Query         gi|254780200|ref|YP_003064613.1| ferrochelatase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 343
No_of_seqs    129 out of 1620
Neff          6.6 
Searched_HMMs 23785
Date          Mon May 23 11:08:28 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780200.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1lbq_A Ferrochelatase; rossman 100.0       0       0  709.7  24.4  317   15-342     4-329 (362)
  2 3hcn_A Ferrochelatase, mitocho 100.0       0       0  693.0  31.9  318   15-342     1-328 (359)
  3 2h1v_A Ferrochelatase; rossman 100.0       0       0  650.8  28.1  300   15-340     2-309 (310)
  4 1qgo_A CBIK protein, anaerobic  99.8 1.2E-17 5.2E-22  141.9  18.1  197  119-340    56-257 (264)
  5 3lyh_A Cobalamin (vitamin B12)  98.8 1.7E-07 7.1E-12   71.3  13.1  117  206-340     6-122 (126)
  6 2jh3_A Ribosomal protein S2-re  98.6 3.5E-07 1.5E-11   69.1   9.1  203  112-341    42-267 (474)
  7 3lyh_A Cobalamin (vitamin B12)  98.3 8.1E-06 3.4E-10   59.6  10.6   98   99-202    28-125 (126)
  8 1lbq_A Ferrochelatase; rossman  97.9 0.00039 1.6E-08   47.9  12.9   77  264-341   109-188 (362)
  9 3hcn_A Ferrochelatase, mitocho  97.7  0.0012   5E-08   44.6  13.0  112   88-201   209-328 (359)
 10 1qgo_A CBIK protein, anaerobic  97.7 0.00069 2.9E-08   46.2  10.9   99  102-202   158-260 (264)
 11 2h1v_A Ferrochelatase; rossman  97.6 0.00079 3.3E-08   45.8  10.9  108  225-340    55-166 (310)
 12 1tjn_A Sirohydrochlorin cobalt  96.9  0.0051 2.2E-07   40.1   8.5  115  206-338    25-146 (156)
 13 2jh3_A Ribosomal protein S2-re  95.5  0.0097 4.1E-07   38.2   3.6  102   95-199   157-266 (474)
 14 1tjn_A Sirohydrochlorin cobalt  93.9    0.11 4.5E-06   31.0   5.7   83  112-200    57-149 (156)
 15 2prs_A High-affinity zinc upta  91.8    0.75 3.1E-05   25.1   9.6  216   95-341    39-283 (284)
 16 2i6j_A Ssoptp, sulfolobus solf  77.6     3.7 0.00016   20.2   6.2   23  121-143    13-35  (161)
 17 1xla_A D-xylose isomerase; iso  75.0     4.4 0.00018   19.7   5.0   58  127-185   120-187 (394)
 18 2csu_A 457AA long hypothetical  56.7     9.7 0.00041   17.3   5.4   57  266-337   390-447 (457)
 19 2waw_A MOBA relate protein; un  56.0     9.9 0.00042   17.3  10.9   24  120-143    29-52  (199)
 20 3oh8_A Nucleoside-diphosphate   54.2     2.1 8.9E-05   21.9  -0.1   10  186-195   341-350 (516)
 21 2h06_A Ribose-phosphate pyroph  52.4      11 0.00048   16.9  12.0  165  129-322    74-276 (326)
 22 2al1_A Enolase 1, 2-phospho-D-  50.5      12 0.00051   16.7   3.7  187  136-332   165-387 (436)
 23 3cx3_A Lipoprotein; zinc-bindi  47.8      13 0.00056   16.4   8.9  208   95-337    49-278 (284)
 24 1muw_A Xylose isomerase; atomi  47.0      14 0.00057   16.3   4.7  107   95-204    67-208 (386)
 25 1iuk_A Hypothetical protein TT  46.3      13 0.00053   16.5   2.9   44  266-321    83-126 (140)
 26 2d59_A Hypothetical protein PH  46.1      14 0.00059   16.2   4.5   46  264-321    88-133 (144)
 27 3civ_A Endo-beta-1,4-mannanase  45.5      14  0.0006   16.2   4.8   24  267-290   236-259 (343)
 28 1w6t_A Enolase; bacterial infe  42.4      16 0.00067   15.8   5.0  186  136-333   171-396 (444)
 29 2yv2_A Succinyl-COA synthetase  41.5      16 0.00069   15.7   5.4   31  114-144    72-103 (297)
 30 1xim_A D-xylose isomerase; iso  40.6      17 0.00071   15.7   4.4   52   95-146    67-139 (393)
 31 1g01_A Endoglucanase; alpha/be  40.3      17 0.00072   15.6  12.3   25  262-287   243-267 (364)
 32 2wm1_A 2-amino-3-carboxymucona  39.8      17 0.00073   15.6   9.1  104  124-232    55-162 (336)
 33 2akz_A Gamma enolase, neural;   38.3      18 0.00077   15.4   3.3  187  135-333   162-385 (439)
 34 1zy9_A Alpha-galactosidase; TM  37.8      19 0.00078   15.4   3.4   52   95-148   210-273 (564)
 35 2fyw_A Conserved hypothetical   36.8      19 0.00081   15.3   8.8   38  300-339   208-245 (267)
 36 3ipw_A Hydrolase TATD family p  36.4      20 0.00082   15.2   4.1   24  120-143    49-72  (325)
 37 3ff4_A Uncharacterized protein  35.0      20 0.00086   15.1   4.1   37  265-312    70-106 (122)
 38 1y81_A Conserved hypothetical   34.8      21 0.00087   15.0   4.1   45  265-321    81-125 (138)
 39 3irs_A Uncharacterized protein  34.8      21 0.00087   15.0   9.7   18  127-144    80-97  (291)
 40 7a3h_A Endoglucanase; hydrolas  32.8      22 0.00093   14.8  14.0   25  123-148    43-68  (303)
 41 1zcl_A Protein tyrosine phosph  31.9      17 0.00071   15.6   1.7   90  115-217    34-130 (180)
 42 3guw_A Uncharacterized protein  31.3      23 0.00099   14.7   6.6   70  129-200    17-90  (261)
 43 2hzm_A RNA polymerase II media  31.0      16 0.00069   15.7   1.5   19   15-33      2-20  (212)
 44 1oi7_A Succinyl-COA synthetase  31.0      24   0.001   14.6   5.7   22  123-144    75-96  (288)
 45 2wkb_A Macrophage migration in  29.9      25   0.001   14.5   5.8   30  226-255    73-102 (125)
 46 1o97_C Electron transferring f  29.5      25  0.0011   14.5   8.6   77   89-169    36-112 (264)
 47 3gi1_A LBP, laminin-binding pr  29.4      25  0.0011   14.4  10.2  207   95-336    51-279 (286)
 48 3dnf_A ISPH, LYTB, 4-hydroxy-3  29.2      25  0.0011   14.4   3.1   18   21-43     69-86  (297)
 49 3kzq_A Putative uncharacterize  29.0      12  0.0005   16.7   0.5   78  232-340   126-207 (208)
 50 3irv_A Cysteine hydrolase; str  28.9     8.3 0.00035   17.8  -0.3   26    1-26      1-30  (233)
 51 2i1j_A Moesin; FERM, coiled-co  28.2      26  0.0011   14.3   2.3   13  296-308   280-292 (575)
 52 3l49_A ABC sugar (ribose) tran  27.6      27  0.0011   14.2   2.6   19  127-145    52-70  (291)
 53 2bln_A Protein YFBG; transfera  27.1      28  0.0012   14.2   2.4   21  123-143    62-82  (305)
 54 3jr7_A Uncharacterized EGV fam  27.1      28  0.0012   14.2   5.2  117  119-245    79-207 (298)
 55 1wg8_A Predicted S-adenosylmet  26.8      24   0.001   14.6   1.7   17  206-222   228-244 (285)
 56 1xiy_A Peroxiredoxin, pfaop; a  26.0      29  0.0012   14.0   3.2   15  132-146    75-89  (182)
 57 3hh8_A Metal ABC transporter s  25.7      29  0.0012   14.0   9.2  199   95-336    57-286 (294)
 58 3e2v_A 3'-5'-exonuclease; stru  25.3      30  0.0012   14.0   4.9   24  120-143    35-58  (401)
 59 2pa6_A Enolase; glycolysis, ly  24.1      31  0.0013   13.8   4.2  185  136-333   167-382 (427)
 60 2hbv_A 2-amino-3-carboxymucona  23.8      31  0.0013   13.8   8.8   76  124-199    59-138 (334)
 61 2odf_A AGR_C_3887P, hypothetic  23.6      32  0.0013   13.7   3.5   37  177-218   123-159 (257)
 62 3c8f_A Pyruvate formate-lyase   23.2      32  0.0014   13.7   9.1  148   86-243    76-241 (245)
 63 2hsg_A Glucose-resistance amyl  22.5      32  0.0013   13.7   1.7   53   95-147    75-127 (332)
 64 1bqc_A Protein (beta-mannanase  22.5      33  0.0014   13.6  12.0   26  121-147    30-55  (302)
 65 1j6o_A TATD-related deoxyribon  22.2      34  0.0014   13.6   7.8   24  121-144    25-48  (268)
 66 1xwy_A DNAse TATD, deoxyribonu  20.6      36  0.0015   13.3   9.2   56  122-190    18-73  (264)
 67 3m9l_A Hydrolase, haloacid deh  20.6      36  0.0015   13.3   3.5   21  122-142    72-92  (205)
 68 2x6q_A Trehalose-synthase TRET  20.5      36  0.0015   13.3   6.7   22  237-258   221-242 (416)
 69 3ke8_A 4-hydroxy-3-methylbut-2  20.5      37  0.0015   13.3   3.8   30  268-299   215-244 (326)
 70 3gxh_A Putative phosphatase (D  20.3      37  0.0015   13.3   8.0   25  118-143    23-47  (157)
 71 1pzx_A Hypothetical protein AP  20.3      37  0.0015   13.3   6.0  183  119-319    61-264 (289)
 72 2nu8_A Succinyl-COA ligase [AD  20.1      37  0.0016   13.3   5.4   23  122-144    74-96  (288)

No 1  
>1lbq_A Ferrochelatase; rossmann fold, PI-helix, lyase; 2.40A {Saccharomyces cerevisiae} SCOP: c.92.1.1 PDB: 1l8x_A
Probab=100.00  E-value=0  Score=709.66  Aligned_cols=317  Identities=23%  Similarity=0.379  Sum_probs=293.5

Q ss_pred             CCCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCHHHHCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCHHHHH
Q ss_conf             77867999971788899998899999998748954411786888998766651257478899999870778874045777
Q gi|254780200|r   15 KFGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKIKHAYAKIWNTAKNESILRTH   94 (343)
Q Consensus        15 ~~~K~gvLL~n~G~P~~~~~~~V~~yL~~fl~D~~Vi~~p~~~~~~il~~~I~~~R~~~~~~~Y~~Iw~~~gg~SPL~~~   94 (343)
                      .++||||||||||||++++  ||++||++||+|++||++|.++|++ |+++|+++|+++++++|++||    |+|||+.+
T Consensus         4 ~~~~tgvLL~nlGtP~~~~--~V~~yL~~~l~D~~Vi~~p~~~~~~-l~~~I~~~R~~k~~~~Y~~ig----ggSPL~~~   76 (362)
T 1lbq_A            4 KRSPTGIVLMNMGGPSKVE--ETYDFLYQLFADNDLIPISAKYQKT-IAKYIAKFRTPKIEKQYREIG----GGSPIRKW   76 (362)
T ss_dssp             -CCCEEEEEEECCCCSSGG--GHHHHHHHHTTCCSSSCCCSSSHHH-HHHHHHHHHHHHHHHHHHHTT----SSCSHHHH
T ss_pred             CCCCEEEEEEECCCCCCHH--HHHHHHHHHCCCCCCCCCCHHHHHH-HHHHCCCCCCHHHHHHHHHCC----CCCCCHHH
T ss_conf             7797699998789989878--9999999974798634687899999-864217568799999999818----98812999


Q ss_pred             HHHHHHHHHHHHHCC----CCCCCHHHHHCCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             599999999865224----7843001121045424789999987099658996317111001468999999999987179
Q gi|254780200|r   95 TRDQATNLAKRLESI----SSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRW  170 (343)
Q Consensus        95 t~~qa~~L~~~L~~~----~~~~V~~amry~~P~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l~~~~~  170 (343)
                      |+.|+++|++.|++.    .++.|++|||||+|+|++++++|+++|+++|+++|||||||++||||+++++.+++++...
T Consensus        77 T~~qa~~l~~~L~~~~~~~~~~~V~~amry~~P~i~~~l~~l~~~G~~~ii~lPlyPqyS~sTt~s~~~~~~~~l~~~~~  156 (362)
T 1lbq_A           77 SEYQATEVCKILDKTCPETAPHKPYVAFRYAKPLTAETYKQMLKDGVKKAVAFSQYPHFSYSTTGSSINELWRQIKALDS  156 (362)
T ss_dssp             HHHHHHHHHHHHHHHCGGGCCEEEEEEESSSSSCHHHHHHHHHTTTCCEEEEEESCSSCCTTTHHHHHHHHHHHHHHHCT
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCHHHCCCHHHHHHHHHHHHHHHHCC
T ss_conf             99999999987510124576752588733799737789999986598548998676032205223799999999987502


Q ss_pred             C--CCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCC---CCCEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             9--86421334557800689999999999973389---986699983367502676279988899999999999726675
Q gi|254780200|r  171 S--PSLRTVPPYYEDSDYISALAQSIREHFESIQW---TPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPD  245 (343)
Q Consensus       171 ~--~~~~~I~~~~~~p~yI~a~~~~I~~~l~~~~~---~~~~llfSaHglP~~~~~~gDpY~~q~~~t~~~i~~~l~~~~  245 (343)
                      .  +++++|++||+||.||++++++|++++++.+.   ++++|||||||||++++++||||..||.+|+++|+++|+++ 
T Consensus       157 ~~~~~~~~I~~~~~~p~yI~a~a~~i~~~l~~~~~~~~~~~~llFS~HglP~~~~~~GdpY~~q~~~t~~~i~~~l~~~-  235 (362)
T 1lbq_A          157 ERSISWSVIDRWPTNEGLIKAFSENITKKLQEFPQPVRDKVVLLFSAHSLPMDVVNTGDAYPAEVAATVYNIMQKLKFK-  235 (362)
T ss_dssp             TCCSEEEEECCCTTCHHHHHHHHHHHHHHHHTSCSTTGGGCEEEEEEECCBHHHHTTTCSHHHHHHHHHHHHHHHTTTC-
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCEECCCCCCCCHHHHHHHHHHHHHHCCCC-
T ss_conf             5663036734644437899999999999999766544677579997057740001378977899999999999972898-


Q ss_pred             CCCEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             67047862257776544302689999899769983999744054221255888758999999975997589816898798
Q gi|254780200|r  246 DRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSN  325 (343)
Q Consensus       246 ~~~~l~fQSr~Gp~~WL~P~t~~~l~~L~~~G~k~v~v~p~gFvsD~lETl~Eidie~~e~~~e~Gg~~~~rvp~lN~~~  325 (343)
                      ++|.++||||+||++||+|+|+++++.|+ +|+|+|+|+||||++||+|||||||+|+++.  +.||++|.||||||+||
T Consensus       236 ~~~~l~fQSr~g~~~WL~P~t~~~le~l~-~g~k~v~vvp~gFvsD~lETL~Eidie~~~~--~~~g~~f~~vp~lN~~p  312 (362)
T 1lbq_A          236 NPYRLVWQSQVGPKPWLGAQTAEIAEFLG-PKVDGLMFIPIAFTSDHIETLHEIDLGVIGE--SEYKDKFKRCESLNGNQ  312 (362)
T ss_dssp             SCEEEEEECCCSSSCBCSCBHHHHHHHHG-GGCSCEEEECTTCSSCCHHHHTCCCCCCCTT--CTTGGGEEECCCCTTCH
T ss_pred             CCCEEEEECCCCCCCCCCCCHHHHHHHHH-CCCCEEEEECCCCCCCCHHHHHHHHHHHHHH--HHCCCEEEECCCCCCCH
T ss_conf             76258996478999999970799999986-3997499988876432443299887679999--80897399878998999


Q ss_pred             HHHHHHHHHHHHHHCCC
Q ss_conf             99999999999984288
Q gi|254780200|r  326 LSIDLLEKITRRELMGW  342 (343)
Q Consensus       326 ~fi~~La~lv~~~l~gw  342 (343)
                      .||++|+++|+++|+.+
T Consensus       313 ~fi~~La~lv~~~l~~~  329 (362)
T 1lbq_A          313 TFIEGMADLVKSHLQSN  329 (362)
T ss_dssp             HHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHCC
T ss_conf             99999999999987357


No 2  
>3hcn_A Ferrochelatase, mitochondrial; metal selectivity, 2Fe-2S, disease mutation, heme biosynthesis, iron, iron-sulfur, lyase, membrane, metal-binding; HET: CHD HEM GOL; 1.60A {Homo sapiens} PDB: 2qd3_A* 2qd5_A* 2qd4_A* 3hco_A* 3hcr_A* 2qd1_A* 2hre_A* 3hcp_A* 2qd2_A* 2hrc_A* 1hrk_A* 2pnj_A* 2po5_A* 2po7_A*
Probab=100.00  E-value=0  Score=693.04  Aligned_cols=318  Identities=25%  Similarity=0.448  Sum_probs=297.1

