSLGRFTAILAFFFFATSIAL 64 (125) Q Consensus 37 ~~~~g~~~~L~k~T~~la~~F~~~sl~l 64 (125) |.+.-.+=|++|..||=-++|++.|++| T Consensus 16 FtAATQG~f~~k~rw~E~i~LLlIafsL 43 (183) T pfam11874 16 FAAATQGYFLTKSRWWESAALLLIAFTL 43 (183) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9998747887773899999999999999 No 17 >COG2322 Predicted membrane protein [Function unknown] Probab=37.55 E-value=27 Score=14.64 Aligned_cols=16 Identities=19% Similarity=0.291 Sum_probs=5.8 Q ss_pred HHHHHHHHHHHHHHHH Q ss_conf 9999999999999972 Q gi|254780196|r 53 LAFFFFATSIALGMIS 68 (125) Q Consensus 53 la~~F~~~sl~l~~~s 68 (125) ++.+|+++-+.-.++. T Consensus 85 l~l~FlvlYltr~~l~ 100 (177) T COG2322 85 LALVFLVLYLTRHGLG 100 (177) T ss_pred HHHHHHHHHHHHHHCC T ss_conf 9999999999998255 No 18 >pfam07423 DUF1510 Protein of unknown function (DUF1510). This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown. Probab=35.98 E-value=28 Score=14.51 Aligned_cols=13 Identities=23% Similarity=0.391 Sum_probs=4.3 Q ss_pred HHHHHHHHHHHHH Q ss_conf 9999999999971 Q gi|254780196|r 10 LIVVVGLVCVILI 22 (125) Q Consensus 10 vi~~~~Li~~VLl 22 (125) |.+.++||++|.- T Consensus 20 I~iV~llIiiva~ 32 (214) T pfam07423 20 IGIVVVLIIIVAY 32 (214) T ss_pred HHHHHHHHHHHHH T ss_conf 9999999999766 No 19 >PRK04778 septation ring formation regulator EzrA; Provisional Probab=34.48 E-value=30 Score=14.38 Aligned_cols=24 Identities=13% Similarity=0.494 Sum_probs=16.1 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHCC Q ss_conf 935998999999999999997147 Q gi|254780196|r 1 MQIFLMVVHLIVVVGLVCVILIQS 24 (125) Q Consensus 1 M~~~llvi~vi~~~~Li~~VLlQ~ 24 (125) |..++++|.+++.+++++.+++++ T Consensus 2 ~~~iii~iivlvii~~~~~~~~rr 25 (569) T PRK04778 2 MIILIIAIVVIIIIAYLVGYILRK 25 (569) T ss_pred EEHHHHHHHHHHHHHHHHHHHHHH T ss_conf 001789999999999999999999 No 20 >pfam04272 Phospholamban Phospholamban. The regulation of calcium levels across the membrane of the sarcoplasmic reticulum involves the interplay of many membrane proteins. Phospholamban is a 52 residue integral membrane protein that is involved in reversibly inhibiting the Ca(2+) pump and regulating the flow of Ca ions across the sarcoplasmic reticulum membrane during muscle contraction and relaxation. Phospholamban is thought to form a pentamer in the membrane. Probab=34.33 E-value=30 Score=14.37 Aligned_cols=19 Identities=21% Similarity=0.735 Sum_probs=11.0 Q ss_pred HHHHHHHHHHHHHHHHHHH Q ss_conf 9989999999999999971 Q gi|254780196|r 4 FLMVVHLIVVVGLVCVILI 22 (125) Q Consensus 4 ~llvi~vi~~~~Li~~VLl 22 (125) ++-.-.+++|++||..|.+ T Consensus 32 fvnfclilicllliciivm 50 (52) T pfam04272 32 FINFCLILICLLLICIIVM 50 (52) T ss_pred HHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999999 No 21 >TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit; InterPro: IPR010205 This entry represents the NqrF subunit of the six-protein, Na(+)-pumping NADH-quinone reductase of a number of marine and pathogenic Gram-negative bacteria.; GO: 0016655 oxidoreductase activity acting on NADH or NADPH quinone or similar compound as acceptor, 0051537 2 iron 2 sulfur cluster binding, 0006814 sodium ion transport, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane. Probab=33.36 E-value=31 Score=14.29 Aligned_cols=23 Identities=35% Similarity=0.534 Sum_probs=18.6 Q ss_pred HHHHHHHHHHHHHHHHHHHCCCC Q ss_conf 99899999999999999714776 Q gi|254780196|r 4 FLMVVHLIVVVGLVCVILIQSSD 26 (125) Q Consensus 4 ~llvi~vi~~~~Li~~VLlQ~~k 26 (125) +=.+++.++.+.|+++||+-+.