BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780198|ref|YP_003064611.1| hypothetical protein CLIBASIA_00415 [Candidatus Liberibacter asiaticus str. psy62] (69 letters) Database: nr 13,984,884 sequences; 4,792,584,752 total letters Searching..................................................done Results from round 1 >gi|254780198|ref|YP_003064611.1| hypothetical protein CLIBASIA_00415 [Candidatus Liberibacter asiaticus str. psy62] gi|254039875|gb|ACT56671.1| hypothetical protein CLIBASIA_00415 [Candidatus Liberibacter asiaticus str. psy62] Length = 69 Score = 135 bits (341), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 69/69 (100%), Positives = 69/69 (100%) Query: 1 MIQHFWIAVDVFVIVATIITCFFMNKQCAWWLRVFLPFLLISIMIVHITHISGHVNFLLF 60 MIQHFWIAVDVFVIVATIITCFFMNKQCAWWLRVFLPFLLISIMIVHITHISGHVNFLLF Sbjct: 1 MIQHFWIAVDVFVIVATIITCFFMNKQCAWWLRVFLPFLLISIMIVHITHISGHVNFLLF 60 Query: 61 PPLSMIFLK 69 PPLSMIFLK Sbjct: 61 PPLSMIFLK 69 >gi|315122625|ref|YP_004063114.1| hypothetical protein CKC_04385 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496027|gb|ADR52626.1| hypothetical protein CKC_04385 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 68 Score = 94.7 bits (234), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 43/63 (68%), Positives = 55/63 (87%) Query: 1 MIQHFWIAVDVFVIVATIITCFFMNKQCAWWLRVFLPFLLISIMIVHITHISGHVNFLLF 60 MI++FWIAVDV VI++TIITCFFMNKQ +WW+RV +P LLIS+M+VHI +ISG +NF LF Sbjct: 1 MIKNFWIAVDVLVIISTIITCFFMNKQFSWWIRVLVPSLLISVMVVHIAYISGQINFFLF 60 Query: 61 PPL 63 P + Sbjct: 61 PAI 63 Searching..................................................done Results from round 2 CONVERGED! >gi|254780198|ref|YP_003064611.1| hypothetical protein CLIBASIA_00415 [Candidatus Liberibacter asiaticus str. psy62] gi|254039875|gb|ACT56671.1| hypothetical protein CLIBASIA_00415 [Candidatus Liberibacter asiaticus str. psy62] Length = 69 Score = 73.7 bits (180), Expect = 8e-12, Method: Composition-based stats. Identities = 69/69 (100%), Positives = 69/69 (100%) Query: 1 MIQHFWIAVDVFVIVATIITCFFMNKQCAWWLRVFLPFLLISIMIVHITHISGHVNFLLF 60 MIQHFWIAVDVFVIVATIITCFFMNKQCAWWLRVFLPFLLISIMIVHITHISGHVNFLLF Sbjct: 1 MIQHFWIAVDVFVIVATIITCFFMNKQCAWWLRVFLPFLLISIMIVHITHISGHVNFLLF 60 Query: 61 PPLSMIFLK 69 PPLSMIFLK Sbjct: 61 PPLSMIFLK 69 >gi|315122625|ref|YP_004063114.1| hypothetical protein CKC_04385 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496027|gb|ADR52626.1| hypothetical protein CKC_04385 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 68 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 43/63 (68%), Positives = 55/63 (87%) Query: 1 MIQHFWIAVDVFVIVATIITCFFMNKQCAWWLRVFLPFLLISIMIVHITHISGHVNFLLF 60 MI++FWIAVDV VI++TIITCFFMNKQ +WW+RV +P LLIS+M+VHI +ISG +NF LF Sbjct: 1 MIKNFWIAVDVLVIISTIITCFFMNKQFSWWIRVLVPSLLISVMVVHIAYISGQINFFLF 60 Query: 61 PPL 63 P + Sbjct: 61 PAI 63 Database: nr Posted date: May 13, 2011 4:10 AM Number of letters in database: 999,999,932 Number of sequences in database: 2,987,209 Database: /data/usr2/db/fasta/nr.01 Posted date: May 13, 2011 4:17 AM Number of letters in database: 999,998,956 Number of sequences in database: 2,896,973 Database: /data/usr2/db/fasta/nr.02 Posted date: May 13, 2011 4:23 AM Number of letters in database: 999,999,979 Number of sequences in database: 2,907,862 Database: /data/usr2/db/fasta/nr.03 Posted date: May 13, 2011 4:29 AM Number of letters in database: 999,999,513 Number of sequences in database: 2,932,190 Database: /data/usr2/db/fasta/nr.04 Posted date: May 13, 2011 4:33 AM Number of letters in database: 792,586,372 Number of sequences in database: 2,260,650 Lambda K H 0.336 0.156 0.531 Lambda K H 0.267 0.0472 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,617,001,740 Number of Sequences: 13984884 Number of extensions: 64194823 Number of successful extensions: 508861 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 31 Number of HSP's that attempted gapping in prelim test: 508819 Number of HSP's gapped (non-prelim): 62 length of query: 69 length of database: 4,792,584,752 effective HSP length: 41 effective length of query: 28 effective length of database: 4,219,204,508 effective search space: 118137726224 effective search space used: 118137726224 T: 11 A: 40 X1: 16 ( 7.8 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (21.1 bits) S2: 76 (33.7 bits)