Q ss_pred             CCCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCHHHHCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCHHHHH
Q ss_conf             77867999971788899998899999998748954411786888998766651257478899999870778874045777
Q gi|254780200|r   15 KFGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKIKHAYAKIWNTAKNESILRTH   94 (343)
Q Consensus        15 ~~~K~gvLL~n~G~P~~~~~~~V~~yL~~fl~D~~Vi~~p~~~~~~il~~~I~~~R~~~~~~~Y~~Iw~~~gg~SPL~~~   94 (343)
                      .++|+||||+|||||++++  ||++||++||+|++||++|   |+.+|+.+|+++|+++++++|++||    |+|||+.+
T Consensus         1 ~k~K~aVLL~n~G~P~t~~--~V~~yL~~~l~d~~vi~~P---~~~~l~~~I~~~R~~~~~~~Y~~ig----ggSPl~~~   71 (359)
T 3hcn_A            1 RKPKTGILMLNMGGPETLG--DVHDFLLRLFLDRDLMTLP---IQNKLAPFIAKRRTPKIQEQYRRIG----GGSPIKIW   71 (359)
T ss_dssp             CCCCEEEEEEECCCCSSGG--GHHHHHHHHHTCTTTCCCT---THHHHHHHHHHHHHHHHHHHHHHTT----SSCCHHHH
T ss_pred             CCCCEEEEEEECCCCCCHH--HHHHHHHHHCCCCCCCCCC---HHHHHHHHHCCCCHHHHHHHHHHCC----CCCHHHHH
T ss_conf             9985599998379999878--9999999982799744233---7888766604656299999999738----98812999


Q ss_pred             HHHHHHHHHHHHHCC----CCCCCHHHHHCCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             599999999865224----7843001121045424789999987099658996317111001468999999999987179
Q gi|254780200|r   95 TRDQATNLAKRLESI----SSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRW  170 (343)
Q Consensus        95 t~~qa~~L~~~L~~~----~~~~V~~amry~~P~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l~~~~~  170 (343)
                      |+.|+++|++.|++.    .++.|++|||||+|+|++++++|+++|+++|+++|||||||++||||+++.+++++.+.++
T Consensus        72 t~~q~~~l~~~L~~~~~~~~~~~v~~amry~~P~i~~~l~~l~~~G~~~ii~lPl~PqyS~~ttgs~~~~~~~~l~~~~~  151 (359)
T 3hcn_A           72 TSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGR  151 (359)
T ss_dssp             HHHHHHHHHHHHHHHCGGGCSEEEEEEESSSSSBHHHHHHHHHHTTCSEEEEEESCSSCCTTTHHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             99999999999876457676426888667899529999999997598568763266211165641555799999998502


Q ss_pred             C--CCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCC---CCEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             9--864213345578006899999999999733899---86699983367502676279988899999999999726675
Q gi|254780200|r  171 S--PSLRTVPPYYEDSDYISALAQSIREHFESIQWT---PEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPD  245 (343)
Q Consensus       171 ~--~~~~~I~~~~~~p~yI~a~~~~I~~~l~~~~~~---~~~llfSaHglP~~~~~~gDpY~~q~~~t~~~i~~~l~~~~  245 (343)
                      .  +.+++|++||++|.||++++++|+++++..+..   ..+|||||||||++++++||||..||++|+++|+++||+. 
T Consensus       152 ~~~~~~~~i~~~~~~~~yi~a~~~~i~~~~~~~~~~~~~~~~llfS~HgiP~~~~~~gdpY~~~~~~t~~~i~~~l~~~-  230 (359)
T 3hcn_A          152 KPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYC-  230 (359)
T ss_dssp             CCSSEEEEECCCTTCHHHHHHHHHHHHHHHTTSCTTTGGGCEEEEEEECCBHHHHTTTCSHHHHHHHHHHHHHHHTTTC-
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCEEHHHCCCCCHHHHHHHHHHHHHHHCCC-
T ss_conf             3777763326889977899999999999986253224778479998401424032158984999999999999974356-


Q ss_pred             CCCEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCHHHHCCHHHHHHHHHHHHHHH-HHCCCCEEEEECCCCCC
Q ss_conf             67047862257776544302689999899769983999744054221255888758999999-97599758981689879
Q gi|254780200|r  246 DRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIF-VNGGGEKFTQVPCLNSS  324 (343)
Q Consensus       246 ~~~~l~fQSr~Gp~~WL~P~t~~~l~~L~~~G~k~v~v~p~gFvsD~lETl~Eidie~~e~~-~e~Gg~~~~rvp~lN~~  324 (343)
                      ++|.++||||+||++||+|+|+|+|++|+++|+|+|+|+||||++||+|||||||+|+++.| .++||++|.|+||||||
T Consensus       231 ~~~~~afQSr~g~~~Wl~P~~~~~l~~L~~~G~k~V~v~p~gFvsD~lETl~eidie~~e~~~~~~G~~~~~rip~lN~~  310 (359)
T 3hcn_A          231 NPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGN  310 (359)
T ss_dssp             SCEEEEEECCSCSSCBSSSBHHHHHHHHHHTTCCEEEEECTTCCSCCCCCHHHHCHHHHHHHHHHTCCCEEEECCCSTTC
T ss_pred             CCCEEEEECCCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCC
T ss_conf             54314785699997877886899999999759986799797204553467998788999999997699638975799999


Q ss_pred             HHHHHHHHHHHHHHHCCC
Q ss_conf             899999999999984288
Q gi|254780200|r  325 NLSIDLLEKITRRELMGW  342 (343)
Q Consensus       325 ~~fi~~La~lv~~~l~gw  342 (343)
                      |.||++|+++|+++|+||
T Consensus       311 p~fi~~La~lv~~~l~~~  328 (359)
T 3hcn_A          311 PLFSKALADLVHSHIQSN  328 (359)
T ss_dssp             HHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHCCC
T ss_conf             999999999999996378


No 3  
>2h1v_A Ferrochelatase; rossman fold, PI-helix, lyase; 1.20A {Bacillus subtilis} PDB: 2hk6_A 1c1h_A* 1ld3_A 1n0i_A 1ak1_A 3goq_A 1doz_A 2q2n_A* 2h1w_A 2ac2_A 2q3j_A* 2ac4_A 2q2o_A* 1c9e_A* 2c8j_A
Probab=100.00  E-value=0  Score=650.84  Aligned_cols=300  Identities=21%  Similarity=0.346  Sum_probs=275.2

Q ss_pred             CCCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCHHHHCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCHHHHH
Q ss_conf             77867999971788899998899999998748954411786888998766651257478899999870778874045777
Q gi|254780200|r   15 KFGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKIKHAYAKIWNTAKNESILRTH   94 (343)
Q Consensus        15 ~~~K~gvLL~n~G~P~~~~~~~V~~yL~~fl~D~~Vi~~p~~~~~~il~~~I~~~R~~~~~~~Y~~Iw~~~gg~SPL~~~   94 (343)
                      .+.|+||||||||||++++  ||++||++||+|++|   ++.             |.++++++|++||    |+|||+.+
T Consensus         2 ~k~K~gvLL~n~GtP~~~~--~v~~yL~~~~~~r~~---~~~-------------~~~~~~~~Y~~ig----g~SPL~~~   59 (310)
T 2h1v_A            2 SRKKMGLLVMAYGTPYKEE--DIERYYTHIRRGRKP---EPE-------------MLQDLKDRYEAIG----GISPLAQI   59 (310)
T ss_dssp             CCEEEEEEEEECCCCSSGG--GHHHHHHHHTTTCCC---CHH-------------HHHHHHHHHHHTT----CSHHHHHH
T ss_pred             CCCCEEEEEEECCCCCCHH--HHHHHHHHHCCCCCC---CHH-------------HHHHHHHHHHHHC----CCCHHHHH
T ss_conf             9887899998789999878--999999997468999---999-------------9999999999848----98867999


Q ss_pred             HHHHHHHHHHHHHCCC---CCCCHHHHHCCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             5999999998652247---8430011210454247899999870996589963171110014689999999999871799
Q gi|254780200|r   95 TRDQATNLAKRLESIS---SIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWS  171 (343)
Q Consensus        95 t~~qa~~L~~~L~~~~---~~~V~~amry~~P~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l~~~~~~  171 (343)
                      |+.|+++|+++|++.+   ++.|++|||||+|+|++++++|+++|+++|+++|||||||.+||+|+++.+.+++.+.+ .
T Consensus        60 t~~qa~~L~~~L~~~~~~~~~~v~~amry~~P~i~~~l~~l~~~g~~~ii~lpl~PqyS~~t~~s~~~~~~~~~~~~~-~  138 (310)
T 2h1v_A           60 TEQQAHNLEQHLNEIQDEITFKAYIGLAHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLG-G  138 (310)
T ss_dssp             HHHHHHHHHHHHHHHCSSEEEEEEEEESSSSSBHHHHHHHHHHTTCCEEEEEESSSSCCTTTHHHHHHHHHHHHHHHC-S
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHCC-C
T ss_conf             999999999998652899527898860579975899999998659843899762441355653408999999987434-8


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHCC---CCCCEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             8642133455780068999999999997338---9986699983367502676279988899999999999726675670
Q gi|254780200|r  172 PSLRTVPPYYEDSDYISALAQSIREHFESIQ---WTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRF  248 (343)
Q Consensus       172 ~~~~~I~~~~~~p~yI~a~~~~I~~~l~~~~---~~~~~llfSaHglP~~~~~~gDpY~~q~~~t~~~i~~~l~~~~~~~  248 (343)
                      +++++|++||++|.||++|+++|+++++...   .++++|||||||+|++++++||||.+||.+|+++|+++|+..  +|
T Consensus       139 ~~~~~I~~~~~~p~yi~a~a~~I~~~l~~~~~~~~~~~~llfS~HgiP~~~~~~gdpY~~~~~~t~~~i~~~l~~~--~~  216 (310)
T 2h1v_A          139 LTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVS--EY  216 (310)
T ss_dssp             CEEEECCCCTTCHHHHHHHHHHHHHHHHHSCHHHHTSEEEEEEEECCBGGGGGGTCCHHHHHHHHHHHHHHHHTCS--CE
T ss_pred             CCEEEECCCCCCHHHHHHHHHHHHHHHHHCCHHHCCCCEEEECCCCCCEEECCCCCCHHHHHHHHHHHHHHHCCCC--CE
T ss_conf             7369956867987799999999999998586443587369850688741000489838999999999999864987--16


Q ss_pred             EEEEECCCC-CCCCCCHHHHHHHHHH-HHCCCCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHH
Q ss_conf             478622577-7654430268999989-97699839997440542212558887589999999759975898168987989
Q gi|254780200|r  249 KICFQSRFG-RIKCLEPPTDKTVEKL-AHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSNL  326 (343)
Q Consensus       249 ~l~fQSr~G-p~~WL~P~t~~~l~~L-~~~G~k~v~v~p~gFvsD~lETl~Eidie~~e~~~e~Gg~~~~rvp~lN~~~~  326 (343)
                      .+|||||+| |++||+|+|+|++++| +++|+|+|+|+||||++||+|||||||+|+||.|.++|+ +|.|+|||||||.
T Consensus       217 ~~~fQSr~g~~~~WL~P~t~d~l~~L~~~~G~k~v~v~p~gF~sD~lETL~Eidie~~e~~~~~G~-~~~rvp~lN~~p~  295 (310)
T 2h1v_A          217 AVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGA-SYYRPEMPNAKPE  295 (310)
T ss_dssp             EEEEESCCCCSSCBSSCBHHHHHHHHHHHHCCSEEEEECTTCCSSCHHHHTTTTTHHHHHHHHHTC-EEECCCCCTTCHH
T ss_pred             EEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCC-CEEEECCCCCCHH
T ss_conf             899840688896678996788999988856972799989870333353399989999999998599-7898039999999


Q ss_pred             HHHHHHHHHHHHHC
Q ss_conf             99999999999842
Q gi|254780200|r  327 SIDLLEKITRRELM  340 (343)
Q Consensus       327 fi~~La~lv~~~l~  340 (343)
                      ||++|+++|+++|.
T Consensus       296 fi~~La~lv~~~l~  309 (310)
T 2h1v_A          296 FIDALATVVLKKLG  309 (310)
T ss_dssp             HHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHC
T ss_conf             99999999999857


No 4  
>1qgo_A CBIK protein, anaerobic cobalamine biosynthetic cobalt chelatase; vitamin B12, metal ION chelation, cobalt precorrin; 2.40A {Salmonella typhimurium LT2} SCOP: c.92.1.2
Probab=99.79  E-value=1.2e-17  Score=141.88  Aligned_cols=197  Identities=13%  Similarity=0.125  Sum_probs=150.3

Q ss_pred             HCCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHC-CCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             104542478999998709965899631711100146899999999998717-9986421334557800689999999999
Q gi|254780200|r  119 RYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMR-WSPSLRTVPPYYEDSDYISALAQSIREH  197 (343)
Q Consensus       119 ry~~P~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l~~~~-~~~~~~~I~~~~~~p~yI~a~~~~I~~~  197 (343)
                      ....|++++++.+|.++|+++++++|||     .+.|..++.+.+.+.+.+ ..+++.+.+++..+|.++.++++.+.+.
T Consensus        56 ~~~~p~~~~al~~l~~~G~~~i~V~Pl~-----l~~G~~~~di~~~~~~~~~~~~~i~~~~pll~~~~~~~~~~~~l~~~  130 (264)
T 1qgo_A           56 GIDIDTPLQALQKLAAQGYQDVAIQSLH-----IINGDEYEKIVREVQLLRPLFTRLTLGVPLLSSHNDYVQLMQALRQQ  130 (264)
T ss_dssp             CCCCCCHHHHHHHHHHTTCCEEEEEECC-----SBCSHHHHHHHHHHHHHGGGSSEEEECCCSBSSHHHHHHHHHHHHTT
T ss_pred             CCCCCCHHHHHHHHHHCCCCEEEEEEEE-----CCCCCHHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             7779999999999997799779998740-----34632599999999987753794698357799989999999999984


Q ss_pred             HHHCCCCCCEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             97338998669998336750267627998889999999999972667567047862257776544302689999899769
Q gi|254780200|r  198 FESIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDG  277 (343)
Q Consensus       198 l~~~~~~~~~llfSaHglP~~~~~~gDpY~~q~~~t~~~i~~~l~~~~~~~~l~fQSr~Gp~~WL~P~t~~~l~~L~~~G  277 (343)
                      +... ..++.|||++||-|..       +...+......+.+ .+   ..+.++|.+  |     +|++++++++|.+.|
T Consensus       131 ~~~~-~~~~~lllvgHGs~~~-------~~~~~~~~~~~l~~-~~---~~v~v~~~~--~-----~P~~~~~l~~l~~~g  191 (264)
T 1qgo_A          131 MPSL-RQTEKVVFMGHGASHH-------AFAAYACLDHMMTA-QR---FPARVGAVE--S-----YPEVDILIDSLRDEG  191 (264)
T ss_dssp             CCCC-CTTEEEEEEECCCSHH-------HHHHHHHHHHHHHH-HT---CSEEEEETT--S-----SSCHHHHHHHHHHHT
T ss_pred             CCCC-CCCCEEEEEECCCCCH-------HHHHHHHHHHHHHH-CC---CCEEEEEEE--E-----CCCHHHHHHHHHHCC
T ss_conf             4556-8885799995799734-------25899999999996-38---985999985--0-----698899999987457


Q ss_pred             CCCEEEECCHHHHCCHHHHHHHH----HHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHHC
Q ss_conf             98399974405422125588875----8999999975997589816898798999999999999842
Q gi|254780200|r  278 IKSLAIITPGFSSDCLETSYEIA----HEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEKITRRELM  340 (343)
Q Consensus       278 ~k~v~v~p~gFvsD~lETl~Eid----ie~~e~~~e~Gg~~~~rvp~lN~~~~fi~~La~lv~~~l~  340 (343)
                      .++|+++| -|++++..+..|+-    ...++.+.+.|++...+.+.|+++|.+++.+.+-+++.|.
T Consensus       192 ~~~v~v~P-~fl~~G~h~~~Di~~~~~~s~~~~l~~~g~~~~~~~~~LG~~p~v~~~~~~r~~~al~  257 (264)
T 1qgo_A          192 VTGVHLMP-LMLVAGDHAINDMASDDGDSWKMRFNAAGIPATPWLSGLGENPAIRAMFVAHLHQALN  257 (264)
T ss_dssp             CCEEEEEE-CSSSCCHHHHTTTTSSSTTSHHHHHHHTTCCEEECCCCGGGSHHHHHHHHHHHHHHHH
T ss_pred             CCEEEEEE-CEECCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             98799997-8002573323201001147999988875984644135779997999999999999984


No 5  
>3lyh_A Cobalamin (vitamin B12) biosynthesis CBIX protein; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Marinobacter aquaeolei}
Probab=98.79  E-value=1.7e-07  Score=71.33  Aligned_cols=117  Identities=12%  Similarity=0.148  Sum_probs=87.0

Q ss_pred             CEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEC
Q ss_conf             66999833675026762799888999999999997266756704786225777654430268999989976998399974
Q gi|254780200|r  206 EMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIIT  285 (343)
Q Consensus       206 ~~llfSaHglP~~~~~~gDpY~~q~~~t~~~i~~~l~~~~~~~~l~fQSr~Gp~~WL~P~t~~~l~~L~~~G~k~v~v~p  285 (343)
                      ..+|+.+||-+...      ........++.+.++++    .+.+||-.      .-+|++.+.++.+.++|+++|+++|
T Consensus         6 ~avllv~HGS~~~~------~~~~~~~la~~l~~~~~----~v~~~fle------~~~P~l~~~l~~l~~~g~~~vvvvP   69 (126)
T 3lyh_A            6 HQIILLAHGSSDAR------WCETFEKLAEPTVESIE----NAAIAYME------LAEPSLDTIVNRAKGQGVEQFTVVP   69 (126)
T ss_dssp             EEEEEEECCCSCHH------HHHHHHHHHHHHHHHST----TCEEEESS------SSSSBHHHHHHHHHHTTCCEEEEEE
T ss_pred             CEEEEEECCCCCHH------HHHHHHHHHHHHHHHCC----CEEEEEEE------CCCCCHHHHHHHHHHCCCCEEEEEE
T ss_conf             66999978999878------99999999999996589----84799982------6899999999999976998799998