| T Consensus 3 ~~~~~F~~i~l~Lv~~iL~ak~k 25 (425) T TIGR01941 3 LAVVMFTLIVLILVVVILLAKSK 25 (425) T ss_pred HHHHHHHHHHHHHHHHHHHHHHH T ss_conf 26578999999999999986774 No 22 >pfam04202 Mfp-3 Foot protein 3. Mytilus foot protein-3 (Mfp-3) is a highly polymorphic protein family located in the byssal adhesive plaques of blue mussels. Probab=33.35 E-value=23 Score=14.94 Aligned_cols=23 Identities=17% Similarity=0.290 Sum_probs=18.7 Q ss_pred HHHHHHHHHHHHHHHHCCCCCCC Q ss_conf 99999999999999714776442 Q gi|254780196|r 7 VVHLIVVVGLVCVILIQSSDSSA 29 (125) Q Consensus 7 vi~vi~~~~Li~~VLlQ~~kg~g 29 (125) -+-|++++.||+.--+|.+.++. T Consensus 5 Sv~VLvaLVLIGsFAVqSDA~~y 27 (71) T pfam04202 5 SVSVLVALVLIGSFAVESDAAAY 27 (71) T ss_pred HHHHHHHHHHHHHEEEEECCCCC T ss_conf 05899999985120353045434 No 23 >TIGR01192 chvA glucan exporter ATP-binding protein; InterPro: IPR005896 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This family contains glucan exporter ATP binding protein in bacteria. It belongs to the larger ABC transporter superfamily with the characteristic ATP binding motif. In general, this protein is in some ways implicated in osmo-regulation and is suggested to participate in the export of glucan from the cytoplasm to periplasm. The cyclic beta-1,2-glucan in the bacterial periplasmic space is suggested to confer the property of high osmolority. It has also been demonstrated that mutants in this loci have lost functions of virulence and motility. It is unclear as to how virulence and osmo-adaptaion are related. ; GO: 0005215 transporter activity, 0006810 transport. Probab=32.47 E-value=28 Score=14.54 Aligned_cols=42 Identities=14% Similarity=0.338 Sum_probs=24.4 Q ss_pred HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHH-HHHHHHHHHHH Q ss_conf 99999999997147764422222333346656668-99999999999 Q gi|254780196|r 11 IVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHS-LGRFTAILAFF 56 (125) Q Consensus 11 i~~~~Li~~VLlQ~~kg~g~G~~~~~~~~~g~~~~-L~k~T~~la~~ 56 (125) ++|+++|+.||+|+|+-.-+ .+..+-|-.|. ..|+--+-+++ T Consensus 254 ~~~iL~~G~~lV~~G~L~VG----eViaFiGFa~LlIGRLDQ~~~F~ 296 (592) T TIGR01192 254 MMIILVIGTVLVKKGELSVG----EVIAFIGFANLLIGRLDQMKGFI 296 (592) T ss_pred HHHHHHHHHHHEECCCCCCC----CEEEHHHHHHHHHHHHHHHHHHH T ss_conf 99999986770214753336----22422316768863799999999 No 24 >pfam06873 SerH Cell surface immobilisation antigen SerH. This family consists of several cell surface immobilisation antigen SerH proteins which seem to be specific to Tetrahymena thermophila. The SerH locus of Tetrahymena thermophila is one of several paralogous loci with genes encoding variants of the major cell surface protein known as the immobilisation antigen (i-ag). Probab=32.40 E-value=24 Score=14.85 Aligned_cols=26 Identities=31% Similarity=0.350 Sum_probs=22.4 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHCCCC Q ss_conf 93599899999999999999714776 Q gi|254780196|r 1 MQIFLMVVHLIVVVGLVCVILIQSSD 26 (125) Q Consensus 1 M~~~llvi~vi~~~~Li~~VLlQ~~k 26 (125) ||.-+|||.+|++-+||-+|--.+|. T Consensus 1 m~~~~~i~~L~i~~llvs~isa~~G~ 26 (407) T pfam06873 1 MQNKTLIICLIISQLLVSVISATAGN 26 (407) T ss_pred CCCCEEEHHHHHHHHHHHHHHHCCCC T ss_conf 98635658899999999996432797 No 25 >PRK02655 psbI photosystem II reaction center I protein I; Provisional Probab=27.41 E-value=39 Score=13.82 Aligned_cols=27 Identities=19% Similarity=0.498 Sum_probs=20.4 Q ss_pred HHHHHHHHHHHHHHHHHHHHHCCCCCC Q ss_conf 999999999999999999972667776 Q gi|254780196|r 48 RFTAILAFFFFATSIALGMISRYTSTR 74 (125) Q Consensus 48 k~T~~la~~F~~~sl~l~~~s~~~~~~ 74 (125) |+..+..+.||+.-+..+++++..