RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780199|ref|YP_003064612.1| outer membrane lipoprotein [Candidatus Liberibacter asiaticus str. psy62] (160 letters) >gnl|CDD|185532 PTZ00260, PTZ00260, dolichyl-phosphate beta-glucosyltransferase; Provisional. Length = 333 Score = 29.7 bits (67), Expect = 0.39 Identities = 23/89 (25%), Positives = 38/89 (42%), Gaps = 23/89 (25%) Query: 55 SYFQKDGKFK---TISTDGSS---SVLATGSYHVKINQDVEIKLTSLIRN---------- 98 S +KD KFK I DGS +A + IN +++I+L SL+RN Sbjct: 98 SRSRKDPKFKYEIIIVNDGSKDKTLKVAKDFWRQNINPNIDIRLLSLLRNKGKGGAVRIG 157 Query: 99 ---TSGKIQCQFLDSN---KLNCLAKDQK 121 + GK +D++ ++ K + Sbjct: 158 MLASRGKY-ILMVDADGATDIDDFDKLED 185 >gnl|CDD|177524 PHA03083, PHA03083, poxvirus myristoylprotein; Provisional. Length = 334 Score = 28.1 bits (63), Expect = 0.97 Identities = 8/22 (36%), Positives = 13/22 (59%) Query: 41 MDITGYWEDDNGILSYFQKDGK 62 ++T YWED++G +S K Sbjct: 91 FNLTHYWEDNDGKISDKYKPNA 112 >gnl|CDD|180100 PRK05463, PRK05463, hypothetical protein; Provisional. Length = 262 Score = 27.5 bits (62), Expect = 1.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Query: 35 ELLPEPMDITGYWEDD 50 EL+ E DIT W DD Sbjct: 94 ELVEEVTDITDLWRDD 109 >gnl|CDD|173171 PRK14708, PRK14708, flagellin; Provisional. Length = 888 Score = 26.4 bits (58), Expect = 3.5 Identities = 8/29 (27%), Positives = 19/29 (65%) Query: 60 DGKFKTISTDGSSSVLATGSYHVKINQDV 88 +GK T +T G+++ + G+Y + ++Q + Sbjct: 222 NGKTITFTTAGAATADSNGNYTIGLDQTL 250 >gnl|CDD|152201 pfam11765, Hyphal_reg_CWP, Hyphally regulated cell wall protein N-terminal. The proteins in this family are all fungal and largely annotated as being hyphally regulated cell wall proteins, and several are listed as the enzyme EC:3.2.1.18. This enzyme is acetylneuraminyl hydrolase or exo-alpha-sialidase, that hydrolyses glycosidic linkages of terminal sialic acid residues in oligosaccharides, glycoproteins, glycolipids, colominic acid and synthetic substrates. Length = 332 Score = 25.5 bits (56), Expect = 6.5 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 9/60 (15%) Query: 33 SSELLPEPMDITGYWEDDNGILSYFQKDGKFKTISTDGSSSVLATGSYHVKINQDVEIKL 92 +S +LP M IT +NG+LS++Q +S V++ G+ I + +I L Sbjct: 121 ASGVLPSTMSITAASWTNNGLLSFYQN---------QRTSGVVSLGTPLGTITNNGQICL 171 >gnl|CDD|130134 TIGR01062, parC_Gneg, DNA topoisomerase IV, A subunit, proteobacterial. Operationally, topoisomerase IV is a type II topoisomerase required for the decatenation of chromosome segregation. Not every bacterium has both a topo II and a topo IV. The topo IV families of the Gram-positive bacteria and the Gram-negative bacteria appear not to represent a single clade among the type II topoisomerases, and are represented by separate models for this reason. Length = 735 Score = 25.3 bits (55), Expect = 8.2 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 6/46 (13%) Query: 112 KLNCLAK-----DQKQFYL-RRTHLTELPSSKPQDDVAEIPEDPTT 151 +LN L K D ++ L RR+ L E +K ++ IP++P T Sbjct: 452 ELNQLVKKEIQADATKYGLARRSSLEEREEAKQVSEIDMIPKEPVT 497 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.317 0.132 0.381 Gapped Lambda K H 0.267 0.0596 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,467,714 Number of extensions: 137334 Number of successful extensions: 281 Number of sequences better than 10.0: 1 Number of HSP's gapped: 281 Number of HSP's successfully gapped: 13 Length of query: 160 Length of database: 5,994,473 Length adjustment: 86 Effective length of query: 74 Effective length of database: 4,136,185 Effective search space: 306077690 Effective search space used: 306077690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (24.5 bits)