Q ss_pred             CHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHHC
Q ss_conf             4054221255888758999999975997589816898798999999999999842
Q gi|254780200|r  286 PGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEKITRRELM  340 (343)
Q Consensus       286 ~gFvsD~lETl~Eidie~~e~~~e~Gg~~~~rvp~lN~~~~fi~~La~lv~~~l~  340 (343)
                      . |+++..-+..||....++...+.| .++.+.+++++||.++++|.+.+++.|+
T Consensus        70 ~-fl~~G~h~~~dip~~~~~~~~~~~-~~i~~~~~lg~~p~l~~~l~~ri~eal~  122 (126)
T 3lyh_A           70 L-FLAAGRHLRKDVPAMIERLEAEHG-VTIRLAEPIGKNPRLGLAIRDVVKEELE  122 (126)
T ss_dssp             C-CSCCCHHHHHHHHHHHHHHHHHHT-CEEEECCCGGGSHHHHHHHHHHHHHHHH
T ss_pred             E-ECCCCCHHHHHHHHHHHHHHHHCC-CEEEECCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             1-325661146569999999998469-6699878787987999999999999986


No 6  
>2jh3_A Ribosomal protein S2-related protein; CBIX, SAD phasing, structural genomics, chelatase super-family fold, 4Fe-4S iron-sulphur cluster; 1.9A {Deinococcus radiodurans}
Probab=98.56  E-value=3.5e-07  Score=69.12  Aligned_cols=203  Identities=10%  Similarity=0.052  Sum_probs=131.8

Q ss_pred             CCCHHHHHCCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHH-------------HHCCCCCCCCCC
Q ss_conf             4300112104542478999998709965899631711100146899999999998-------------717998642133
Q gi|254780200|r  112 IVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELI-------------HMRWSPSLRTVP  178 (343)
Q Consensus       112 ~~V~~amry~~P~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l~-------------~~~~~~~~~~I~  178 (343)
                      ..|..|+--.+|++.+++..+   +.++|+++|||=--...    +...+-+++.             ......++++-+
T Consensus        42 ~eV~~afle~eP~l~eaL~~l---~a~~VvVVPlFLs~G~H----~~~DIP~~L~l~~~~~~~~~~~~~~~~g~~v~~~~  114 (474)
T 2jh3_A           42 DEVLEGYWQQEPGLRQVLRTV---AYSDVTVVPVFLSEGYV----TETVLPRELGLGHQGPVPTGGVVRVLGGRRVRYTR  114 (474)
T ss_dssp             SEEEEEESSSSSBTTTGGGGC---CBSEEEEEECCSCCSHH----HHTHHHHHHTCCCCSCCCTTCEEEEETTEEEEECC
T ss_pred             EEEEEEECCCCCCHHHHHHHC---CCCCEEEEEEEECCCCH----HHHHHHHHHCCCCCCCCCCCCHHHCCCCCEEEECC
T ss_conf             078875325799989999864---89968999578546732----34452477535645554310022027995499678


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHCC-CCCCEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCC
Q ss_conf             455780068999999999997338-9986699983367502676279988899999999999726675670478622577
Q gi|254780200|r  179 PYYEDSDYISALAQSIREHFESIQ-WTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKICFQSRFG  257 (343)
Q Consensus       179 ~~~~~p~yI~a~~~~I~~~l~~~~-~~~~~llfSaHglP~~~~~~gDpY~~q~~~t~~~i~~~l~~~~~~~~l~fQSr~G  257 (343)
                      +.-.||..++.+.+++++.+.... .....|+...||-.-          .-.+..++++.+..+..  ....+|-+.  
T Consensus       115 PLG~hP~L~dlL~~Ra~eal~~~~~~~~~~lLlvg~GS~~----------~a~~~~A~~L~e~~~~~--~V~~~fle~--  180 (474)
T 2jh3_A          115 PLGAHPGMADAIAAQARDTLPEGTDPADVTLLLLAARPGN----------AALETHAQALRERGQFA--GVEVVLESR--  180 (474)
T ss_dssp             CGGGSTTHHHHHHHHHHHHSCTTCCGGGCEEEEEESSTTC----------HHHHHHHHHHHHHCCSS--EEEEEECCC--
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCC----------CCHHHHHHHHHHHCCCC--CEEEEEEEC--
T ss_conf             8789888999999999998524788766079999368775----------42589999999745877--368888514--


Q ss_pred             CCCCCCHHHHHHHHHHH--------HCCCCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHCC-CCEEEEECCCCCCHHHH
Q ss_conf             76544302689999899--------7699839997440542212558887589999999759-97589816898798999
Q gi|254780200|r  258 RIKCLEPPTDKTVEKLA--------HDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGG-GEKFTQVPCLNSSNLSI  328 (343)
Q Consensus       258 p~~WL~P~t~~~l~~L~--------~~G~k~v~v~p~gFvsD~lETl~Eidie~~e~~~e~G-g~~~~rvp~lN~~~~fi  328 (343)
                           .|.+.+....+.        ..|.++|+|+| =|+++..-|..||............ .....+.+.|++||..+
T Consensus       181 -----~P~v~~~~~~~~a~~~~~~~~~~~~rVVVvP-yFLa~G~ht~~dIPe~l~~a~~r~~~~~~i~~A~pLG~hp~la  254 (474)
T 2jh3_A          181 -----EALTPESHAASAVPLSEWPSRVEAGQAVLVP-FLTHLGKHAAERLQQALAQAAERFPQAPPLHVGGPVGEHPAVA  254 (474)
T ss_dssp             -----C---------CCEEGGGGGGGCCSSCEEEEE-CSSCCCHHHHHHHHHHHHHHHHHCTTCCCEEECCCGGGSTTHH
T ss_pred             -----CCCCCHHHHHHHHHHHHHHHCCCCCEEEEEE-EECCCCCCHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCHHHH
T ss_conf             -----6773102345566555554315888599985-1148873214467888765442135677425536678875899


Q ss_pred             HHHHHHHHHHHCC
Q ss_conf             9999999998428
Q gi|254780200|r  329 DLLEKITRRELMG  341 (343)
Q Consensus       329 ~~La~lv~~~l~g  341 (343)
                      +.+.+..++...+
T Consensus       255 dlVleR~~EA~a~  267 (474)
T 2jh3_A          255 EVVLALAAEGRED  267 (474)
T ss_dssp             HHHHHHHHTTCSC
T ss_pred             HHHHHHHHHHHCC
T ss_conf             9999999986115


No 7  
>3lyh_A Cobalamin (vitamin B12) biosynthesis CBIX protein; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Marinobacter aquaeolei}
Probab=98.30  E-value=8.1e-06  Score=59.64  Aligned_cols=98  Identities=15%  Similarity=0.264  Sum_probs=69.4

Q ss_pred             HHHHHHHHHCCCCCCCHHHHHCCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             99999865224784300112104542478999998709965899631711100146899999999998717998642133
Q gi|254780200|r   99 ATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRTVP  178 (343)
Q Consensus        99 a~~L~~~L~~~~~~~V~~amry~~P~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l~~~~~~~~~~~I~  178 (343)
                      ++.++++++   ++.| -.|....|++++++.++.+.|+++|+++|+|-.-..-+....-+.+.+...+.  ..++.+.+
T Consensus        28 a~~l~~~~~---~v~~-~fle~~~P~l~~~l~~l~~~g~~~vvvvP~fl~~G~h~~~dip~~~~~~~~~~--~~~i~~~~  101 (126)
T 3lyh_A           28 AEPTVESIE---NAAI-AYMELAEPSLDTIVNRAKGQGVEQFTVVPLFLAAGRHLRKDVPAMIERLEAEH--GVTIRLAE  101 (126)
T ss_dssp             HHHHHHHST---TCEE-EESSSSSSBHHHHHHHHHHTTCCEEEEEECCSCCCHHHHHHHHHHHHHHHHHH--TCEEEECC
T ss_pred             HHHHHHHCC---CEEE-EEEECCCCCHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHC--CCEEEECC
T ss_conf             999996589---8479-99826899999999999976998799998132566114656999999999846--96699878


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHCC
Q ss_conf             455780068999999999997338
Q gi|254780200|r  179 PYYEDSDYISALAQSIREHFESIQ  202 (343)
Q Consensus       179 ~~~~~p~yI~a~~~~I~~~l~~~~  202 (343)
                      ++..||.+.+++.++|+++++..+
T Consensus       102 ~lg~~p~l~~~l~~ri~eal~~~d  125 (126)
T 3lyh_A          102 PIGKNPRLGLAIRDVVKEELERSE  125 (126)
T ss_dssp             CGGGSHHHHHHHHHHHHHHHHHC-
T ss_pred             CCCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             787987999999999999986027


No 8  
>1lbq_A Ferrochelatase; rossmann fold, PI-helix, lyase; 2.40A {Saccharomyces cerevisiae} SCOP: c.92.1.1 PDB: 1l8x_A
Probab=97.91  E-value=0.00039  Score=47.93  Aligned_cols=77  Identities=17%  Similarity=0.226  Sum_probs=40.5

Q ss_pred             HHHHHHHHHHHHCCCCCEEEECC--HHHHCCHHHH-HHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHHC
Q ss_conf             02689999899769983999744--0542212558-88758999999975997589816898798999999999999842
Q gi|254780200|r  264 PPTDKTVEKLAHDGIKSLAIITP--GFSSDCLETS-YEIAHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEKITRRELM  340 (343)
Q Consensus       264 P~t~~~l~~L~~~G~k~v~v~p~--gFvsD~lETl-~Eidie~~e~~~e~Gg~~~~rvp~lN~~~~fi~~La~lv~~~l~  340 (343)
                      |++.++|+++.++|+++|+++|-  -|.+--..+. .++.-..++. .......+..|+..-++|.||+++++.|+++++
T Consensus       109 P~i~~~l~~l~~~G~~~ii~lPlyPqyS~sTt~s~~~~~~~~l~~~-~~~~~~~~~~I~~~~~~p~yI~a~a~~i~~~l~  187 (362)
T 1lbq_A          109 PLTAETYKQMLKDGVKKAVAFSQYPHFSYSTTGSSINELWRQIKAL-DSERSISWSVIDRWPTNEGLIKAFSENITKKLQ  187 (362)
T ss_dssp             SCHHHHHHHHHTTTCCEEEEEESCSSCCTTTHHHHHHHHHHHHHHH-CTTCCSEEEEECCCTTCHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHCCCCEEEEEECCHHHCCCHHHHHHHHHHHHHHHH-CCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHH
T ss_conf             7377899999865985489986760322052237999999999875-025663036734644437899999999999999


Q ss_pred             C
Q ss_conf             8
Q gi|254780200|r  341 G  341 (343)
Q Consensus       341 g  341 (343)
                      .
T Consensus       188 ~  188 (362)
T 1lbq_A          188 E  188 (362)
T ss_dssp             T
T ss_pred             H
T ss_conf             7


No 9  
>3hcn_A Ferrochelatase, mitochondrial; metal selectivity, 2Fe-2S, disease mutation, heme biosynthesis, iron, iron-sulfur, lyase, membrane, metal-binding; HET: CHD HEM GOL; 1.60A {Homo sapiens} PDB: 2qd3_A* 2qd5_A* 2qd4_A* 3hco_A* 3hcr_A* 2qd1_A* 2hre_A* 3hcp_A* 2qd2_A* 2hrc_A* 1hrk_A* 2pnj_A* 2po5_A* 2po7_A*
Probab=97.73  E-value=0.0012  Score=44.56  Aligned_cols=112  Identities=20%  Similarity=0.283  Sum_probs=74.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCCCHH-----HHHCCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHH---
Q ss_conf             40457775999999998652247843001-----1210454247899999870996589963171110014689999---
Q gi|254780200|r   88 ESILRTHTRDQATNLAKRLESISSIVVDW-----AMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQD---  159 (343)
Q Consensus        88 ~SPL~~~t~~qa~~L~~~L~~~~~~~V~~-----amry~~P~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~---  159 (343)
                      |.|-.......+.++.++|+-..++.+.+     .+.--.|++++++++|.+.|+++|+++|.-  |.+=...+.+|   
T Consensus       209 gdpY~~~~~~t~~~i~~~l~~~~~~~~afQSr~g~~~Wl~P~~~~~l~~L~~~G~k~V~v~p~g--FvsD~lETl~eidi  286 (359)
T 3hcn_A          209 GDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIA--FTSDHIETLYELDI  286 (359)
T ss_dssp             TCSHHHHHHHHHHHHHHHTTTCSCEEEEEECCSCSSCBSSSBHHHHHHHHHHTTCCEEEEECTT--CCSCCCCCHHHHCH
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCC--CCCCCHHHHHHHHH
T ss_conf             8984999999999999974356543147856999978778868999999997599867997972--04553467998788


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHC
Q ss_conf             999999871799864213345578006899999999999733
Q gi|254780200|r  160 KVFQELIHMRWSPSLRTVPPYYEDSDYISALAQSIREHFESI  201 (343)
Q Consensus       160 ~~~~~l~~~~~~~~~~~I~~~~~~p~yI~a~~~~I~~~l~~~  201 (343)
                      +..+.+.+.....++..|+...++|.||+++++.|++.++..
T Consensus       287 e~~e~~~~~~G~~~~~rip~lN~~p~fi~~La~lv~~~l~~~  328 (359)
T 3hcn_A          287 EYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSN  328 (359)
T ss_dssp             HHHHHHHHHTCCCEEEECCCSTTCHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             999999997699638975799999999999999999996378


No 10 
>1qgo_A CBIK protein, anaerobic cobalamine biosynthetic cobalt chelatase; vitamin B12, metal ION chelation, cobalt precorrin; 2.40A {Salmonella typhimurium LT2} SCOP: c.92.1.2
Probab=97.66  E-value=0.00069  Score=46.19  Aligned_cols=99  Identities=12%  Similarity=0.120  Sum_probs=63.7

Q ss_pred             HHHHHHCCCCCCCHHHHHCCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHH----HHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             99865224784300112104542478999998709965899631711100146----89999999999871799864213
Q gi|254780200|r  102 LAKRLESISSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATT----GTAQDKVFQELIHMRWSPSLRTV  177 (343)
Q Consensus       102 L~~~L~~~~~~~V~~amry~~P~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTt----gS~~~~~~~~l~~~~~~~~~~~I  177 (343)
                      ++..+.+. ...|++|+-.+.|++++++++|++.|+++++++|+|=.-..-+.    +..-+.+...+.+.+... ..+.
T Consensus       158 ~~~~l~~~-~~~v~v~~~~~~P~~~~~l~~l~~~g~~~v~v~P~fl~~G~h~~~Di~~~~~~s~~~~l~~~g~~~-~~~~  235 (264)
T 1qgo_A          158 LDHMMTAQ-RFPARVGAVESYPEVDILIDSLRDEGVTGVHLMPLMLVAGDHAINDMASDDGDSWKMRFNAAGIPA-TPWL  235 (264)
T ss_dssp             HHHHHHHH-TCSEEEEETTSSSCHHHHHHHHHHHTCCEEEEEECSSSCCHHHHTTTTSSSTTSHHHHHHHTTCCE-EECC
T ss_pred             HHHHHHHC-CCCEEEEEEEECCCHHHHHHHHHHCCCCEEEEEECEECCCCCHHHHHHHHHHHHHHHHHHHCCCEE-EEEC
T ss_conf             99999963-898599998506988999999874579879999780025733232010011479999888759846-4413


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCC
Q ss_conf             3455780068999999999997338
Q gi|254780200|r  178 PPYYEDSDYISALAQSIREHFESIQ  202 (343)
Q Consensus       178 ~~~~~~p~yI~a~~~~I~~~l~~~~  202 (343)
                      ++...+|.+.+.+.++++++++...
T Consensus       236 ~~LG~~p~v~~~~~~r~~~al~~~~  260 (264)
T 1qgo_A          236 SGLGENPAIRAMFVAHLHQALNMAV  260 (264)
T ss_dssp             CCGGGSHHHHHHHHHHHHHHHHC--
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             5779997999999999999984230


No 11 
>2h1v_A Ferrochelatase; rossman fold, PI-helix, lyase; 1.20A {Bacillus subtilis} PDB: 2hk6_A 1c1h_A* 1ld3_A 1n0i_A 1ak1_A 3goq_A 1doz_A 2q2n_A* 2h1w_A 2ac2_A 2q3j_A* 2ac4_A 2q2o_A* 1c9e_A* 2c8j_A
Probab=97.64  E-value=0.00079  Score=45.79  Aligned_cols=108  Identities=21%  Similarity=0.206  Sum_probs=62.3

Q ss_pred             CCHHHHHHHHHHHHHHHCCCCC--CCEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCEEEECC--HHHHCCHHHHHHHH
Q ss_conf             9888999999999997266756--7047862257776544302689999899769983999744--05422125588875
Q gi|254780200|r  225 PYGCHCHKTARLLKEFLSWPDD--RFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITP--GFSSDCLETSYEIA  300 (343)
Q Consensus       225 pY~~q~~~t~~~i~~~l~~~~~--~~~l~fQSr~Gp~~WL~P~t~~~l~~L~~~G~k~v~v~p~--gFvsD~lETl~Eid  300 (343)
                      |=....++-++.+.++|+...+  .+.+.+--|.|     .|++.++++++.++|+.+++++|.  -|.+=...+..   
T Consensus        55 PL~~~t~~qa~~L~~~L~~~~~~~~~~v~~amry~-----~P~i~~~l~~l~~~g~~~ii~lpl~PqyS~~t~~s~~---  126 (310)
T 2h1v_A           55 PLAQITEQQAHNLEQHLNEIQDEITFKAYIGLAHI-----EPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYN---  126 (310)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCSSEEEEEEEEESSS-----SSBHHHHHHHHHHTTCCEEEEEESSSSCCTTTHHHHH---
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCC-----CCCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHH---
T ss_conf             67999999999999998652899527898860579-----9758999999986598438997624413556534089---


Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHHC
Q ss_conf             8999999975997589816898798999999999999842
Q gi|254780200|r  301 HEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEKITRRELM  340 (343)
Q Consensus       301 ie~~e~~~e~Gg~~~~rvp~lN~~~~fi~~La~lv~~~l~  340 (343)
                      -..++...+.++..+..|+..-++|.||+++++.|+++++
T Consensus       127 ~~~~~~~~~~~~~~~~~I~~~~~~p~yi~a~a~~I~~~l~  166 (310)
T 2h1v_A          127 KRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYA  166 (310)
T ss_dssp             HHHHHHHHHHCSCEEEECCCCTTCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHHHH
T ss_conf             9999998743487369956867987799999999999998


No 12 
>1tjn_A Sirohydrochlorin cobaltochelatase; AF0721, APC5049, midwest consortium for structural genomics, protein structure initiative, A. fulgidus; 2.01A {Archaeoglobus fulgidus} SCOP: c.92.1.3 PDB: 2dj5_A
Probab=96.92  E-value=0.0051  Score=40.14  Aligned_cols=115  Identities=12%  Similarity=0.032  Sum_probs=58.0

Q ss_pred             CEEEEEECCCCHHHHHHCCCC-HHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             669998336750267627998-8899999999999726675670478622577765443026899998997699839997
Q gi|254780200|r  206 EMLLVSFHQMPVSYLLKGDPY-GCHCHKTARLLKEFLSWPDDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAII  284 (343)
Q Consensus       206 ~~llfSaHglP~~~~~~gDpY-~~q~~~t~~~i~~~l~~~~~~~~l~fQSr~Gp~~WL~P~t~~~l~~L~~~G~k~v~v~  284 (343)
                      ..||+.+||-..       |. .....+.++.+.++.+.  .....||-      ++-+|.+.+.+  +.+.|.++|+|+
T Consensus        25 ~gllLvgHGSr~-------~~~~~~~~~la~~l~~~~~~--~~V~~~fl------E~~ep~~~~~~--l~~~g~~~Ivvv   87 (156)
T 1tjn_A           25 RGLVIVGHGSQL-------NHYREVMELHRKRIEESGAF--DEVKIAFA------ARKRRPMPDEA--IREMNCDIIYVV   87 (156)
T ss_dssp             EEEEEEECCTTS-------TTHHHHHHHHHHHHHHHTSS--SEEEEEEC------SSSCSSCHHHH--HHHCCCSEEEEE
T ss_pred             CEEEEEECCCCC-------HHHHHHHHHHHHHHHHHCCC--CEEEEEEE------ECCCCCCHHHH--HHHCCCCEEEEE
T ss_conf             569999589998-------78999999999999967899--81978987------61689809999--987499869986


Q ss_pred             CCHHHHCCHHHHHHHHHHHHHHHH------HCCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             440542212558887589999999------759975898168987989999999999998
Q gi|254780200|r  285 TPGFSSDCLETSYEIAHEAKEIFV------NGGGEKFTQVPCLNSSNLSIDLLEKITRRE  338 (343)
Q Consensus       285 p~gFvsD~lETl~Eidie~~e~~~------e~Gg~~~~rvp~lN~~~~fi~~La~lv~~~  338 (343)
                      | =|+++..-|..||--+......      +.-|..+.+.+.|+.+|..+++|.+.|.+.
T Consensus        88 P-lfL~~G~H~~~DIP~~l~~~~~~~~~~~~~~g~~I~~a~pLG~d~~l~dvil~rv~~~  146 (156)
T 1tjn_A           88 P-LFISYGLHVTEDLPDLLGFPRGRGIKEGEFEGKKVVICEPIGEDYFVTYAILNSVFRI  146 (156)
T ss_dssp             E-CCSSCSHHHHTHHHHHHTCCCSSSCEEEEETTEEEEECCCSTTCHHHHHHHHHHHHCC
T ss_pred             E-HHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             0-1112783267678999975131254312469838998478889989999999999997


No 13 
>2jh3_A Ribosomal protein S2-related protein; CBIX, SAD phasing, structural genomics, chelatase super-family fold, 4Fe-4S iron-sulphur cluster; 1.9A {Deinococcus radiodurans}
Probab=95.50  E-value=0.0097  Score=38.21  Aligned_cols=102  Identities=14%  Similarity=0.085  Sum_probs=67.4

Q ss_pred             HHHHHHHHHHHHHCCCCCCCHHHHHCCCCCHHHHHHHHH--------HCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             599999999865224784300112104542478999998--------709965899631711100146899999999998
Q gi|254780200|r   95 TRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLR--------EEGCDRLLIFPLYPQYSAATTGTAQDKVFQELI  166 (343)
Q Consensus        95 t~~qa~~L~~~L~~~~~~~V~~amry~~P~i~~~l~~l~--------~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l~  166 (343)
                      ....++.|++..   .-..|..++--..|+++++...+.        ..|.++|+++|+|=+--..|..-+-+.+...-.
T Consensus       157 ~~~~A~~L~e~~---~~~~V~~~fle~~P~v~~~~~~~~a~~~~~~~~~~~~rVVVvPyFLa~G~ht~~dIPe~l~~a~~  233 (474)
T 2jh3_A          157 LETHAQALRERG---QFAGVEVVLESREALTPESHAASAVPLSEWPSRVEAGQAVLVPFLTHLGKHAAERLQQALAQAAE  233 (474)
T ss_dssp             HHHHHHHHHHHC---CSSEEEEEECCCC---------CCEEGGGGGGGCCSSCEEEEECSSCCCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHC---CCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             589999999745---87736888851467731023455665555543158885999851148873214467888765442


Q ss_pred             HHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             717998642133455780068999999999997
Q gi|254780200|r  167 HMRWSPSLRTVPPYYEDSDYISALAQSIREHFE  199 (343)
Q Consensus       167 ~~~~~~~~~~I~~~~~~p~yI~a~~~~I~~~l~  199 (343)
                      .....+.+.+-.+.-.||...+.+.++.+++..
T Consensus       234 r~~~~~~i~~A~pLG~hp~ladlVleR~~EA~a  266 (474)
T 2jh3_A          234 RFPQAPPLHVGGPVGEHPAVAEVVLALAAEGRE  266 (474)
T ss_dssp             HCTTCCCEEECCCGGGSTTHHHHHHHHHHTTCS
T ss_pred             HCCCCCCEEECCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             135677425536678875899999999998611


No 14 
>1tjn_A Sirohydrochlorin cobaltochelatase; AF0721, APC5049, midwest consortium for structural genomics, protein structure initiative, A. fulgidus; 2.01A {Archaeoglobus fulgidus} SCOP: c.92.1.3 PDB: 2dj5_A
Probab=93.91  E-value=0.11  Score=30.98  Aligned_cols=83  Identities=19%  Similarity=0.179  Sum_probs=52.0

Q ss_pred             CCCHHHHH-CCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHCC---------CCCCCCCCCCC
Q ss_conf             43001121-045424789999987099658996317111001468999999999987179---------98642133455
Q gi|254780200|r  112 IVVDWAMR-YGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRW---------SPSLRTVPPYY  181 (343)
Q Consensus       112 ~~V~~amr-y~~P~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l~~~~~---------~~~~~~I~~~~  181 (343)
                      ..|..|+- +.+|.+.+.+  +++.|+++|+++|+|=.-.    .-+.+.+-+.+.....         ..++.+-++.-
T Consensus        57 ~~V~~~flE~~ep~~~~~~--l~~~g~~~IvvvPlfL~~G----~H~~~DIP~~l~~~~~~~~~~~~~~g~~I~~a~pLG  130 (156)
T 1tjn_A           57 DEVKIAFAARKRRPMPDEA--IREMNCDIIYVVPLFISYG----LHVTEDLPDLLGFPRGRGIKEGEFEGKKVVICEPIG  130 (156)
T ss_dssp             SEEEEEECSSSCSSCHHHH--HHHCCCSEEEEEECCSSCS----HHHHTHHHHHHTCCCSSSCEEEEETTEEEEECCCST
T ss_pred             CEEEEEEEECCCCCCHHHH--HHHCCCCEEEEEEHHHCCC----CHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCC
T ss_conf             8197898761689809999--9874998699860111278----326767899997513125431246983899847888


Q ss_pred             CCCHHHHHHHHHHHHHHHH
Q ss_conf             7800689999999999973
Q gi|254780200|r  182 EDSDYISALAQSIREHFES  200 (343)
Q Consensus       182 ~~p~yI~a~~~~I~~~l~~  200 (343)
                      .+|...+++.+++.+...+
T Consensus       131 ~d~~l~dvil~rv~~~~~~  149 (156)
T 1tjn_A          131 EDYFVTYAILNSVFRIGRD  149 (156)
T ss_dssp             TCHHHHHHHHHHHHCCC--
T ss_pred             CCHHHHHHHHHHHHHHHCC
T ss_conf             9989999999999997326


No 15 
>2prs_A High-affinity zinc uptake system protein ZNUA; protein consists of two (beta/ALFA)4 domains, metal transport; 1.70A {Escherichia coli} PDB: 2osv_A 2ps0_A 2ps3_A 2ps9_A 2ogw_A
Probab=91.81  E-value=0.75  Score=25.08  Aligned_cols=216  Identities=8%  Similarity=-0.000  Sum_probs=109.2

Q ss_pred             HHHHHHHHHHHHHCCCCCCCHHHHHCCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHH---HHHCCC
Q ss_conf             59999999986522478430011210454247899999870996589963171110014689999999999---871799
Q gi|254780200|r   95 TRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQEL---IHMRWS  171 (343)
Q Consensus        95 t~~qa~~L~~~L~~~~~~~V~~amry~~P~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l---~~~~~~  171 (343)
                      |-.+.++|++     .++.|..|+-+- |++++.++++...   +.+.+.....-.........+.....-   ......
T Consensus        39 ~p~d~~~l~~-----Adlvv~~G~~~E-~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  109 (284)
T 2prs_A           39 RPSDVKRLQN-----ADLVVWVGPEME-AFMQKPVSKLPGA---KQVTIAQLEDVKPLLMKSIHGDDDDHDHAEKSDEDH  109 (284)
T ss_dssp             CTTHHHHHHH-----CSEEEECCTTTC-GGGHHHHHTSCGG---GEEEGGGCTTTGGGCCC-------------------
T ss_pred             CHHHHHHHHC-----CCEEEECCCCHH-HHHHHHHHHCCCC---CCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             9999999966-----999999485417-7899999857577---622321004654432112356533334444566555


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCEEE
Q ss_conf             86421334557800689999999999973389986699983367502676279988899999999999726675670478
Q gi|254780200|r  172 PSLRTVPPYYEDSDYISALAQSIREHFESIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKIC  251 (343)
Q Consensus       172 ~~~~~I~~~~~~p~yI~a~~~~I~~~l~~~~~~~~~llfSaHglP~~~~~~gDpY~~q~~~t~~~i~~~l~~~~~~~~l~  251 (343)
                      ..-.+-+++|-+|.....+++.|.+.|.+..-...          ..+-.+.+.|..++....+.+.+.+.-..++-.++
T Consensus       110 ~~~~~dpHvWldp~~~~~~a~~Ia~~L~~~dP~~~----------~~y~~n~~~~~~~l~~l~~~~~~~l~~~~~~~~i~  179 (284)
T 2prs_A          110 HHGDFNMHLWLSPEIARATAVAIHGKLVELMPQSR----------AKLDANLKDFEAQLASTETQVGNELAPLKGKGYFV  179 (284)
T ss_dssp             --CCCCCCGGGCHHHHHHHHHHHHHHHHHHCGGGH----------HHHHHHHHHHHHHHHHHHHHHHHHHGGGTTCCEEE
T ss_pred             CCCCCCCEEECCHHHHHHHHHHHHHHHHHHCHHHH----------HHHHHHHHHHHHHHHHHHHHHHHHHCHHHCCCCCE
T ss_conf             57999971745999999999999999987594867----------66778999999999998999999834242577310


Q ss_pred             EECC-----------------CCCCCCCCHHHHHHHHHHHH-CCCCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             6225-----------------77765443026899998997-69983999744054221255888758999999975997
Q gi|254780200|r  252 FQSR-----------------FGRIKCLEPPTDKTVEKLAH-DGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGE  313 (343)
Q Consensus       252 fQSr-----------------~Gp~~WL~P~t~~~l~~L~~-~G~k~v~v~p~gFvsD~lETl~Eidie~~e~~~e~Gg~  313 (343)
                      +-..                 .+++...+|.-...+.++.+ ++++ ++++-+.+-++-.|+|          +.+.|+ 
T Consensus       180 ~H~af~Y~~~~~gl~~~~~~~~~~~~~ps~~~l~~~~~~ik~~~i~-~i~~e~~~~~~~~~~l----------a~e~~v-  247 (284)
T 2prs_A          180 FHDAYGYFEKQFGLTPLGHFTVNPEIQPGAQRLHEIRTQLVEQKAT-CVFAEPQFRPAVVESV----------ARGTSV-  247 (284)
T ss_dssp             EESCCHHHHHHHTCCCCEEEESSTTSCCCHHHHHHHHHHHHHTTCC-EEEECTTSCSHHHHHH----------TTTSCC-
T ss_pred             ECCHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCC-EEEEECCCCHHHHHHH----------HHHHCC-
T ss_conf             1605676899769847543135876678989999999987515984-8998589891999999----------998099-


Q ss_pred             EEEEECCCCC-----CHHHHHHHHHHH---HHHHCC
Q ss_conf             5898168987-----989999999999---998428
Q gi|254780200|r  314 KFTQVPCLNS-----SNLSIDLLEKIT---RRELMG  341 (343)
Q Consensus       314 ~~~rvp~lN~-----~~~fi~~La~lv---~~~l~g  341 (343)
                      ....+..++.     ...|.+++...+   .+.|+|
T Consensus       248 ~~~~ldpl~~~~~~~~~~Y~~~m~~n~~~l~~aL~g  283 (284)
T 2prs_A          248 RMGTLDPLGTNIKLGKTSYSEFLSQLANQYASCLKG  283 (284)
T ss_dssp             EEEECCTTCTTSCCSTTHHHHHHHHHHHHHHHHHSC
T ss_pred             CEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             779844776677777042999999999999998678


No 16 
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 2i6o_A* 2dxp_A* 2i6p_A*
Probab=77.64  E-value=3.7  Score=20.22  Aligned_cols=23  Identities=35%  Similarity=0.624  Sum_probs=18.8

Q ss_pred             CCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             45424789999987099658996
Q gi|254780200|r  121 GKPSVKEIINNLREEGCDRLLIF  143 (343)
Q Consensus       121 ~~P~i~~~l~~l~~~g~~~ii~l  143 (343)
                      .-|..++-+..|++.|++.|+-|
T Consensus        13 ~~P~~~~~~~~l~~~gi~~Iv~L   35 (161)
T 2i6j_A           13 GLPYTENEILEWRKEGVKRVLVL   35 (161)
T ss_dssp             CCCSSHHHHHHHHHHTCCEEEEC
T ss_pred             CCCCCHHHHHHHHHCCCCEEEEC
T ss_conf             79999999999997799899988


No 17 
>1xla_A D-xylose isomerase; isomerase(intramolecular oxidoreductse); 2.30A {Arthrobacter SP} SCOP: c.1.15.3 PDB: 1die_A* 1did_A 1xlb_A 1xlc_A* 1xld_A* 1xle_A 1xlf_A* 1xlg_A* 1xlh_A 1xli_A* 1xlj_A* 1xlk_A 1xll_A 1xlm_A* 4xia_A* 5xia_A*
Probab=74.97  E-value=4.4  Score=19.74  Aligned_cols=58  Identities=9%  Similarity=0.113  Sum_probs=24.3

Q ss_pred             HHHHHHHHCCCCEEEEEECCHHH--HHHH--------HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCH
Q ss_conf             89999987099658996317111--0014--------68999999999987179986421334557800
Q gi|254780200|r  127 EIINNLREEGCDRLLIFPLYPQY--SAAT--------TGTAQDKVFQELIHMRWSPSLRTVPPYYEDSD  185 (343)
Q Consensus       127 ~~l~~l~~~g~~~ii~lPLyPqy--S~sT--------tgS~~~~~~~~l~~~~~~~~~~~I~~~~~~p~  185 (343)
                      .+++-.++-|.+.+++-|-.-=|  ...|        ...+++++.+...+.+....+ .|.+-..+|.
T Consensus       120 ~~idia~~LGa~~~vlW~GrdG~~~~~~~d~~~~~d~l~e~l~~v~~~a~~~g~~~~i-~IEpKP~EP~  187 (394)
T 1xla_A          120 HNIDLAAEMGAETFVMWGGREGSEYDGSKDLAAALDRMREGVDTAAGYIKDKGYNLRI-ALEPKPNEPR  187 (394)
T ss_dssp             HHHHHHHHTTCSEEEECCTTCEESSGGGCCHHHHHHHHHHHHHHHHHHHHHHTCCCEE-EECCCSSSSS
T ss_pred             HHHHHHHHHCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEE-EECCCCCCCC
T ss_conf             9999999958981787268764357776699999999999999999999861988448-8434567876