+.. T Consensus 5 Ki~VY~vV~fFv~lFiFGfLs~Dp~Rn 31 (38) T PRK02655 5 KISVYIVVFFFVGIFVFGFLSSDPTRT 31 (38) T ss_pred EEEHHHHHHHHHHHHHHHHCCCCCCCC T ss_conf 873377899999999886305898899 No 26 >pfam11087 DUF2881 Protein of unknown function (DUF2881). This viral family of proteins has no known function. Some members are annotated as p34 however this cannot be confirmed. Probab=27.16 E-value=39 Score=13.81 Aligned_cols=27 Identities=22% Similarity=0.453 Sum_probs=22.1 Q ss_pred HHHHHHHHHHHHHHHHHHHHCCCCCCC Q ss_conf 599899999999999999714776442 Q gi|254780196|r 3 IFLMVVHLIVVVGLVCVILIQSSDSSA 29 (125) Q Consensus 3 ~~llvi~vi~~~~Li~~VLlQ~~kg~g 29 (125) +++.++--|+.+.++.++.-|++..+| T Consensus 7 ~iitiltaiigvaiiavivs~~sntag 33 (54) T pfam11087 7 PIITILTAIIGVAIIAVIVSQNSNTAG 33 (54) T ss_pred CHHHHHHHHHHHHHHHEEEECCCCCCC T ss_conf 079999999988774114423788401 No 27 >TIGR00867 deg-1 degenerin; InterPro: IPR004726 The Caenorhabditis elegans mec-4 gene encodes a subunit of a candidate mechano-sensitive ion channel that plays a critical role in touch reception . The product is a mechano-sensory protein (degenerin). At least some of the proteins in this group form part of a mechano-transducing complex for touch sensitivity. Others include the acid-sensing ion channels, ASIC1-3 that are homo- or hetero-oligomeric neuronal H+-gated channels that mediate pain sensation in response to tissue acidosis. Mammalian ENaC (IPR004724 from INTERPRO) is important for the maintenance of Na+ balance and the regulation of blood pressure. Three homologous ENaC subunits, a, b and g, have been shown to assemble to form the highly Na+-selective channel. ; GO: 0005216 ion channel activity, 0006811 ion transport, 0016021 integral to membrane. Probab=26.21 E-value=43 Score=13.63 Aligned_cols=36 Identities=22% Similarity=0.420 Sum_probs=26.6 Q ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHHHHH---HHCCCCC Q ss_conf 46656668999999999999999999999---7266777 Q gi|254780196|r 38 SVRSTAHSLGRFTAILAFFFFATSIALGM---ISRYTST 73 (125) Q Consensus 38 ~~~g~~~~L~k~T~~la~~F~~~sl~l~~---~s~~~~~ 73 (125) ...-+.|++.|+-|++.++|++..|++-. +.++... T Consensus 13 ~~~~a~N~~~R~~W~~~fl~cl~~f~~q~~~~i~Ky~~~ 51 (757) T TIGR00867 13 MVATASNGFSRYVWVLLFLFCLLMFLYQAYLLISKYNRY 51 (757) T ss_pred EEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC T ss_conf 024625168899999999999999999999999997158 No 28 >PRK12452 cardiolipin synthetase; Reviewed Probab=25.93 E-value=36 Score=13.98 Aligned_cols=27 Identities=7% Similarity=-0.042 Sum_probs=16.3 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 666899999999999999999999972 Q gi|254780196|r 42 TAHSLGRFTAILAFFFFATSIALGMIS 68 (125) Q Consensus 42 ~~~~L~k~T~~la~~F~~~sl~l~~~s 68 (125) .-+.-+++.|++.++|+=.-=.+.|+- T Consensus 52 ~R~p~~~laWllvi~~lP~~G~ilYl~ 78 (509) T PRK12452 52 NRSPQSTLAWFLVLALLPVIGVLLYSI 78 (509) T ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHE T ss_conf 697889999999999999999999991 No 29 >PRK04335 cell division protein ZipA; Provisional Probab=25.37 E-value=44 Score=13.55 Aligned_cols=22 Identities=18% Similarity=0.360 Sum_probs=11.4 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 93599899999999999999714 Q gi|254780196|r 1 MQIFLMVVHLIVVVGLVCVILIQ 23 (125) Q Consensus 1 M~~~llvi~vi~~~~Li~~VLlQ 23 (125) |+-+=+|+.||-+| .|+.