HHsearch alignment for GI: 254780200 and conserved domain: cd03411

>cd03411 Ferrochelatase_N Ferrochelatase, N-terminal domain: Ferrochelatase (protoheme ferrolyase or HemH) is the terminal enzyme of the heme biosynthetic pathway. It catalyzes the insertion of ferrous iron into the protoporphyrin IX ring yielding protoheme. This enzyme is ubiquitous in nature and widely distributed in bacteria and eukaryotes. Recently, some archaeal members have been identified. The oligomeric state of these enzymes varies depending on the presence of a dimerization motif at the C-terminus.
Probab=95.88  E-value=0.18  Score=30.81  Aligned_cols=95  Identities=16%  Similarity=0.310  Sum_probs=60.5

Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEC--CHHHHCCHHHHHHHH
Q ss_conf             799888999999999997266756704786225777654430268999989976998399974--405422125588875
Q gi|254780200|r  223 GDPYGCHCHKTARLLKEFLSWPDDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIIT--PGFSSDCLETSYEIA  300 (343)
Q Consensus       223 gDpY~~q~~~t~~~i~~~l~~~~~~~~l~fQSr~Gp~~WL~P~t~~~l~~L~~~G~k~v~v~p--~gFvsD~lETl~Eid  300 (343)
T Consensus        63 ~SPL~~~t~~q~~~L~~~L~~~~~~~~V~~amry~-----~P~i~~~l~~l~~~g~~~iv~lPlyPqyS~sTt~S~~~~-  136 (159)
T cd03411          63 GSPLNEITRAQAEALEKALDERGIDVKVYLAMRYG-----PPSIEEALEELKADGVDRIVVLPLYPQYSASTTGSYLDE-  136 (159)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECC-----CCCHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHH-
T ss_conf             88789999999999999987328995189874327-----998999999998548884999979874131448999999-


Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             899999997599758981689879
Q gi|254780200|r  301 HEAKEIFVNGGGEKFTQVPCLNSS  324 (343)
Q Consensus       301 ie~~e~~~e~Gg~~~~rvp~lN~~  324 (343)
T Consensus       137 -~~~~~~~~~~~~~i~~I~~f~d~  159 (159)
T cd03411         137 -VERALKKLRPAPELRVIRSFYDH  159 (159)
T ss_pred             -HHHHHHHCCCCCEEEEECCCCCC
T ss_conf             -99999964899848982886788