No 18 
>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii OT3} SCOP: c.2.1.8 c.23.4.1 c.23.4.1
Probab=56.72  E-value=9.7  Score=17.33  Aligned_cols=57  Identities=11%  Similarity=0.165  Sum_probs=31.5

Q ss_pred             HHHHHHHHHHCC-CCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             689999899769-983999744054221255888758999999975997589816898798999999999999
Q gi|254780200|r  266 TDKTVEKLAHDG-IKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEKITRR  337 (343)
Q Consensus       266 t~~~l~~L~~~G-~k~v~v~p~gFvsD~lETl~Eidie~~e~~~e~Gg~~~~rvp~lN~~~~fi~~La~lv~~  337 (343)
                      .+..++.+.+.+ .|-|+++..|-.         .+-+.++.+.++|      +|++.+-..-+.+++.+++-
T Consensus       390 ~~~l~~~~~~~~~~kPvv~~~~g~~---------~~~~~~~~l~~~G------ip~f~~pe~a~~Al~~l~~y  447 (457)
T 2csu_A          390 AEGIIRAVKEVNNEKPVLAMFMAGY---------VSEKAKELLEKNG------IPTYERPEDVASAAYALVEQ  447 (457)
T ss_dssp             HHHHHHHHHHHCCCCCEEEEEECTT---------TTHHHHHHHHTTT------CCEESSHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHCCCCCEEEEECCCC---------CHHHHHHHHHHCC------CCCCCCHHHHHHHHHHHHHH
T ss_conf             9999999998489997899978976---------6099999998689------98679999999999999999


No 19 
>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP}
Probab=56.02  E-value=9.9  Score=17.26  Aligned_cols=24  Identities=13%  Similarity=0.099  Sum_probs=19.6

Q ss_pred             CCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             045424789999987099658996
Q gi|254780200|r  120 YGKPSVKEIINNLREEGCDRLLIF  143 (343)
Q Consensus       120 y~~P~i~~~l~~l~~~g~~~ii~l  143 (343)
                      .+.|.++.+++.+.+.|+++++++
T Consensus        29 ~g~~ll~~~i~~~~~~~~~~iivv   52 (199)
T 2waw_A           29 GDTTLLGATLAMARRCPFDQLIVT   52 (199)
T ss_dssp             TTEEHHHHHHHHHHTSSCSEEEEE
T ss_pred             CCCHHHHHHHHHHHCCCCEEEECC
T ss_conf             993199999997423331167415


No 20 
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-2; 2.00A {Corynebacterium glutamicum}
Probab=54.22  E-value=2.1  Score=21.94  Aligned_cols=10  Identities=20%  Similarity=0.109  Sum_probs=3.2

Q ss_pred             HHHHHHHHHH
Q ss_conf             6899999999
Q gi|254780200|r  186 YISALAQSIR  195 (343)
Q Consensus       186 yI~a~~~~I~  195 (343)
                      +++=+++.|.
T Consensus       341 hvdDva~ai~  350 (516)
T 3oh8_A          341 AIDDLTDIYY  350 (516)
T ss_dssp             EHHHHHHHHH
T ss_pred             EHHHHHHHHH
T ss_conf             7999999999


No 21 
>2h06_A Ribose-phosphate pyrophosphokinase I; PRS1, PRPP synthetase 1, phosphoribosyl pyrophosphate synthetase 1, transferase; 2.20A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h07_A 2h08_A
Probab=52.36  E-value=11  Score=16.86  Aligned_cols=165  Identities=15%  Similarity=0.121  Sum_probs=81.1

Q ss_pred             HHHHHHCCCCEE-EEEECCHHHHHHHHH------HHHHHHHHHHHHHCCC------CCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             999987099658-996317111001468------9999999999871799------864213345578006899999999
Q gi|254780200|r  129 INNLREEGCDRL-LIFPLYPQYSAATTG------TAQDKVFQELIHMRWS------PSLRTVPPYYEDSDYISALAQSIR  195 (343)
Q Consensus       129 l~~l~~~g~~~i-i~lPLyPqyS~sTtg------S~~~~~~~~l~~~~~~------~~~~~I~~~~~~p~yI~a~~~~I~  195 (343)
                      +..+++.|..+| +++|-|| ||+---.      -+.+.+.+.+...+..      +.-.-+..|++-|.-.-.....+.
T Consensus        74 i~alr~~~A~~It~ViPYl~-YaRQDr~~~~ge~isak~va~lL~~~G~d~vit~DlH~~~i~~~f~~~~~~~~~~~~~~  152 (326)
T 2h06_A           74 INACKIASASRVTAVIPCFP-YARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVL  152 (326)
T ss_dssp             HHHHHTTTBSEEEEEESSCT-TTTCCSCSSSSCCCHHHHHHHHHHHHTCCEEEEESCSSGGGGGGCSSCEEEECSHHHHH
T ss_pred             HHHHHHCCCCEEEEEEEECC-CCCCCCCCCCCCCEEHHHHHHHHHHCCCCEEEEECCCHHHHHHCCCCCCCCCCCCCHHH
T ss_conf             88887568872899987313-43133133798865399999999870899799964887998421589865321540345


Q ss_pred             HHHHHCCCCC-CEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCC---------------
Q ss_conf             9997338998-669998336750267627998889999999999972667567047862257776---------------
Q gi|254780200|r  196 EHFESIQWTP-EMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKICFQSRFGRI---------------  259 (343)
Q Consensus       196 ~~l~~~~~~~-~~llfSaHglP~~~~~~gDpY~~q~~~t~~~i~~~l~~~~~~~~l~fQSr~Gp~---------------  259 (343)
                      ..+.....+. ..++.|    |    +.|.      .+-++.+++.||.+   +......|.+..               
T Consensus       153 ~~~~~~~~~~~~~vvvs----P----D~Ga------~kra~~~a~~l~~~---~~~~~K~R~~~~~v~~~~~~gdV~gk~  215 (326)
T 2h06_A          153 KWIRENISEWRNCTIVS----P----DAGG------AKRVTSIADRLNVD---FALIHKERKKANEVDRMVLVGDVKDRV  215 (326)
T ss_dssp             HHHHTTCTTGGGCEEEE----S----SGGG------HHHHHHHHHHHTCE---EEEEEECC------CCEEEESCCTTEE
T ss_pred             HHHHHHCCCCCCCEEEC----C----CCCH------HHHHHHHHHHHCCC---EEEEEEEECCCCCEEEEEEECCCCCCE
T ss_conf             67887425766776986----7----9557------99999999982897---434655524898142467621332440


Q ss_pred             -------CCCCHHHHHHHHHHHHCCCCCEEEECC-HHHH-CCHHHHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             -------544302689999899769983999744-0542-21255888758999999975997589816898
Q gi|254780200|r  260 -------KCLEPPTDKTVEKLAHDGIKSLAIITP-GFSS-DCLETSYEIAHEAKEIFVNGGGEKFTQVPCLN  322 (343)
Q Consensus       260 -------~WL~P~t~~~l~~L~~~G~k~v~v~p~-gFvs-D~lETl~Eidie~~e~~~e~Gg~~~~rvp~lN  322 (343)
                             ==.+=++.++.+.|.++|.++|.+++. |-.+ +.+|-           +.++|.+.+....++.
T Consensus       216 vIIVDDii~TGgTl~~aa~~Lk~~GA~~V~~~aTHglfs~~a~e~-----------l~~s~i~~ivvTnTIp  276 (326)
T 2h06_A          216 AILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISR-----------INNACFEAVVVTNTIP  276 (326)
T ss_dssp             EEEEEEEESSCHHHHHHHHHHHHTTEEEEEEEEEEECCCTTHHHH-----------HHHSCEEEEEEETTSC
T ss_pred             EEEECCHHHCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHH-----------HHCCCCCEEEECCCCC
T ss_conf             588641553326799999999857998656886434458179999-----------8647998899868856


No 22 
>2al1_A Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: PEP 2PG; 1.50A {Saccharomyces cerevisiae} SCOP: c.1.11.1 d.54.1.1 PDB: 1ebg_A 1ebh_A* 1one_A* 2one_A* 1p48_A* 1p43_A* 1l8p_A 4enl_A 1nel_A 1els_A 3enl_A 5enl_A* 6enl_A 7enl_A* 2al2_A* 2al2_B* 2xh7_A* 2xgz_A* 2xh2_A* 2xh4_A* ...
Probab=50.47  E-value=12  Score=16.67  Aligned_cols=187  Identities=10%  Similarity=0.044  Sum_probs=96.9

Q ss_pred             CCCEEEEEEC-CHHHHHH--HHHHHHHHHHHHHHHHCCC------CCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             9965899631-7111001--4689999999999871799------86421334557800689999999999973389986
Q gi|254780200|r  136 GCDRLLIFPL-YPQYSAA--TTGTAQDKVFQELIHMRWS------PSLRTVPPYYEDSDYISALAQSIREHFESIQWTPE  206 (343)
Q Consensus       136 g~~~ii~lPL-yPqyS~s--TtgS~~~~~~~~l~~~~~~------~~~~~I~~~~~~p~yI~a~~~~I~~~l~~~~~~~~  206 (343)
                      .+++++++|. +.-|+.+  ....++..+.+.+++....      .+=-|.+++.+...-++.+.+.|...    ....+
T Consensus       165 diQEfmIiP~ga~sf~eal~~~~eVy~~lk~~L~~k~g~~~t~vgDEGGfaP~~~~~eeaL~ll~~Ai~~a----Gy~~~  240 (436)
T 2al1_A          165 ALQEFMIAPTGAKTFAEALRIGSEVYHNLKSLTKKRYGASAGNVGDEGGVAPNIQTAEEALDLIVDAIKAA----GHDGK  240 (436)
T ss_dssp             CSCEEEEECTTCSSHHHHHHHHHHHHHHHHHHHHHHHCGGGGSBCTTSCBCCCCSCHHHHHHHHHHHHHHH----TCTTT
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHC----CCCCC
T ss_conf             60137850689999999999999999999999986327666763787662778887199999999999964----99763


Q ss_pred             -EEE--EEECCC--CHHHHHHCC---------CCHHHHHHHHHHHHHHH-------CCCCCCCEEEEE---CCCCC---C
Q ss_conf             -699--983367--502676279---------98889999999999972-------667567047862---25777---6
Q gi|254780200|r  207 -MLL--VSFHQM--PVSYLLKGD---------PYGCHCHKTARLLKEFL-------SWPDDRFKICFQ---SRFGR---I  259 (343)
Q Consensus       207 -~ll--fSaHgl--P~~~~~~gD---------pY~~q~~~t~~~i~~~l-------~~~~~~~~l~fQ---Sr~Gp---~  259 (343)
                       .+-  +-|+.+  ..+|.-.+.         --..|..+....+.++.       ++.+++|. +|+   .+.|-   +
T Consensus       241 i~i~lD~AASefy~~~kY~~~~~~~~~~~~~~~s~~elid~y~~l~~~yPIisIEDp~~e~D~~-gw~~lt~~~g~~iVG  319 (436)
T 2al1_A          241 VKIGLDCASSEFFKDGKYDLDFKNPNSDKSKWLTGPQLADLYHSLMKRYPIVSIEDPFAEDDWE-AWSHFFKTAGIQIVA  319 (436)
T ss_dssp             CEEEEECCGGGGEETTEECTTTTCTTCCGGGCBCHHHHHHHHHHHHHHSCEEEEECCSCTTCHH-HHHHHHTTCCSEEEE
T ss_pred             EEEEECCHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCCCHHHH-HHHHHHHHCCCEEEC
T ss_conf             5898623056551288247761267766663003699999999999769988996798802489-999999854917854


Q ss_pred             CCCCHHHHHHHHHHHHCCCCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             5443026899998997699839997440542212558887589999999759975898168987989999999
Q gi|254780200|r  260 KCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLE  332 (343)
Q Consensus       260 ~WL~P~t~~~l~~L~~~G~k~v~v~p~gFvsD~lETl~Eidie~~e~~~e~Gg~~~~rvp~lN~~~~fi~~La  332 (343)
                      -=|-..-.+.|++-.+++.-|-+++=|.=+---.||+     |+-+.+.++|.....--.+=-+.+.||.-||
T Consensus       320 DDL~vTn~~rl~~gi~~~~~NavliK~NQiGTvset~-----eai~~a~~~g~~~ivShrsGETeD~~iadLA  387 (436)
T 2al1_A          320 DDLTVTNPKRIATAIEKKAADALLLKVNQIGTLSESI-----KAAQDSFAAGWGVMVSHRSGETEDTFIADLV  387 (436)
T ss_dssp             STTTTTCHHHHHHHHHTTCCSEEEECHHHHCCHHHHH-----HHHHHHHHTTCEEEEECCSBCCSCCHHHHHH
T ss_pred             CCCCCCCHHHHHHCCCCCCCCCEEEECCCCCCHHHHH-----HHHHHHHHCCCEEEEECCCCCCCCCHHHHHH
T ss_conf             3002343255551313577661276033422099999-----9999999879879997788886620599999


No 23 
>3cx3_A Lipoprotein; zinc-binding, transport, lipid binding protein, metal binding protein; 2.40A {Streptococcus pneumoniae}
Probab=47.75  E-value=13  Score=16.38  Aligned_cols=208  Identities=11%  Similarity=0.089  Sum_probs=104.8

Q ss_pred             HHHHHHHHHHHHHCCCCCCCHHHHHCCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             59999999986522478430011210454247899999870996589963171110014689999999999871799864
Q gi|254780200|r   95 TRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSL  174 (343)
Q Consensus        95 t~~qa~~L~~~L~~~~~~~V~~amry~~P~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l~~~~~~~~~  174 (343)
                      |-.+..+|++     .++.|..|..+ +|++...++.+...++   .++.+----+........ ....   ..+....-
T Consensus        49 ~p~d~~~l~~-----ADliv~~G~~l-E~~~~~~~~~~~~~~~---~v~~~~~~~~~~~~~~~~-~~~~---~~~~~~~~  115 (284)
T 3cx3_A           49 SANDIAAIYD-----ADVFVYHSHTL-ESWAGSLDPNLKKSKV---KVLEASEGMTLERVPGLE-DVEA---GDGVDEKT  115 (284)
T ss_dssp             CHHHHHHHHH-----SSEEEESCTTT-SCTTTTCCTTTTTCCC---EEEETTTTCCCCBCCC-----------------C
T ss_pred             CHHHHHHHHC-----CCEEEEECCCC-HHHHHHHHHHHHCCCC---EEEECCCCCCCCCCCCCC-CCCC---CCCCCCCC
T ss_conf             9999999964-----99999918850-7789999998641575---132112365400013421-1004---55545456


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEC
Q ss_conf             21334557800689999999999973389986699983367502676279988899999999999726675670478622
Q gi|254780200|r  175 RTVPPYYEDSDYISALAQSIREHFESIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKICFQS  254 (343)
Q Consensus       175 ~~I~~~~~~p~yI~a~~~~I~~~l~~~~~~~~~llfSaHglP~~~~~~gDpY~~q~~~t~~~i~~~l~~~~~~~~l~fQS  254 (343)
                      ..-+++|-+|.....+++.|.+.|.+.+-..          -..+..+..-|..++.+.-+.+.+.+.-..++..++|..
T Consensus       116 ~~dPH~Wldp~~~~~~a~~I~~~L~~~dP~~----------~~~y~~n~~~~~~~l~~l~~~~~~~l~~~~~~~~v~~h~  185 (284)
T 3cx3_A          116 LYDPHTWLDPEKAGEEAQIIADKLSEVDSEH----------KETYQKNAQAFIKKAQELTKKFQPKFEKATQKTFVTQHT  185 (284)
T ss_dssp             CBCCCGGGSHHHHHHHHHHHHHHHHHHSGGG----------HHHHHHHHHHHHHHHHHHHHHHHHHHHSCSCCCEEEEES
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC----------HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             8888665783678999999999999868310----------678899999998778998899999875314564588661


Q ss_pred             C-------C----------CCCCCCCHHHHHHHHH-HHHCCCCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             5-------7----------7765443026899998-99769983999744054221255888758999999975997589
Q gi|254780200|r  255 R-------F----------GRIKCLEPPTDKTVEK-LAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFT  316 (343)
Q Consensus       255 r-------~----------Gp~~WL~P~t~~~l~~-L~~~G~k~v~v~p~gFvsD~lETl~Eidie~~e~~~e~Gg~~~~  316 (343)
                      .       +          .++.-.+|.-...+.+ +.+.+++-| ++-+.|-++-+++|          +.+.|. ...
T Consensus       186 a~~Y~~~~~gl~~~~~~~~~~~~~ps~~~l~~l~~~ik~~~v~~i-f~e~~~~~~~~~~l----------a~e~g~-~~~  253 (284)
T 3cx3_A          186 AFSYLAKRFGLNQLGIAGISPEQEPSPRQLTEIQEFVKTYKVKTI-FTESNASSKVAETL----------VKSTGV-GLK  253 (284)
T ss_dssp             CCHHHHHHTTCCEEEEECSSTTCCCCSHHHHHHHHHHHHTTCCCE-EECSSSCCHHHHHH----------HSSSSC-CEE
T ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCEE-EECCCCCHHHHHHH----------HHHCCC-CEE
T ss_conf             279999987994444111256554228899999999985599789-98189991999999----------997199-868


Q ss_pred             EECCCCCC----HHHHHHHHHHHHH
Q ss_conf             81689879----8999999999999
Q gi|254780200|r  317 QVPCLNSS----NLSIDLLEKITRR  337 (343)
Q Consensus       317 rvp~lN~~----~~fi~~La~lv~~  337 (343)
                      .+..+...    +.++++|...+..
T Consensus       254 ~ld~l~~~~~~~~~Y~~~m~~n~~~  278 (284)
T 3cx3_A          254 TLNPLESDPQNDKTYLENLEENMSI  278 (284)
T ss_dssp             ECCCSSSCCCSSCCHHHHHHHHHHH
T ss_pred             EECCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             8567777888867799999999999


