HHsearch alignment for GI: 254780200 and conserved domain: cd03414

>cd03414 CbiX_SirB_C Sirohydrochlorin cobalt chelatase (CbiX) and sirohydrochlorin iron chelatase (SirB), C-terminal domain. SirB catalyzes the ferro-chelation of sirohydrochlorin to siroheme, the prosthetic group of sulfite and nitrite reductases. CbiX is a cobaltochelatase, responsible for the chelation of Co2+ into sirohydrochlorin, an important step in the vitamin B12 biosynthetic pathway. CbiX often contains a C-terminal histidine-rich region that may be important for metal delivery and/or storage, and may also contain an iron-sulfur center. Both CbiX and SirB are found in a wide range of bacteria.
Probab=98.17  E-value=0.00016  Score=52.13  Aligned_cols=115  Identities=20%  Similarity=0.264  Sum_probs=61.3

Q ss_pred             EEEEEECCCCHHHHHHCCC-CHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEC
Q ss_conf             6999833675026762799-888999999999997266756704786225777654430268999989976998399974
Q gi|254780200|r  207 MLLVSFHQMPVSYLLKGDP-YGCHCHKTARLLKEFLSWPDDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIIT  285 (343)
Q Consensus       207 ~llfSaHglP~~~~~~gDp-Y~~q~~~t~~~i~~~l~~~~~~~~l~fQSr~Gp~~WL~P~t~~~l~~L~~~G~k~v~v~p  285 (343)
T Consensus         2 avllvgHGSr-------~p~a~~~~~~la~~l~~~~~~~--~v~~~fle~------~~P~l~e~l~~l~~~G~~~ivvvP   66 (117)
T cd03414           2 AVVLVGRGSS-------DPDANADVAKIARLLEEGTGFA--RVETAFAAA------TRPSLPEALERLRALGARRVVVLP   66 (117)
T ss_pred             EEEEEECCCC-------CHHHHHHHHHHHHHHHHHCCCC--EEEEEEECC------CCCCHHHHHHHHHHCCCCEEEEEE
T ss_conf             8999958999-------8789999999999999768998--188877536------799899999999976997599976


Q ss_pred             CHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHH
Q ss_conf             405422125588875899999997599758981689879899999999999984
Q gi|254780200|r  286 PGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEKITRREL  339 (343)
Q Consensus       286 ~gFvsD~lETl~Eidie~~e~~~e~Gg~~~~rvp~lN~~~~fi~~La~lv~~~l  339 (343)
T Consensus        67 ~-fL~~G~-~~~~i~~~~~~~~-~~p~~~i~~~~pLG~~p~l~~~l~~Ri~eal  117 (117)
T cd03414          67 Y-LLFTGV-LMDRIEEQVAELA-AEPGIEFVLAPPLGPHPELAEALLERVREAL  117 (117)
T ss_pred             H-HHCCCC-HHHHHHHHHHHHH-HCCCCEEEECCCCCCCHHHHHHHHHHHHHHC
T ss_conf             2-312784-2766799999998-4889718988889899899999999999769