HHsearch alignment of GI: 254780200 and MMDB domain: 3hcn_A_165-307

>3hcn_A (A:165-307) Ferrochelatase, mitochondrial; metal selectivity, 2Fe-2S, disease mutation, heme biosynthesis, iron, iron-sulfur, lyase, membrane, metal-binding; HET: CHD HEM GOL; 1.60A {Homo sapiens} PDB: 2qd3_A* 2qd5_A* 2qd4_A* 3hco_A* 3hcr_A* 2qd1_A* 2hre_A* 3hcp_A* 2qd2_A* 2hrc_A* 1hrk_A* 2pnj_A* 2po5_A* 2po7_A*
Probab=100.00  E-value=9.1e-44  Score=324.87  Aligned_cols=139  Identities=26%  Similarity=0.479  Sum_probs=129.7

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCC---CCCEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCC
Q ss_conf             7800689999999999973389---9866999833675026762799888999999999997266756704786225777
Q gi|254780200|r  182 EDSDYISALAQSIREHFESIQW---TPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKICFQSRFGR  258 (343)
Q Consensus       182 ~~p~yI~a~~~~I~~~l~~~~~---~~~~llfSaHglP~~~~~~gDpY~~q~~~t~~~i~~~l~~~~~~~~l~fQSr~Gp  258 (343)
                      +||+||++|+++|++++++.+.   ++++|||||||||++++++||||.+||.+|+++|+++||+. ++|.++||||+||
T Consensus         1 ~~P~yi~a~~~~I~~~l~~~~~~~~~~~~lifSaHslP~~~~~~gdpY~~q~~~t~~~i~~~l~~~-~~~~~~~QS~~g~   79 (143)
T 3hcn_A            1 THHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYC-NPYRLVWQSKVGP   79 (143)
T ss_dssp             TCHHHHHHHHHHHHHHHTTSCTTTGGGCEEEEEEECCBHHHHTTTCSHHHHHHHHHHHHHHHTTTC-SCEEEEEECCSCS
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCCCCHHHCCCCCHHHHHHHHHHHHHHHCCC-HHHHHEEECCCCC
T ss_conf             643367889999998750055335788369998304543203317960888999999999873454-0222101147798


Q ss_pred             CCCCCHHHHHHHHHHHHCCCCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHC-CCCEEEEECCC
Q ss_conf             6544302689999899769983999744054221255888758999999975-99758981689
Q gi|254780200|r  259 IKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNG-GGEKFTQVPCL  321 (343)
Q Consensus       259 ~~WL~P~t~~~l~~L~~~G~k~v~v~p~gFvsD~lETl~Eidie~~e~~~e~-Gg~~~~rvp~l  321 (343)
                      ++||+|+|.|+|++|+++|+|+|+|+||||+|||+|||||||+|+||.|.++ |+.+|+|+|||
T Consensus        80 ~~Wl~P~~~~~l~~l~~~G~k~v~v~p~gF~sD~lETlyeidie~~e~~~~~~G~~~~~~vp~L  143 (143)
T 3hcn_A           80 MPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESL  143 (143)
T ss_dssp             SCBSSSBHHHHHHHHHHTTCCEEEEECTTCCSCCCCCHHHHCHHHHHHHHHHTCCCEEEECCCS
T ss_pred             CCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             6666873899999999749972999797313563467998789999999997699648983799