RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254780199|ref|YP_003064612.1| outer membrane lipoprotein
[Candidatus Liberibacter asiaticus str. psy62]
         (160 letters)



>gnl|CDD|147482 pfam05320, Pox_RNA_Pol_19, Poxvirus DNA-directed RNA polymerase 19
           kDa subunit.  This family contains several DNA-directed
           RNA polymerase 19 kDa polypeptides. The Poxvirus
           DNA-directed RNA polymerase (EC: 2.7.7.6) catalyses
           DNA-template-directed extension of the 3'-end of an RNA
           strand by one nucleotide at a time.
          Length = 167

 Score = 26.2 bits (58), Expect = 3.7
 Identities = 22/97 (22%), Positives = 36/97 (37%), Gaps = 16/97 (16%)

Query: 39  EPMDITGYWEDDNGILSYFQKDGKFKTISTDGSSSV--LATGSYHVKINQDVEIKLTSLI 96
           +  DI  Y  DD+    Y +++   +   +  SS V  L   +Y ++   +     TS  
Sbjct: 3   DSDDIIDYESDDDDSEEYEEEEEDEEDAESLESSDVSSLKQSNYKIESASENIEDATSNP 62

Query: 97  RNTSGKIQCQFLDSNKLNCLAKDQKQFYLRRTHLTEL 133
           +  S KI                 K+ Y RR  L E+
Sbjct: 63  KQVSEKI--------------SAIKRRYTRRISLFEI 85


>gnl|CDD|35107 COG5548, COG5548, Small integral membrane protein [Function
          unknown].
          Length = 105

 Score = 25.7 bits (56), Expect = 5.7
 Identities = 9/36 (25%), Positives = 17/36 (47%)

Query: 52 GILSYFQKDGKFKTISTDGSSSVLATGSYHVKINQD 87
          G++ YF+K+ +   +S   S  +L   +Y     Q 
Sbjct: 18 GLIGYFRKNSQVSLLSGVFSGLLLFVAAYLQLQGQT 53


>gnl|CDD|31333 COG1138, CcmF, Cytochrome c biogenesis factor [Posttranslational
          modification, protein turnover, chaperones].
          Length = 648

 Score = 25.7 bits (56), Expect = 6.1
 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 1/42 (2%)

Query: 6  FLSLSFLFPLVAAIAVVSCSALSVVVDSSELLPEPMDITGYW 47
           L L+F   LV A  V   S   V  +S+ LLP    I   W
Sbjct: 49 LLLLAF-ALLVYAFVVSDFSVQYVAQNSNTLLPLYYKIAAVW 89


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.317    0.132    0.381 

Gapped
Lambda     K      H
   0.267   0.0683    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 1,844,594
Number of extensions: 83838
Number of successful extensions: 184
Number of sequences better than 10.0: 1
Number of HSP's gapped: 184
Number of HSP's successfully gapped: 7
Length of query: 160
Length of database: 6,263,737
Length adjustment: 86
Effective length of query: 74
Effective length of database: 4,405,363
Effective search space: 325996862
Effective search space used: 325996862
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (24.3 bits)