No 24 
>1muw_A Xylose isomerase; atomic resolution, disorder; 0.86A {Streptomyces olivochromogenes} SCOP: c.1.15.3 PDB: 1s5m_A* 1s5n_A* 2gyi_A* 1xyb_A* 1xyc_A* 1xya_A* 1xyl_A 1xym_A* 1dxi_A 3gnx_A* 1gw9_A* 1xib_A 1xic_A* 1xid_A* 1xie_A* 1xif_A* 1xig_A* 1xih_A* 1xii_A* 1xij_A ...
Probab=46.97  E-value=14  Score=16.30  Aligned_cols=107  Identities=10%  Similarity=0.139  Sum_probs=43.6

Q ss_pred             HHHHHHHHHHHHHCCC-CCCCHHHHHCCC----------CCHH----------HHHHHHHHCCCCEEEEEECCHHH--HH
Q ss_conf             5999999998652247-843001121045----------4247----------89999987099658996317111--00
Q gi|254780200|r   95 TRDQATNLAKRLESIS-SIVVDWAMRYGK----------PSVK----------EIINNLREEGCDRLLIFPLYPQY--SA  151 (343)
Q Consensus        95 t~~qa~~L~~~L~~~~-~~~V~~amry~~----------P~i~----------~~l~~l~~~g~~~ii~lPLyPqy--S~  151 (343)
                      +....+.+++.|++.+ .+.+..+..+++          |.-+          .+++-.++-|++.+++-+=..-|  ..
T Consensus        67 ~~~~~~~ik~~l~~~Gl~~~~~T~nlf~~p~~~~Ga~TspD~~vR~~Ai~~vk~aidiAa~LGa~~vvlw~G~eG~~~~~  146 (386)
T 1muw_A           67 RESHIKRFRQALDATGMTVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAKTYVAWGGREGAESGA  146 (386)
T ss_dssp             HHHHHHHHHHHHHHHTCBCCEEECCCSSSGGGTTCSTTCSSHHHHHHHHHHHHHHHHHHHHHTCSEEEECCTTCEESSTT
T ss_pred             HHHHHHHHHHHHHHCCCCCCEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCC
T ss_conf             79999999999996398421303532468553578778959999999999999999999994998489738977767766


Q ss_pred             HH--------HHHHHHHHHHHHHHHCCCCCCCC-CCCCCCCC---HHHHHHHHHHHHHHHHCCCC
Q ss_conf             14--------68999999999987179986421-33455780---06899999999999733899
Q gi|254780200|r  152 AT--------TGTAQDKVFQELIHMRWSPSLRT-VPPYYEDS---DYISALAQSIREHFESIQWT  204 (343)
Q Consensus       152 sT--------tgS~~~~~~~~l~~~~~~~~~~~-I~~~~~~p---~yI~a~~~~I~~~l~~~~~~  204 (343)
                      .+        ....++++.+...+.+.  .+++ |.+-..+|   .|+..+.+.+ ..+++.+.+
T Consensus       147 ~~d~~~~~~~l~e~L~~v~dya~~~g~--~v~~~IEpkP~EP~~~~~~~t~~~~l-~~l~~~g~~  208 (386)
T 1muw_A          147 AKDVRVALDRMKEAFDLLGEYVTSQGY--DIRFAIEPKPNEPRGDILLPTVGHAL-AFIERLERP  208 (386)
T ss_dssp             SCCHHHHHHHHHHHHHHHHHHHHHHTC--CCEEEECCCSSSSSSEESSCSHHHHH-HHHTTSSSG
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHCC--CCEEEECCCCCCCCCCCCCCCHHHHH-HHHHHCCCC
T ss_conf             579999999999999999999997299--94699613678876440048999999-999980986


No 25 
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A
Probab=46.29  E-value=13  Score=16.54  Aligned_cols=44  Identities=11%  Similarity=0.111  Sum_probs=21.5

Q ss_pred             HHHHHHHHHHCCCCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             68999989976998399974405422125588875899999997599758981689
Q gi|254780200|r  266 TDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCL  321 (343)
Q Consensus       266 t~~~l~~L~~~G~k~v~v~p~gFvsD~lETl~Eidie~~e~~~e~Gg~~~~rvp~l  321 (343)
                      +.+.++++.+.|++.+ ++.+||..          -++.+.|+++|. ++.--.|+
T Consensus        83 v~~~v~e~~~~g~~~v-~~q~G~~~----------~e~~~~a~~~Gi-~vI~~~C~  126 (140)
T 1iuk_A           83 LMDHLPEVLALRPGLV-WLQSGIRH----------PEFEKALKEAGI-PVVADRCL  126 (140)
T ss_dssp             HTTTHHHHHHHCCSCE-EECTTCCC----------HHHHHHHHHTTC-CEEESCCH
T ss_pred             HHHHHHHHHHCCCCEE-EECCCCCC----------HHHHHHHHHCCC-EEECCCCC
T ss_conf             9999999996298989-98989689----------999999999599-79928942


No 26 
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.65A {Pyrococcus horikoshii OT3} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X*
Probab=46.08  E-value=14  Score=16.21  Aligned_cols=46  Identities=20%  Similarity=0.183  Sum_probs=27.2

Q ss_pred             HHHHHHHHHHHHCCCCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             0268999989976998399974405422125588875899999997599758981689
Q gi|254780200|r  264 PPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCL  321 (343)
Q Consensus       264 P~t~~~l~~L~~~G~k~v~v~p~gFvsD~lETl~Eidie~~e~~~e~Gg~~~~rvp~l  321 (343)
                      ..+.+.++++.+.|+|.+.+.+=+| +          -+..+.+.++|. ++.--.|+
T Consensus        88 ~~v~~il~~~~~~g~k~v~~~~g~~-~----------ee~~~~a~~~gi-~~v~~~C~  133 (144)
T 2d59_A           88 KLTMEYVEQAIKKGAKVVWFQYNTY-N----------REASKKADEAGL-IIVANRCM  133 (144)
T ss_dssp             HHHHHHHHHHHHHTCSEEEECTTCC-C----------HHHHHHHHHTTC-EEEESCCH
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCC-C----------HHHHHHHHHCCC-EEECCCCH
T ss_conf             8889999999975999999824644-9----------999999999699-57903621


No 27 
>3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius}
Probab=45.54  E-value=14  Score=16.16  Aligned_cols=24  Identities=21%  Similarity=0.216  Sum_probs=11.0

Q ss_pred             HHHHHHHHHCCCCCEEEECCHHHH
Q ss_conf             899998997699839997440542
Q gi|254780200|r  267 DKTVEKLAHDGIKSLAIITPGFSS  290 (343)
Q Consensus       267 ~~~l~~L~~~G~k~v~v~p~gFvs  290 (343)
                      .+.|+.+++.--|-|.|.=.|..+
T Consensus       236 ~~~l~~~~~~~~KPi~~~E~G~~s  259 (343)
T 3civ_A          236 VPVLREVAEAHEKPLFFMEVGCPS  259 (343)
T ss_dssp             HHHHHHHHHHHTCCEEEEEECCCS
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             678898876308986998536544


No 28 
>1w6t_A Enolase; bacterial infection, surface protein, moonlighting protein, glycolysis, phosphopyruvate hydratase, lyase; HET: 2PE; 2.10A {Streptococcus pneumoniae} SCOP: c.1.11.1 d.54.1.1 PDB: 1iyx_A
Probab=42.43  E-value=16  Score=15.84  Aligned_cols=186  Identities=12%  Similarity=0.146  Sum_probs=95.5

Q ss_pred             CCCEEEEEEC-CHHHHHH--HHHHHHHHHHHHHHHHCCCCCC----CCCCCCCCCCHHHHHHHHHHHHHHHHCCCC---C
Q ss_conf             9965899631-7111001--4689999999999871799864----213345578006899999999999733899---8
Q gi|254780200|r  136 GCDRLLIFPL-YPQYSAA--TTGTAQDKVFQELIHMRWSPSL----RTVPPYYEDSDYISALAQSIREHFESIQWT---P  205 (343)
Q Consensus       136 g~~~ii~lPL-yPqyS~s--TtgS~~~~~~~~l~~~~~~~~~----~~I~~~~~~p~yI~a~~~~I~~~l~~~~~~---~  205 (343)
                      .+++.+++|. ++.|+.+  ....++..+.+.+++.+....+    -|.+++-+.+.-++.+.+.|    +.....   +
T Consensus       171 diQEfmIiP~ga~sf~eal~~~~eV~~~lk~~L~~~g~~t~vgDEGGfaP~~~s~eeaL~li~eAI----~~aGy~~G~d  246 (444)
T 1w6t_A          171 AFQEFMILPVGAPTFKEALRYGAEIFHALKKILKSRGLETAVGDEGGFAPRFEGTEDGVETILAAI----EAAGYVPGKD  246 (444)
T ss_dssp             CCSEEEEECTTCSSHHHHHHHHHHHHHHHHHHHHHTTCCCCBCTTSCBCCCCSSHHHHHHHHHHHH----HHTTCCBTTT
T ss_pred             CHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH----HHHCCCCCCC
T ss_conf             645663289999988999998999999999999856998764878685999999899999999999----9828887871


Q ss_pred             CEE--EEEECCCCH--HHH---H--H--CCC--CHHHHHHHHHHHHHHH-------CCCCCCCE--EEEECCCCC-----
Q ss_conf             669--998336750--267---6--2--799--8889999999999972-------66756704--786225777-----
Q gi|254780200|r  206 EML--LVSFHQMPV--SYL---L--K--GDP--YGCHCHKTARLLKEFL-------SWPDDRFK--ICFQSRFGR-----  258 (343)
Q Consensus       206 ~~l--lfSaHglP~--~~~---~--~--gDp--Y~~q~~~t~~~i~~~l-------~~~~~~~~--l~fQSr~Gp-----  258 (343)
                      ..+  =+.|+.+=.  ++.   .  .  +.-  -..|..+....+.++.       ++.+++|.  -.+++++|.     
T Consensus       247 i~ialD~AAsefy~~~k~~y~~~~~~~~~~~~~s~~elid~y~~l~~~yPIisIEDp~~e~D~~gw~~lt~~lg~~~~iv  326 (444)
T 1w6t_A          247 VFLGFDCASSEFYDKERKVYDYTKFEGEGAAVRTSAEQIDYLEELVNKYPIITIEDGMDENDWDGWKALTERLGKKVQLV  326 (444)
T ss_dssp             BEEEEECCGGGGBC--CCCEETHHHHCTTCCEECHHHHHHHHHHHHHHSCEEEEESCSCTTCHHHHHHHHHHHTTTSEEE
T ss_pred             EEEEECHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCCCCCCCHHHHHHHHHCCEEEEE
T ss_conf             68862042676642677511032236787540289999999999996688779976887434024999999858805886


Q ss_pred             CCCCCHHHHHHHHHHHHCCCCCEEEECC---HHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             6544302689999899769983999744---05422125588875899999997599758981689879899999999
Q gi|254780200|r  259 IKCLEPPTDKTVEKLAHDGIKSLAIITP---GFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEK  333 (343)
Q Consensus       259 ~~WL~P~t~~~l~~L~~~G~k~v~v~p~---gFvsD~lETl~Eidie~~e~~~e~Gg~~~~rvp~lN~~~~fi~~La~  333 (343)
                      +-=|--.-.+.|++-.+++.-+-+++=|   |-+||-+|        +-+++.++|.....--.+--+.+.||.-||=
T Consensus       327 GDDL~vTn~~rl~~gi~~~~~nailiK~NQiGTvset~e--------ai~la~~~g~~~ivShRSGETeD~~iaDLAV  396 (444)
T 1w6t_A          327 GDDFFVTNTDYLARGIQEGAANSILIKVNQIGTLTETFE--------AIEMAKEAGYTAVVSHRSGETEDSTIADIAV  396 (444)
T ss_dssp             ESTTTTTCHHHHHHHHHHTCCSEEEECHHHHCSHHHHHH--------HHHHHHHTTCEEEEECCSSCCSCCHHHHHHH
T ss_pred             CCCCCCCCCHHHHHCCCCCCCHHHHCCCCCCCCHHHHHH--------HHHHHHHCCCEEEEECCCCCCCCCHHHHHHH
T ss_conf             661113571376601133554264023323222999999--------9999998698799978988765105999998


No 29 
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix K1}
Probab=41.55  E-value=16  Score=15.75  Aligned_cols=31  Identities=6%  Similarity=0.259  Sum_probs=21.0

Q ss_pred             CHHHHHCC-CCCHHHHHHHHHHCCCCEEEEEE
Q ss_conf             00112104-54247899999870996589963
Q gi|254780200|r  114 VDWAMRYG-KPSVKEIINNLREEGCDRLLIFP  144 (343)
Q Consensus       114 V~~amry~-~P~i~~~l~~l~~~g~~~ii~lP  144 (343)
                      |..+.-+- .+.+.++++++.+.|+.-++++.
T Consensus        72 vDlavi~vPa~~v~~~v~e~~~~Gvk~~viit  103 (297)
T 2yv2_A           72 INTSIVFVPAPFAPDAVYEAVDAGIRLVVVIT  103 (297)
T ss_dssp             CCEEEECCCGGGHHHHHHHHHHTTCSEEEECC
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEEEC
T ss_conf             64899904731009999999877998899967


No 30 
>1xim_A D-xylose isomerase; isomerase(intramolecular oxidoreductse); HET: XYL; 2.20A {Actinoplanes missouriensis} SCOP: c.1.15.3 PDB: 4xim_A 5xim_A* 6xim_A* 7xim_A 8xim_A* 9xim_A* 3xin_A 2xim_A* 5xin_A* 1xin_A* 1bhw_A* 2xin_A* 3xim_A*
Probab=40.65  E-value=17  Score=15.65  Aligned_cols=52  Identities=10%  Similarity=0.079  Sum_probs=25.1

Q ss_pred             HHHHHHHHHHHHHCCC-CCCCHHHHHC----------CCCCH--H--------HHHHHHHHCCCCEEEEEECC
Q ss_conf             5999999998652247-8430011210----------45424--7--------89999987099658996317
Q gi|254780200|r   95 TRDQATNLAKRLESIS-SIVVDWAMRY----------GKPSV--K--------EIINNLREEGCDRLLIFPLY  146 (343)
Q Consensus        95 t~~qa~~L~~~L~~~~-~~~V~~amry----------~~P~i--~--------~~l~~l~~~g~~~ii~lPLy  146 (343)
                      .+...+.+++.|++.+ .+.+..+.-|          .+|.-  .        ++++-.++-|.+.+++-+=.
T Consensus        67 ~~~~~~~~k~~l~~~Gl~~~~~t~nlf~~p~f~~Ga~TnPD~~vR~~Ai~~~k~aIDiaa~LGa~~~v~W~G~  139 (393)
T 1xim_A           67 RDGIIAGFKKALDETGLIVPMVTTNLFTHPVFKDGGFTSNDRSVRRYAIRKVLRQMDLGAELGAKTLVLWGGR  139 (393)
T ss_dssp             HHHHHHHHHHHHHHHTCBCCEEECCCSSSGGGTTCSTTCSSHHHHHHHHHHHHHHHHHHHHHTCCEEEEECTT
T ss_pred             HHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCC
T ss_conf             9999999999999639841020564356812016887896999999999999999999999689969983798


No 31 
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A*
Probab=40.33  E-value=17  Score=15.62  Aligned_cols=25  Identities=12%  Similarity=0.089  Sum_probs=11.1

Q ss_pred             CCHHHHHHHHHHHHCCCCCEEEECCH
Q ss_conf             43026899998997699839997440
Q gi|254780200|r  262 LEPPTDKTVEKLAHDGIKSLAIITPG  287 (343)
Q Consensus       262 L~P~t~~~l~~L~~~G~k~v~v~p~g  287 (343)
                      ......+.+..+.+.|+ -|.+-=.|
T Consensus       243 ~~~~~~~~~~~~~~~g~-Pv~igEfG  267 (364)
T 1g01_A          243 ERSNVMANVRYALDNGV-AVFATEWG  267 (364)
T ss_dssp             GCCCHHHHHHHHHHTTC-CEEEEEEE
T ss_pred             HHHHHHHHHHHHHHCCC-CEEEEECC
T ss_conf             78999999999997699-88998447


No 32 
>2wm1_A 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; neurological disorders, metal-dependent amidohydrolase, kynurenine pathway; HET: 13P; 2.01A {Homo sapiens}
Probab=39.76  E-value=17  Score=15.56  Aligned_cols=104  Identities=8%  Similarity=-0.078  Sum_probs=50.5

Q ss_pred             CHHHHHHHHHHCCCCEEEEEECCHHHHHHHHH----HHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             24789999987099658996317111001468----99999999998717998642133455780068999999999997
Q gi|254780200|r  124 SVKEIINNLREEGCDRLLIFPLYPQYSAATTG----TAQDKVFQELIHMRWSPSLRTVPPYYEDSDYISALAQSIREHFE  199 (343)
Q Consensus       124 ~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTtg----S~~~~~~~~l~~~~~~~~~~~I~~~~~~p~yI~a~~~~I~~~l~  199 (343)
                      .++.-++.|.+.|+++.|++|.++.+....-.    ...+...+.+.+......=|++.-..-++.-.+..++.++..++
T Consensus        55 d~e~~l~~Md~~GId~~vl~~~~~~~~~~~~~~~~~~~~~~~N~~~~~~~~~~p~Rf~g~~~v~~~~~~~~~~e~~~~~~  134 (336)
T 2wm1_A           55 DPEVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVK  134 (336)
T ss_dssp             CHHHHHHHHHHHTCCEEEEECCGGGGCTTSCHHHHHHHHHHHHHHHHHHHHHSTTTEEEEECCCTTSHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHCCCCEEEECCCCHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHH
T ss_conf             99999999998499699985782675324681789999999999999998768991886304886675899999999987