+|++ T Consensus 1 MQdLrlILIIvGaI-AIiALL~H 22 (319) T PRK04335 1 MQELRFVLIVVGAL-AIAALLFH 22 (319) T ss_pred CCHHHHHHHHHHHH-HHHHHHHH T ss_conf 93140299999999-99999984 No 30 >pfam04238 DUF420 Protein of unknown function (DUF420). Predicted membrane protein with four transmembrane helices. Probab=25.04 E-value=45 Score=13.52 Aligned_cols=12 Identities=25% Similarity=0.241 Sum_probs=5.0 Q ss_pred HHHHHHHHCCCC Q ss_conf 999999714776 Q gi|254780196|r 15 GLVCVILIQSSD 26 (125) Q Consensus 15 ~Li~~VLlQ~~k 26 (125) ++.+.+.+-+++ T Consensus 19 L~~G~~~Ik~~~ 30 (133) T pfam04238 19 LLAGVRFIRRGN 30 (133) T ss_pred HHHHHHHHHHCC T ss_conf 999999999387 No 31 >KOG1094 consensus Probab=24.90 E-value=45 Score=13.50 Aligned_cols=20 Identities=15% Similarity=0.557 Sum_probs=8.3 Q ss_pred HHHHHHHHHHHHHHHHHHHC Q ss_conf 99899999999999999714 Q gi|254780196|r 4 FLMVVHLIVVVGLVCVILIQ 23 (125) Q Consensus 4 ~llvi~vi~~~~Li~~VLlQ 23 (125) |++.+.++.++++|+++.|- T Consensus 394 ~~~f~~if~iva~ii~~~L~ 413 (807) T KOG1094 394 IIIFVAIFLIVALIIALMLW 413 (807) T ss_pred HHHHHHHHHHHHHHHHHHHH T ss_conf 78999999999999999999 No 32 >pfam07359 LEAP-2 Liver-expressed antimicrobial peptide 2 precursor (LEAP-2). This family consists of several mammalian liver-expressed antimicrobial peptide 2 (LEAP-2) sequences. LEAP-2 is a cysteine-rich, and cationic protein. LEAP-2 contains a core structure with two disulfide bonds formed by cysteine residues in relative 1-3 and 2-4 positions. LEAP-2 is synthesized as a 77-residue precursor, which is predominantly expressed in the liver and highly conserved among mammals. The largest native LEAP-2 form of 40 amino acid residues is generated from the precursor at a putative cleavage site for a furin-like endoprotease. In contrast to smaller LEAP-2 variants, this peptide exhibits dose-dependent antimicrobial activity against selected microbial model organisms. The exact function of this family is unclear. Probab=23.24 E-value=49 Score=13.33 Aligned_cols=19 Identities=32% Similarity=0.635 Sum_probs=13.6 Q ss_pred HHHHHHHHHHHHHCCCCCC Q ss_conf 9999999999971477644 Q gi|254780196|r 10 LIVVVGLVCVILIQSSDSS 28 (125) Q Consensus 10 vi~~~~Li~~VLlQ~~kg~ 28 (125) -+.+++||.++|+|+-.|. T Consensus 5 kL~a~~lv~LlL~~Qv~~S 23 (77) T pfam07359 5 KLFAVLLICLLLLAQVDGS 23 (77) T ss_pred HHHHHHHHHHHHHHHCCCC T ss_conf 9999999999997204589 No 33 >PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Probab=22.64 E-value=45 Score=13.52 Aligned_cols=26 Identities=35% Similarity=0.471 Sum_probs=15.5 Q ss_pred CHHHHH--HHHHHHHHHHHHHHHHCCCC Q ss_conf 935998--99999999999999714776 Q gi|254780196|r 1 MQIFLM--VVHLIVVVGLVCVILIQSSD 26 (125) Q Consensus 1 M~~~ll--vi~vi~~~~Li~~VLlQ~~k 26 (125) |..+++ +++.++.++|+.++|.-++| T Consensus 1 ~~~i~~~~~~f~~~~~~lv~~il~a~~~ 28 (408) T PRK05464 1 MMEIILGVVMFTAIVLILVAVILFAKSK 28 (408) T ss_pred CCEEEHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9166527999999999999999999752 No 34 >pfam08285 DPM3 Dolichol-phosphate mannosyltransferase subunit 3 (DPM3). This family corresponds to subunit 3 of dolichol-phosphate mannosyltransferase, an enzyme which generates mannosyl donors for glycosylphosphatidylinositols, N-glycan and protein O- and C-mannosylation. DPM3 is an integral membrane protein and plays a role in stabilising the dolichol-phosphate mannosyl transferase complex. Probab=21.61 E-value=53 Score=13.16 Aligned_cols=23 Identities=13% Similarity=0.316 Sum_probs=14.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999972 Q gi|254780196|r 46 LGRFTAILAFFFFATSIALGMIS 68 (125) Q Consensus 46 L~k~T~~la~~F~~~sl~l~~~s 68 (125) |+|.+-|+..++.+.++-++.+- T Consensus 1 MTk~~q~l~~~~ll~~~wlal~~ 23 (91) T pfam08285 1 MTKATEWLLLLVLLSALYLALLL 23 (91) T ss_pred CCHHHHHHHHHHHHHHHHHHHHH T ss_conf 94799999999999999999998 Done!