HHsearch alignment of GI: 254780200 and MMDB domain: 2jh3_A_118-249

>2jh3_A (A:118-249) Ribosomal protein S2-related protein; CBIX, SAD phasing, structural genomics, chelatase super-family fold, 4Fe-4S iron-sulphur cluster; 1.9A {Deinococcus radiodurans}
Probab=98.40  E-value=1.8e-06  Score=65.18  Aligned_cols=129  Identities=9%  Similarity=-0.028  Sum_probs=102.0

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCC-CCCEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCC-C
Q ss_conf             7800689999999999973389-9866999833675026762799888999999999997266756704786225777-6
Q gi|254780200|r  182 EDSDYISALAQSIREHFESIQW-TPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKICFQSRFGR-I  259 (343)
Q Consensus       182 ~~p~yI~a~~~~I~~~l~~~~~-~~~~llfSaHglP~~~~~~gDpY~~q~~~t~~~i~~~l~~~~~~~~l~fQSr~Gp-~  259 (343)
                      .||..+++++++|.+.+..... ....||+.+||-+.          ...++.++.+.++++.  ..+.+||.+.... .
T Consensus         1 ~hp~i~~~l~~ri~~~~~~~~~~~~~~vvlvaHGS~~----------~~~~~~~~~l~~~~~~--~~v~~~~le~~p~~~   68 (132)
T 2jh3_A            1 AHPGMADAIAAQARDTLPEGTDPADVTLLLLAARPGN----------AALETHAQALRERGQF--AGVEVVLESREALTP   68 (132)
T ss_dssp             GSTTHHHHHHHHHHHHSCTTCCGGGCEEEEEESSTTC----------HHHHHHHHHHHHHCCS--SEEEEEECCCC----
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCC----------CCHHHHHHHHHHHCCC--CCEEEEEEECCCCHH
T ss_conf             6867899999999998621577675499998157754----------2069999999984688--865899984468656


Q ss_pred             CCCCHHHHHHHHHHHHCCCCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHCC-CCEEEEECCCCC
Q ss_conf             5443026899998997699839997440542212558887589999999759-975898168987
Q gi|254780200|r  260 KCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGG-GEKFTQVPCLNS  323 (343)
Q Consensus       260 ~WL~P~t~~~l~~L~~~G~k~v~v~p~gFvsD~lETl~Eidie~~e~~~e~G-g~~~~rvp~lN~  323 (343)
                      .|+.|.+.+.++.+.++|.++|+|+|. |+++..-+..||.-+..+...+.+ +..+...+++++
T Consensus        69 ~~~~~~~~~~~~~~~~~G~~~vvvvP~-fl~~G~H~~~DIp~~l~~~~~~~p~~~~i~~~~~lG~  132 (132)
T 2jh3_A           69 ESHAASAVPLSEWPSRVEAGQAVLVPF-LTHLGKHAAERLQQALAQAAERFPQAPPLHVGGPVGE  132 (132)
T ss_dssp             -----CCEEGGGGGGGCCSSCEEEEEC-SSCCCHHHHHHHHHHHHHHHHHCTTCCCEEECCCGGG
T ss_pred             HHCCCHHHHHHHHHHHCCCCEEEEEEH-HHCCCCCHHHHHHHHHHHHHHHHCCCCCEEEECCCCC
T ss_conf             520213688998887628985999853-3179812144578999987754033676376067889