Q ss_pred             HCCCCCCEEEEEECCCCHHHHHHCCCCHHHHHH
Q ss_conf             338998669998336750267627998889999
Q gi|254780200|r  200 SIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHK  232 (343)
Q Consensus       200 ~~~~~~~~llfSaHglP~~~~~~gDpY~~q~~~  232 (343)
                      .....  .+.+..+.-.   ..-+||.-.-+.+
T Consensus       135 ~~g~~--g~~~~~~~~~---~~~~d~~~~pi~~  162 (336)
T 2wm1_A          135 ELGFP--GVQIGTHVNE---WDLNAQELFPVYA  162 (336)
T ss_dssp             TSCCS--EEEEESEETT---EETTCGGGHHHHH
T ss_pred             CCCCC--EEECCCCCCC---CCCCCHHHHHHHH
T ss_conf             16954--5750554688---7889612214789


No 33 
>2akz_A Gamma enolase, neural; fluoride inhibition, negative cooperativity, glycolysis, , isothermal titration calorimetry, lyase; 1.36A {Homo sapiens} SCOP: c.1.11.1 d.54.1.1 PDB: 2akm_A 1te6_A 2psn_A 3b97_A 2xsx_A 1pdz_A 1pdy_A
Probab=38.31  E-value=18  Score=15.41  Aligned_cols=187  Identities=12%  Similarity=0.106  Sum_probs=98.1

Q ss_pred             CCCCEEEEEEC-CHHHHHHH--HHHHHHHHHHHHHHHCC------CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             09965899631-71110014--68999999999987179------98642133455780068999999999997338998
Q gi|254780200|r  135 EGCDRLLIFPL-YPQYSAAT--TGTAQDKVFQELIHMRW------SPSLRTVPPYYEDSDYISALAQSIREHFESIQWTP  205 (343)
Q Consensus       135 ~g~~~ii~lPL-yPqyS~sT--tgS~~~~~~~~l~~~~~------~~~~~~I~~~~~~p~yI~a~~~~I~~~l~~~~~~~  205 (343)
                      -.+++.+++|. ++-|+.+-  ...++..+.+.+.+...      ..+=-|.+++-+.+.-++.+.+.|..+    ....
T Consensus       162 ldiQEfmIiP~ga~sf~eal~~~~eV~~~lk~~L~~k~~~~~t~vgDEGGfaP~~~~~eeaL~~l~~ai~~a----g~~~  237 (439)
T 2akz_A          162 LAMQEFMILPVGAESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALELVKEAIDKA----GYTE  237 (439)
T ss_dssp             CCSCEEEEECTTCSSHHHHHHHHHHHHHHHHHHHHHHHCGGGGCBCTTSCBCCSCCCHHHHHHHHHHHHHHH----TCTT
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC----CCCC
T ss_conf             660047872699999999999999999999999876236645651687776889755187999999999971----9874


Q ss_pred             C-EE--EEEECCCC--HHHHHHCC--------CCHHHHHHHHHHHHHHH-------CCCCCCCE--EEEECCCCC---CC
Q ss_conf             6-69--99833675--02676279--------98889999999999972-------66756704--786225777---65
Q gi|254780200|r  206 E-ML--LVSFHQMP--VSYLLKGD--------PYGCHCHKTARLLKEFL-------SWPDDRFK--ICFQSRFGR---IK  260 (343)
Q Consensus       206 ~-~l--lfSaHglP--~~~~~~gD--------pY~~q~~~t~~~i~~~l-------~~~~~~~~--l~fQSr~Gp---~~  260 (343)
                      + .+  =+-|+.+=  .+|.-++.        -...|..+....+.++.       ++.+++|.  -.+++++|-   +-
T Consensus       238 ~i~ialD~AAsefy~~gkY~~~~~~~~~~~~~~~~~eli~~y~~li~kyPIisIEDp~~e~D~~gw~~lt~~lg~~IvGD  317 (439)
T 2akz_A          238 KIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALYQDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGD  317 (439)
T ss_dssp             TCEEEEECCGGGGEETTEECTTTTSSCCGGGCBCHHHHHHHHHHHHHHSCEEEEECCSCTTCHHHHHHHHHTCSSEEEES
T ss_pred             EEEEEEHHHHHHHHHCCCEEEEECCCCCCCCEEEHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHCCEEECC
T ss_conf             25653224256543188656750356775303106889999999872088689967987043799999999709778653


Q ss_pred             CCCHHHHHHHHHHHHCCCCCEEEECC---HHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             44302689999899769983999744---05422125588875899999997599758981689879899999999
Q gi|254780200|r  261 CLEPPTDKTVEKLAHDGIKSLAIITP---GFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEK  333 (343)
Q Consensus       261 WL~P~t~~~l~~L~~~G~k~v~v~p~---gFvsD~lETl~Eidie~~e~~~e~Gg~~~~rvp~lN~~~~fi~~La~  333 (343)
                      =|.-.-.+.|++-.+++.-+-+++=|   |-++|-+        |+-+++.++|.....--.+=-+.+.||.-||=
T Consensus       318 Dl~vTn~~rl~~gi~~~~~nailiK~NQiGTvset~--------ea~~la~~~g~~~ivShrSGETeD~~iaDLAV  385 (439)
T 2akz_A          318 DLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAI--------QACKLAQENGWGVMVSHRSGETEDTFIADLVV  385 (439)
T ss_dssp             TTTTTCHHHHHHHHHTTCCSEEEECHHHHCCHHHHH--------HHHHHHHHTTCEEEEECCSBCCSCCHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHCCCCCEEEECCCCCCCHHHHH--------HHHHHHHHCCCEEEEECCCCCCCCHHHHHHHH
T ss_conf             003556899997775477772686266654199999--------99999998798799968888866302889988


No 34 
>1zy9_A Alpha-galactosidase; TM1192, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI, hydrolase; 2.34A {Thermotoga maritima} SCOP: b.30.5.11 c.1.8.13
Probab=37.84  E-value=19  Score=15.36  Aligned_cols=52  Identities=21%  Similarity=0.159  Sum_probs=28.7

Q ss_pred             HHHHHHHHHHHHHCCC-CC-CCHHH----HHC------CCCCHHHHHHHHHHCCCCEEEEEECCHH
Q ss_conf             5999999998652247-84-30011----210------4542478999998709965899631711
Q gi|254780200|r   95 TRDQATNLAKRLESIS-SI-VVDWA----MRY------GKPSVKEIINNLREEGCDRLLIFPLYPQ  148 (343)
Q Consensus        95 t~~qa~~L~~~L~~~~-~~-~V~~a----mry------~~P~i~~~l~~l~~~g~~~ii~lPLyPq  148 (343)
                      |++....+.+++++.+ ++ .+..+    ...      --|..++.++++++.|..  +++-+-|.
T Consensus       210 te~~vl~~~~~~~~ip~d~~~iD~~w~~~~gd~~~d~~~fP~~~~~~~~lh~~G~k--~g~~~~P~  273 (564)
T 1zy9_A          210 TWEETLKNLKLAKNFPFEVFQIDDAYEKDIGDWLVTRGDFPSVEEMAKVIAENGFI--PGIWTAPF  273 (564)
T ss_dssp             CHHHHHHHHHHGGGTTCSEEEECTTSEEETTEEEEECTTCCCHHHHHHHHHHTTCE--EEEEECTT
T ss_pred             CHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCEECCCCCCCHHHHHHHHHHCCCE--EEEEECCC
T ss_conf             99999999999982899799986761127998137876578999999999866984--89995555


No 35 
>2fyw_A Conserved hypothetical protein; structural genomics, PSI, midwest center for structural genomics, MCSG; 2.40A {Streptococcus pneumoniae TIGR4} SCOP: c.135.1.1
Probab=36.84  E-value=19  Score=15.26  Aligned_cols=38  Identities=3%  Similarity=-0.098  Sum_probs=26.7

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHH
Q ss_conf             5899999997599758981689879899999999999984
Q gi|254780200|r  300 AHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEKITRREL  339 (343)
Q Consensus       300 die~~e~~~e~Gg~~~~rvp~lN~~~~fi~~La~lv~~~l  339 (343)
                      .......|.+.|. ++.-+.= +++..|+..+++++.+++
T Consensus       208 k~h~~~~A~~~gi-~vi~~GH-~tE~~~~~~l~~~L~~~l  245 (267)
T 2fyw_A          208 YYHTAQDMLSDGL-LALDPGH-YIEVIFVEKIAALLSQWK  245 (267)
T ss_dssp             CHHHHHHHHHTTC-EEEECCG-GGGGHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHCCC-EEEECCC-CHHHHHHHHHHHHHHHHH
T ss_conf             6699999987799-8998885-050899999999999999


No 36 
>3ipw_A Hydrolase TATD family protein; niaid, ssgcid, seattle structural genomics center for infectious disease, dysentery, liver abcess; 1.95A {Entamoeba histolytica hm-1}
Probab=36.44  E-value=20  Score=15.21  Aligned_cols=24  Identities=13%  Similarity=0.422  Sum_probs=19.4

Q ss_pred             CCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             045424789999987099658996
Q gi|254780200|r  120 YGKPSVKEIINNLREEGCDRLLIF  143 (343)
Q Consensus       120 y~~P~i~~~l~~l~~~g~~~ii~l  143 (343)
                      |-.+-++++|+..++.|++++++.
T Consensus        49 ~h~~Dl~~Vl~rA~~~gV~~ii~~   72 (325)
T 3ipw_A           49 YHEEDIDVVLQRAERNGLSHIIIT   72 (325)
T ss_dssp             CSCCCHHHHHHHHHHTTEEEEEEC
T ss_pred             CCCCCHHHHHHHHHHCCCCEEEEE
T ss_conf             770269999999998699989992


No 37 
>3ff4_A Uncharacterized protein; structural genomics, PSI- 2, protein structure initiative, midwest center for structural genomics; 2.10A {Cytophaga hutchinsonii atcc 33406}
Probab=35.03  E-value=20  Score=15.06  Aligned_cols=37  Identities=22%  Similarity=0.235  Sum_probs=17.8

Q ss_pred             HHHHHHHHHHHCCCCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHCCC
Q ss_conf             268999989976998399974405422125588875899999997599
Q gi|254780200|r  265 PTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGG  312 (343)
Q Consensus       265 ~t~~~l~~L~~~G~k~v~v~p~gFvsD~lETl~Eidie~~e~~~e~Gg  312 (343)
                      .+.+.++++.+.|+|.| ++-+|-.+          -+..+.++++|+
T Consensus        70 ~~~~~v~e~~~~g~k~v-w~q~G~~~----------e~~~~~a~~~Gi  106 (122)
T 3ff4_A           70 NQLSEYNYILSLKPKRV-IFNPGTEN----------EELEEILSENGI  106 (122)
T ss_dssp             HHGGGHHHHHHHCCSEE-EECTTCCC----------HHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHCCCCEE-EEECCCCC----------HHHHHHHHHCCC
T ss_conf             98999999985399999-99369879----------999999999699


No 38 
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8
Probab=34.77  E-value=21  Score=15.04  Aligned_cols=45  Identities=13%  Similarity=0.224  Sum_probs=20.6

Q ss_pred             HHHHHHHHHHHCCCCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             268999989976998399974405422125588875899999997599758981689
Q gi|254780200|r  265 PTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCL  321 (343)
Q Consensus       265 ~t~~~l~~L~~~G~k~v~v~p~gFvsD~lETl~Eidie~~e~~~e~Gg~~~~rvp~l  321 (343)
                      .+.+.++++.+.|+|.+.+.+-++           +-|..+.++++|. ++.--.|+
T Consensus        81 ~~~~il~e~~~~g~k~v~~q~G~~-----------~~e~~~~a~~~Gi-~vigpnC~  125 (138)
T 1y81_A           81 VGLQVAKEAVEAGFKKLWFQPGAE-----------SEEIRRFLEKAGV-EYSFGRCI  125 (138)
T ss_dssp             HHHHHHHHHHHTTCCEEEECTTSC-----------CHHHHHHHHHHTC-EEECSCCH
T ss_pred             HHHHHHHHHHHCCCCEEEEECCHH-----------HHHHHHHHHHCCC-EEECCCCC
T ss_conf             879999999756999789607644-----------1999999998499-89907905


No 39 
>3irs_A Uncharacterized protein BB4693; structural genomics, PSI-2, protein structure initiative, TIM-barrel protein; HET: GOL; 1.76A {Bordetella bronchiseptica} PDB: 3k4w_A
Probab=34.76  E-value=21  Score=15.03  Aligned_cols=18  Identities=6%  Similarity=-0.045  Sum_probs=8.7

Q ss_pred             HHHHHHHHCCCCEEEEEE
Q ss_conf             899999870996589963
Q gi|254780200|r  127 EIINNLREEGCDRLLIFP  144 (343)
Q Consensus       127 ~~l~~l~~~g~~~ii~lP  144 (343)
                      +-+.++.+..-++++.+.
T Consensus        80 ~~~~~~~~~~pdR~~~~a   97 (291)
T 3irs_A           80 ADVAAVAKAYPDKFHPVG   97 (291)
T ss_dssp             HHHHHHHHHSTTTEEEEE
T ss_pred             HHHHHHHHHCCCEEEEEC
T ss_conf             999999997899199802


No 40 
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside hydrolase family 5, michaelis complex, SKEW-BOAT, distortio; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A
Probab=32.78  E-value=22  Score=14.82  Aligned_cols=25  Identities=20%  Similarity=0.300  Sum_probs=13.7

Q ss_pred             CCHHHHHHHHHHC-CCCEEEEEECCHH
Q ss_conf             4247899999870-9965899631711
Q gi|254780200|r  123 PSVKEIINNLREE-GCDRLLIFPLYPQ  148 (343)
Q Consensus       123 P~i~~~l~~l~~~-g~~~ii~lPLyPq  148 (343)
                      ...++.++.|+++ |+.-|-+ |++|+
T Consensus        43 ~~~~~~~~~l~~~~G~N~VRl-~~~~~   68 (303)
T 7a3h_A           43 FVNYESMKWLRDDWGINVFRA-AMYTS   68 (303)
T ss_dssp             GCSHHHHHHHHHHTCCCEEEE-EEESS
T ss_pred             CCCHHHHHHHHHHCCCCEEEE-EEECC
T ss_conf             689999999998649978999-60648


No 41 
>1zcl_A Protein tyrosine phosphatase 4A1; PRL-1 PTP4A dual specific phosphatase, hydrolase; 2.90A {Rattus norvegicus} PDB: 1x24_A
Probab=31.88  E-value=17  Score=15.64  Aligned_cols=90  Identities=9%  Similarity=0.048  Sum_probs=45.3

Q ss_pred             HHHHHC------CCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCCCHHH
Q ss_conf             011210------454247899999870996589963171110014689999999999871799-8642133455780068
Q gi|254780200|r  115 DWAMRY------GKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWS-PSLRTVPPYYEDSDYI  187 (343)
Q Consensus       115 ~~amry------~~P~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l~~~~~~-~~~~~I~~~~~~p~yI  187 (343)
                      +..||+      ..-.+++-++.|++.|+..||-+. -+.|-.           +.+.+.+.. ..+.+.+..--...-+
T Consensus        34 ~~~~rfi~t~~P~~~ti~~f~~~lk~~gv~~IV~l~-e~~y~~-----------~~~~~~gI~~~~~p~~D~~~P~~~~i  101 (180)
T 1zcl_A           34 YKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVC-EATYDT-----------TLVEKEGIHVLDWPFDDGAPPSNQIV  101 (180)
T ss_dssp             BTTBCEEEEECCCSSSHHHHHHHHHTTTEEEEEECS-CCCSCS-----------HHHHTTTCEEEECCCCTTSCCCSHHH
T ss_pred             ECCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEECC-CCCCCH-----------HHHHHCCCEEEEEECCCCCCCCHHHH
T ss_conf             237248885598945499999999987990999899-997886-----------99997598899951699999799999


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEECCCCH
Q ss_conf             999999999997338998669998336750
Q gi|254780200|r  188 SALAQSIREHFESIQWTPEMLLVSFHQMPV  217 (343)
Q Consensus       188 ~a~~~~I~~~l~~~~~~~~~llfSaHglP~  217 (343)
                      +.+.+.+++.+++..+ ...+|-..+|+--
T Consensus       102 ~~~~~~v~~~~~~~~~-~~V~VHC~aG~gR  130 (180)
T 1zcl_A          102 DDWLSLVKIKFREEPG-CCIAVHSVAGLGR  130 (180)
T ss_dssp             HHHHHHHHHHHHHSTT-CEEEEEESSSSSH
T ss_pred             HHHHHHHHHHHHHCCC-CCEEEEECCCCCH
T ss_conf             9999999999984899-9489884999775


No 42 
>3guw_A Uncharacterized protein AF_1765; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 3.20A {Archaeoglobus fulgidus dsm 4304}
Probab=31.28  E-value=23  Score=14.66  Aligned_cols=70  Identities=14%  Similarity=0.157  Sum_probs=28.8

