BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780199|ref|YP_003064612.1| outer membrane lipoprotein [Candidatus Liberibacter asiaticus str. psy62] (160 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780199|ref|YP_003064612.1| outer membrane lipoprotein [Candidatus Liberibacter asiaticus str. psy62] Length = 160 Score = 329 bits (844), Expect = 1e-92, Method: Compositional matrix adjust. Identities = 160/160 (100%), Positives = 160/160 (100%) Query: 1 MQARCFLSLSFLFPLVAAIAVVSCSALSVVVDSSELLPEPMDITGYWEDDNGILSYFQKD 60 MQARCFLSLSFLFPLVAAIAVVSCSALSVVVDSSELLPEPMDITGYWEDDNGILSYFQKD Sbjct: 1 MQARCFLSLSFLFPLVAAIAVVSCSALSVVVDSSELLPEPMDITGYWEDDNGILSYFQKD 60 Query: 61 GKFKTISTDGSSSVLATGSYHVKINQDVEIKLTSLIRNTSGKIQCQFLDSNKLNCLAKDQ 120 GKFKTISTDGSSSVLATGSYHVKINQDVEIKLTSLIRNTSGKIQCQFLDSNKLNCLAKDQ Sbjct: 61 GKFKTISTDGSSSVLATGSYHVKINQDVEIKLTSLIRNTSGKIQCQFLDSNKLNCLAKDQ 120 Query: 121 KQFYLRRTHLTELPSSKPQDDVAEIPEDPTTPSTSIIFYK 160 KQFYLRRTHLTELPSSKPQDDVAEIPEDPTTPSTSIIFYK Sbjct: 121 KQFYLRRTHLTELPSSKPQDDVAEIPEDPTTPSTSIIFYK 160 >gi|254780663|ref|YP_003065076.1| carbonate dehydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 207 Score = 23.9 bits (50), Expect = 1.5, Method: Compositional matrix adjust. Identities = 9/26 (34%), Positives = 12/26 (46%) Query: 24 CSALSVVVDSSELLPEPMDITGYWED 49 C + V+DS+ P D G W D Sbjct: 105 CGGIQAVLDSNNSSTSPGDFIGKWMD 130 >gi|254781019|ref|YP_003065432.1| hydroxymethylglutaryl-coenzyme A synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 396 Score = 23.9 bits (50), Expect = 1.5, Method: Compositional matrix adjust. Identities = 9/28 (32%), Positives = 17/28 (60%) Query: 23 SCSALSVVVDSSELLPEPMDITGYWEDD 50 C A+++++ S + E DITG + +D Sbjct: 154 GCGAVAILISSQTSILEIEDITGIYTND 181 >gi|254780370|ref|YP_003064783.1| argininosuccinate lyase [Candidatus Liberibacter asiaticus str. psy62] Length = 473 Score = 23.5 bits (49), Expect = 1.9, Method: Compositional matrix adjust. Identities = 9/21 (42%), Positives = 16/21 (76%) Query: 84 INQDVEIKLTSLIRNTSGKIQ 104 I+ ++E +LTSLI + +GK+ Sbjct: 93 IHMNIEARLTSLIGSIAGKMH 113 >gi|254780224|ref|YP_003064637.1| hypothetical protein CLIBASIA_00545 [Candidatus Liberibacter asiaticus str. psy62] Length = 382 Score = 23.5 bits (49), Expect = 2.2, Method: Compositional matrix adjust. Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 67 STDGSSSVLATGSYHV 82 STD S+L+TG +HV Sbjct: 276 STDRVYSILSTGGFHV 291 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.132 0.381 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,458 Number of Sequences: 1233 Number of extensions: 3743 Number of successful extensions: 8 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 6 length of query: 160 length of database: 328,796 effective HSP length: 67 effective length of query: 93 effective length of database: 246,185 effective search space: 22895205 effective search space used: 22895205 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 35 (18.1 bits)