RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780196|ref|YP_003064609.1| hypothetical protein CLIBASIA_00405 [Candidatus Liberibacter asiaticus str. psy62] (125 letters) >d1muwa_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces olivochromogenes [TaxId: 1963]} Length = 386 Score = 25.7 bits (56), Expect = 1.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Query: 90 QGNDNFGDGSSPKLDSVSA 108 QG D FGD + P LD V Sbjct: 20 QGRDPFGDATRPALDPVET 38 >d1eysm_ f.26.1.1 (M:) M (medium) subunit {Thermochromatium tepidum [TaxId: 1050]} Length = 318 Score = 25.5 bits (56), Expect = 1.4 Identities = 10/70 (14%), Positives = 26/70 (37%), Gaps = 8/70 (11%) Query: 4 FLMVVHLIVVVGLVCVILIQSSDSSAFG----SSSNFTSVRSTAHS---LGRFTAILAFF 56 F + +V+G + ++ S + A ++T+ S + F + F Sbjct: 149 FAAAIFFYLVLGFIRPVM-MGSWAKAVPFGIFPHLDWTAAFSIRYGNLYYNPFHMLSIAF 207 Query: 57 FFATSIALGM 66 + +++ M Sbjct: 208 LYGSALLFAM 217 >d1bxba_ c.1.15.3 (A:) D-xylose isomerase {Thermus aquaticus, subsp. Thermophilus [TaxId: 271]} Length = 387 Score = 25.4 bits (55), Expect = 1.7 Identities = 8/20 (40%), Positives = 10/20 (50%) Query: 89 DQGNDNFGDGSSPKLDSVSA 108 + G D FGD +LD V Sbjct: 19 NVGRDPFGDAVRERLDPVYV 38 >d1xlma_ c.1.15.3 (A:) D-xylose isomerase {Arthrobacter, strain b3728 [TaxId: 1663]} Length = 393 Score = 25.3 bits (55), Expect = 1.8 Identities = 8/19 (42%), Positives = 9/19 (47%) Query: 90 QGNDNFGDGSSPKLDSVSA 108 G D FG + LD V A Sbjct: 19 TGADPFGVATRKNLDPVEA 37 >d2i5nm1 f.26.1.1 (M:1-323) M (medium) subunit {Rhodopseudomonas viridis [TaxId: 1079]} Length = 323 Score = 25.1 bits (55), Expect = 2.0 Identities = 10/69 (14%), Positives = 23/69 (33%), Gaps = 6/69 (8%) Query: 4 FLMVVHLIVVVGLVCVILIQS-SDSSAFGSSSNFTSVRSTAHSLGRFT-----AILAFFF 57 F + ++ +G + L+ S S+ FG + + + + G F F Sbjct: 148 FAAAIFFVLCIGCIHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWHGFSIGFA 207 Query: 58 FATSIALGM 66 + + Sbjct: 208 YGCGLLFAA 216 >d1xima_ c.1.15.3 (A:) D-xylose isomerase {Actinoplanes missouriensis [TaxId: 1866]} Length = 392 Score = 24.9 bits (54), Expect = 2.3 Identities = 9/19 (47%), Positives = 10/19 (52%) Query: 90 QGNDNFGDGSSPKLDSVSA 108 Q D FGD + LD V A Sbjct: 19 QARDAFGDATRTALDPVEA 37 >d2axtb1 f.55.1.1 (B:2-489) Photosystem II core light harvesting protein PsbB {Thermosynechococcus elongatus [TaxId: 146786]} Length = 488 Score = 24.8 bits (54), Expect = 2.4 Identities = 12/41 (29%), Positives = 14/41 (34%), Gaps = 10/41 (24%) Query: 22 IQSSDSSAFGSSS-NFTSVRS---TAHSLGRFTAILAFFFF 58 I D+ S TS R AH A+ A FF Sbjct: 428 IFEFDTETLNSDGIFRTSPRGWFTFAH------AVFALLFF 462 >d2axtc1 f.55.1.1 (C:27-473) Photosystem II CP43 protein PsbC {Thermosynechococcus elongatus [TaxId: 146786]} Length = 447 Score = 23.6 bits (51), Expect = 5.1 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 10/41 (24%) Query: 22 IQSSDSSAFGSSS-NFTSVR---STAHSLGRFTAILAFFFF 58 + S A +S NF S R +T+H +LAFFF Sbjct: 378 LNSVGGVATEINSVNFVSPRSWLATSH------FVLAFFFL 412 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.320 0.129 0.347 Gapped Lambda K H 0.267 0.0442 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 370,086 Number of extensions: 12945 Number of successful extensions: 33 Number of sequences better than 10.0: 1 Number of HSP's gapped: 33 Number of HSP's successfully gapped: 13 Length of query: 125 Length of database: 2,407,596 Length adjustment: 75 Effective length of query: 50 Effective length of database: 1,377,846 Effective search space: 68892300 Effective search space used: 68892300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.0 bits)