HHsearch alignment for GI: 254780200 and conserved domain: PRK00923

>PRK00923 sirohydrochlorin cobaltochelatase; Reviewed.
Probab=98.11  E-value=0.0002  Score=51.46  Aligned_cols=119  Identities=15%  Similarity=0.131  Sum_probs=85.2

Q ss_pred             CEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEC
Q ss_conf             66999833675026762799888999999999997266756704786225777654430268999989976998399974
Q gi|254780200|r  206 EMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIIT  285 (343)
Q Consensus       206 ~~llfSaHglP~~~~~~gDpY~~q~~~t~~~i~~~l~~~~~~~~l~fQSr~Gp~~WL~P~t~~~l~~L~~~G~k~v~v~p  285 (343)
T Consensus         4 ~alllvgHGSr~~------~~~~~~~~~a~~l~~~~~~--~~V~~afle~------~~P~i~~~~~~l~~~G~~~ivvvP   69 (130)
T PRK00923          4 IGLLLVGHGSRLP------YNKEVVTEIAEKIKEKFPD--YIVEVGFMEF------NEPTIPEALKKFAGTGVDKIIVVP   69 (130)
T ss_pred             EEEEEEECCCCCH------HHHHHHHHHHHHHHHHCCC--CEEEEEEEEC------CCCCHHHHHHHHHHCCCCEEEEEE
T ss_conf             6999997899976------7899999999999985899--8298877615------789899999999966998899986


Q ss_pred             CHHHHCCHHHHHHHHHHHHH-------HHHHCC-CCEEEEECCCCCCHHHHHHHHHHHHHHH
Q ss_conf             40542212558887589999-------999759-9758981689879899999999999984
Q gi|254780200|r  286 PGFSSDCLETSYEIAHEAKE-------IFVNGG-GEKFTQVPCLNSSNLSIDLLEKITRREL  339 (343)
Q Consensus       286 ~gFvsD~lETl~Eidie~~e-------~~~e~G-g~~~~rvp~lN~~~~fi~~La~lv~~~l  339 (343)
T Consensus        70 -~fL~~G~H~~~DIP~~l~~~~~~~~~~~~~~~~~v~i~~~~plG~~p~l~dvl~~R~~EAL  130 (130)
T PRK00923         70 -VFLAHGVHTKRDIPKILGLDEGEKEGEIEEDGKDVELVYAEPIGADPRIADIVLDRANEAL  130 (130)
T ss_pred             -HHHCCCCCCCHHHHHHHHHHHHHCCCCHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHC
T ss_conf             -3016682422001889877675165422213885279977888899799999999999759