HHsearch alignment of GI: 254780200 and MMDB domain: 1tjn_A_1-130

>1tjn_A (A:1-130) Sirohydrochlorin cobaltochelatase; AF0721, APC5049, midwest consortium for structural genomics, protein structure initiative, A. fulgidus; 2.01A {Archaeoglobus fulgidus}
Probab=96.23  E-value=0.03  Score=35.85  Aligned_cols=34  Identities=21%  Similarity=0.322  Sum_probs=22.1

Q ss_pred             CCCHHHHH-CCCCCHHHHHHHHHHCCCCEEEEEECCH
Q ss_conf             43001121-0454247899999870996589963171
Q gi|254780200|r  112 IVVDWAMR-YGKPSVKEIINNLREEGCDRLLIFPLYP  147 (343)
Q Consensus       112 ~~V~~amr-y~~P~i~~~l~~l~~~g~~~ii~lPLyP  147 (343)
                      ..|+.|+- ++.|++++++..  ..|+++|+++|+|=
T Consensus        57 ~~v~~~fle~~~P~l~~~ll~--~~g~~~v~vvP~fl   91 (130)
T 1tjn_A           57 DEVKIAFAARKRRPMPDEAIR--EMNCDIIYVVPLFI   91 (130)
T ss_dssp             SEEEEEECSSSCSSCHHHHHH--HCCCSEEEEEECCS
T ss_pred             CEEEEEEECCCCCCHHHHHHH--HCCCCEEEEHHHHH
T ss_conf             849875421668982999999--74998797618877