Q ss_pred             HHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHH----CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             9999870996589963171110014689999999999871----79986421334557800689999999999973
Q gi|254780200|r  129 INNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHM----RWSPSLRTVPPYYEDSDYISALAQSIREHFES  200 (343)
Q Consensus       129 l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l~~~----~~~~~~~~I~~~~~~p~yI~a~~~~I~~~l~~  200 (343)
                      ++++++.|+++++.....|..+.. ..+..+.+. .+..+    .....++.-....-||..++...+.+.+.++.
T Consensus        17 l~~~~~~Gv~~ii~~~~~~~~~~~-~~~~~d~~~-~~~~~~~~~~~~~~~~~~~~~GiHP~~~~~~~~~l~~~l~~   90 (261)
T 3guw_A           17 LVKLKENGIKEVCSLAFFPVKPKY-PQTMIDVFR-KLTEFEPLRCEAAGVKMHPAVGIHPRCIPPDYEFVLGYLEE   90 (261)
T ss_dssp             HHHHHTTSCCEECCBCCCSSCCSS-HHHHHHHHH-HHHHTHHHHHHTTTCEECCBCCCCGGGCCTTTHHHHHHHTT
T ss_pred             HHHHHHCCCCEEEEECCCCCCCCC-HHHHHHHHH-HHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHCC
T ss_conf             999998599889992788000222-689999999-98888888887448867999988826485569999998525


No 43 
>2hzm_A RNA polymerase II mediator complex subunit 20; beta barrel, channel, transcription; 2.40A {Saccharomyces cerevisiae} PDB: 2hzs_A
Probab=30.97  E-value=16  Score=15.73  Aligned_cols=19  Identities=32%  Similarity=0.489  Sum_probs=16.7

Q ss_pred             CCCCEEEEEECCCCCCCCC
Q ss_conf             7786799997178889999
Q gi|254780200|r   15 KFGKIGVLLVNLGTPDGHD   33 (343)
Q Consensus        15 ~~~K~gvLL~n~G~P~~~~   33 (343)
                      .|+|+|||+++--||++.+
T Consensus         2 ~m~~sAVifvekATP~TIT   20 (212)
T 2hzm_A            2 SMGKSAVIFVERATPATLT   20 (212)
T ss_dssp             --CCEEEEEECSCCTTHHH
T ss_pred             CCCCEEEEEEECCCCCHHH
T ss_conf             8652389998047832589


No 44 
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1
Probab=30.96  E-value=24  Score=14.62  Aligned_cols=22  Identities=9%  Similarity=0.261  Sum_probs=14.1

Q ss_pred             CCHHHHHHHHHHCCCCEEEEEE
Q ss_conf             4247899999870996589963
Q gi|254780200|r  123 PSVKEIINNLREEGCDRLLIFP  144 (343)
Q Consensus       123 P~i~~~l~~l~~~g~~~ii~lP  144 (343)
                      +.+.++++++.+.|+.-++++.
T Consensus        75 ~~v~~~~~e~~~~Gvk~~vi~s   96 (288)
T 1oi7_A           75 PAAADAALEAAHAGIPLIVLIT   96 (288)
T ss_dssp             HHHHHHHHHHHHTTCSEEEECC
T ss_pred             HHHHHHHHHHHHCCCCEEEEEC
T ss_conf             9999999999867998899955


No 45 
>2wkb_A Macrophage migration inhibitory factor; cytokine; HET: CME; 1.78A {Plasmodium berghei} PDB: 3gad_A 3gac_A 2wkf_A*
Probab=29.93  E-value=25  Score=14.50  Aligned_cols=30  Identities=23%  Similarity=0.253  Sum_probs=23.5

Q ss_pred             CHHHHHHHHHHHHHHHCCCCCCCEEEEECC
Q ss_conf             888999999999997266756704786225
Q gi|254780200|r  226 YGCHCHKTARLLKEFLSWPDDRFKICFQSR  255 (343)
Q Consensus       226 Y~~q~~~t~~~i~~~l~~~~~~~~l~fQSr  255 (343)
                      ....+.+-++.+.+.||++.++..+.|+.-
T Consensus        73 n~~~s~~i~~~l~~~LgI~~~RiyI~f~~~  102 (125)
T 2wkb_A           73 NSLLADKITKILSNHLSVKPRRVYIEFRDC  102 (125)
T ss_dssp             HHHHHHHHHHHHHHHHCCCGGGEEEEEEC-
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCEEEEEEEC
T ss_conf             899999999999997198902289999978


No 46 
>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C*
Probab=29.53  E-value=25  Score=14.46  Aligned_cols=77  Identities=10%  Similarity=0.091  Sum_probs=47.3

Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHCCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             04577759999999986522478430011210454247899999870996589963171110014689999999999871
Q gi|254780200|r   89 SILRTHTRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHM  168 (343)
Q Consensus        89 SPL~~~t~~qa~~L~~~L~~~~~~~V~~amry~~P~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l~~~  168 (343)
                      +|.-.+.-+.+-.|+++.+  +++.| .++..|+|..+++|++..+-|+|+.+++. -+.++.+-+-.+-.-+.+++++.
T Consensus        36 Np~D~~AlE~Al~lkE~~g--~~~~V-t~ls~Gp~~a~~~Lr~alAmGaD~av~v~-d~~~~~~d~~atA~~LA~~i~~~  111 (264)
T 1o97_C           36 NEWDDFSLEEAMKIKESSD--TDVEV-VVVSVGPDRVDESLRKCLAKGADRAVRVW-DDAAEGSDAIVVGRILTEVIKKE  111 (264)
T ss_dssp             CHHHHHHHHHHHHHHHHCS--SCCEE-EEEEESCGGGHHHHHHHHHTTCSEEEEEC-CGGGTTCCHHHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHCCC--CCEEE-EEEEECCHHHHHHHHHHHHHCCCEEEEEE-CCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             9767999999999984479--95699-99981508889999999972797269996-05777878999999999999743


Q ss_pred             C
Q ss_conf             7
Q gi|254780200|r  169 R  169 (343)
Q Consensus       169 ~  169 (343)
                      .
T Consensus       112 ~  112 (264)
T 1o97_C          112 A  112 (264)
T ss_dssp             C
T ss_pred             C
T ss_conf             9


No 47 
>3gi1_A LBP, laminin-binding protein of group A streptococci; zinc-binding receptor, metal-binding, helical backbone, alpha/beta domains; 2.45A {Streptococcus pyogenes} PDB: 3hjt_A
Probab=29.39  E-value=25  Score=14.44  Aligned_cols=207  Identities=12%  Similarity=0.142  Sum_probs=105.3

Q ss_pred             HHHHHHHHHHHHHCCCCCCCHHHHHCCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             59999999986522478430011210454247899999870996589963171110014689999999999871799864
Q gi|254780200|r   95 TRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSL  174 (343)
Q Consensus        95 t~~qa~~L~~~L~~~~~~~V~~amry~~P~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l~~~~~~~~~  174 (343)
                      |-.+..+|++     .++.|..|+-+ +|++++.++.+...++.  ++-..-+.......+  .+.....   .+....-
T Consensus        51 ~p~d~~~l~~-----Adliv~~G~~l-E~~l~~~~~~~~~~~~~--v~~~~~~~~~~~~~~--~~~~~~~---~~~~~~~  117 (286)
T 3gi1_A           51 SVNDVAAIYD-----ADLFVYHSHTL-EAWARDLDPNLKKSKVD--VFEASKPLTLDRVKG--LEDMEVT---QGIDPAT  117 (286)
T ss_dssp             CHHHHHHHHT-----SSEEEESCTTT-SGGGTTCCTTTTTCCCE--EEETTTTSCCCBCC--------------------
T ss_pred             CHHHHHHHHC-----CCEEEEECCCC-HHHHHHHHHHCCCCCCC--EEECCCCCCCCCCCC--CCCCCCC---CCCCCCC
T ss_conf             9999999966-----99999928851-57899999864456764--242256512210267--6522234---6777778


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEC
Q ss_conf             21334557800689999999999973389986699983367502676279988899999999999726675670478622
Q gi|254780200|r  175 RTVPPYYEDSDYISALAQSIREHFESIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKICFQS  254 (343)
Q Consensus       175 ~~I~~~~~~p~yI~a~~~~I~~~l~~~~~~~~~llfSaHglP~~~~~~gDpY~~q~~~t~~~i~~~l~~~~~~~~l~fQS  254 (343)
                      ..-+++|-+|.....+++.|.+.|.+.+-..          -..+-++.+-|..++.+..+.+.+.+.--.++..++|..
T Consensus       118 ~~dPH~Wldp~~~~~~a~~I~~~L~~~dP~~----------~~~y~~N~~~~~~~l~~l~~~~~~~~~~~~~~~~v~~H~  187 (286)
T 3gi1_A          118 LYDPHTWTDPVLAGEEAVNIAKELGRLDPKH----------KDSYTKNAKAFKKEAEQLTEEYTQKFKKVRSKTFVTQHT  187 (286)
T ss_dssp             CBCCCGGGSHHHHHHHHHHHHHHHHHHCGGG----------HHHHHHHHHHHHHHHHHHHHHHHHHHTTCSCCEEEEEES
T ss_pred             CCCCCEECCHHHHHHHHHHHHHHHHHHCHHH----------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             9998741789999999999999998769687----------899999999999999999999999754313352588676


Q ss_pred             C-------CC----CCCCCCHH------HHHHHHH-HHHCCCCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             5-------77----76544302------6899998-99769983999744054221255888758999999975997589
Q gi|254780200|r  255 R-------FG----RIKCLEPP------TDKTVEK-LAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFT  316 (343)
Q Consensus       255 r-------~G----p~~WL~P~------t~~~l~~-L~~~G~k~v~v~p~gFvsD~lETl~Eidie~~e~~~e~Gg~~~~  316 (343)
                      .       +|    ....+.|.      -...+.+ +.+.+++ ++++-+.|-..-.++          ++.+.|. ...
T Consensus       188 a~~Y~~~~~gl~~~~~~~~~~~~eps~~~l~~l~~~ik~~~i~-~if~e~~~~~~~~~~----------la~~~g~-~v~  255 (286)
T 3gi1_A          188 AFSYLAKRFGLKQLGISGISPEQEPSPRQLKEIQDFVKEYNVK-TIFAEDNVNPKIAHA----------IAKSTGA-KVK  255 (286)
T ss_dssp             CCHHHHHHTTCEEEEEECSCC---CCHHHHHHHHHHHHHTTCC-EEEECTTSCTHHHHH----------HHHTTTC-EEE
T ss_pred             CHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCC-EEEEECCCCHHHHHH----------HHHHHCC-CEE
T ss_conf             4689999839851442124677789877899999999975998-999848889199999----------9998299-768


Q ss_pred             EECCCCC----CHHHHHHHHHHHH
Q ss_conf             8168987----9899999999999
Q gi|254780200|r  317 QVPCLNS----SNLSIDLLEKITR  336 (343)
Q Consensus       317 rvp~lN~----~~~fi~~La~lv~  336 (343)
                      .+..+..    .+.+++++..-+.
T Consensus       256 ~ld~l~~~~~~~~~Y~~~m~~n~~  279 (286)
T 3gi1_A          256 TLSPLEAAPSGNKTYLENLRANLE  279 (286)
T ss_dssp             ECCCSCSCCSSSCCHHHHHHHHHH
T ss_pred             EECCCCCCCCCCCCHHHHHHHHHH
T ss_conf             857776788886779999999999


No 48 
>3dnf_A ISPH, LYTB, 4-hydroxy-3-methylbut-2-ENYL diphosphate reductase; trilobal strucure, open alpha/beta, 3Fe-4S, iron, iron- sulfur; 1.65A {Aquifex aeolicus}
Probab=29.20  E-value=25  Score=14.42  Aligned_cols=18  Identities=28%  Similarity=0.466  Sum_probs=8.5

Q ss_pred             EEEECCCCCCCCCHHHHHHHHHH
Q ss_conf             99971788899998899999998
Q gi|254780200|r   21 VLLVNLGTPDGHDFFSLRRYLRE   43 (343)
Q Consensus        21 vLL~n~G~P~~~~~~~V~~yL~~   43 (343)
                      |++-+.|.|  |   +++..+++
T Consensus        69 ViirAHGv~--~---~v~~~~~~   86 (297)
T 3dnf_A           69 VIIRSHGIP--P---EKEEALRK   86 (297)
T ss_dssp             EEECTTCCC--H---HHHHHHHH
T ss_pred             EEEECCCCC--H---HHHHHHHH
T ss_conf             776026998--8---99999997


No 49 
>3kzq_A Putative uncharacterized protein VP2116; protein with unknown function, structural genomics, PSI, MCSG, protein structure initiative; HET: PG6; 2.10A {Vibrio parahaemolyticus}
Probab=29.00  E-value=12  Score=16.71  Aligned_cols=78  Identities=13%  Similarity=0.092  Sum_probs=45.9

Q ss_pred             HHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCHHHHHHH----HHHHHCCCCCEEEECCHHHHCCHHHHHHHHHHHHHHH
Q ss_conf             999999997266756704786225777654430268999----9899769983999744054221255888758999999
Q gi|254780200|r  232 KTARLLKEFLSWPDDRFKICFQSRFGRIKCLEPPTDKTV----EKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIF  307 (343)
Q Consensus       232 ~t~~~i~~~l~~~~~~~~l~fQSr~Gp~~WL~P~t~~~l----~~L~~~G~k~v~v~p~gFvsD~lETl~Eidie~~e~~  307 (343)
                      ++...+++.+|+..+.+.-+.+|         |.+.+.+    +...+.|+..    .|+|+.++               
T Consensus       126 ~~l~~ia~~~Gld~~~~~~~~~s---------~~~~~~l~~~~~~a~~~gv~G----vPtfvv~~---------------  177 (208)
T 3kzq_A          126 ATHLQLAKEIGLNVQQFKNDMDG---------TLLEGVFQDQLSLAKSLGVNS----YPSLVLQI---------------  177 (208)
T ss_dssp             HHHHHHHHHTTCCHHHHHHHHTS---------HHHHHHHHHHHHHHHHTTCCS----SSEEEEEE---------------
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHH---------HHHHHHHHHHHHHHHHCCCCC----CCEEEEEE---------------
T ss_conf             89988788739999999999861---------699999999999999859975----88799998---------------


Q ss_pred             HHCCCCEEEEECCCCCCHHHHHHHHHHHHHHHC
Q ss_conf             975997589816898798999999999999842
Q gi|254780200|r  308 VNGGGEKFTQVPCLNSSNLSIDLLEKITRRELM  340 (343)
Q Consensus       308 ~e~Gg~~~~rvp~lN~~~~fi~~La~lv~~~l~  340 (343)
                         |+..+...--..+.+.+++.|.+++.++|+
T Consensus       178 ---~~~~~~~~~g~~~~~~~~~~l~e~~~~~~~  207 (208)
T 3kzq_A          178 ---NDAYFPIEVDYLSTEPTLKLIRERIIENMS  207 (208)
T ss_dssp             ---TTEEEEECCCSSCSHHHHHHHHHHHHHTC-
T ss_pred             ---CCEEEEECCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             ---998888268876899999999999997268


No 50 
>3irv_A Cysteine hydrolase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.60A {Pseudomonas syringae PV}
Probab=28.93  E-value=8.3  Score=17.79  Aligned_cols=26  Identities=23%  Similarity=0.594  Sum_probs=15.1

Q ss_pred             CCCCCCCCCCCCCCCC----CCEEEEEECC
Q ss_conf             9888789988998777----8679999717
Q gi|254780200|r    1 MNISSFAPRNHPKVKF----GKIGVLLVNL   26 (343)
Q Consensus         1 ~~~~~~~~~~~p~~~~----~K~gvLL~n~   26 (343)
                      |...+..|.+.|.+..    .|+|+|++-+
T Consensus         1 ~~~~~~~p~~~p~~~~~~dp~~tALlvID~   30 (233)
T 3irv_A            1 MSLAEVNPMSKPLVRWPINPLRTAVIVVDM   30 (233)
T ss_dssp             --------CCSCCCCCCCCGGGEEEEEECC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEEEEECC
T ss_conf             996768888888788889999879999858


No 51 
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, merlin, actin binding, masking, regulation, SELF-inhibition cell adhesion; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A
Probab=28.17  E-value=26  Score=14.30  Aligned_cols=13  Identities=8%  Similarity=0.330  Sum_probs=5.7

Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             8887589999999
Q gi|254780200|r  296 SYEIAHEAKEIFV  308 (343)
Q Consensus       296 l~Eidie~~e~~~  308 (343)
                      ++.+.++....+.
T Consensus       280 l~~l~~~~h~~~~  292 (575)
T 2i1j_A          280 ILALCMGNHELYM  292 (575)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999788758888


No 52 
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides}
Probab=27.63  E-value=27  Score=14.24  Aligned_cols=19  Identities=16%  Similarity=0.008  Sum_probs=9.6

Q ss_pred             HHHHHHHHCCCCEEEEEEC
Q ss_conf             8999998709965899631
Q gi|254780200|r  127 EIINNLREEGCDRLLIFPL  145 (343)
Q Consensus       127 ~~l~~l~~~g~~~ii~lPL  145 (343)
                      +.++.|.+.|++=|++.|.
T Consensus        52 ~~i~~~i~~~vDgiIi~~~   70 (291)
T 3l49_A           52 SQIQTLIAQKPDAIIEQLG   70 (291)
T ss_dssp             HHHHHHHHHCCSEEEEESS
T ss_pred             HHHHHHHHCCCCEEEECCC
T ss_conf             9999999749999997786


No 53 
>2bln_A Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 1yrw_A
Probab=27.09  E-value=28  Score=14.17  Aligned_cols=21  Identities=10%  Similarity=0.118  Sum_probs=13.1

Q ss_pred             CCHHHHHHHHHHCCCCEEEEE
Q ss_conf             424789999987099658996
Q gi|254780200|r  123 PSVKEIINNLREEGCDRLLIF  143 (343)
Q Consensus       123 P~i~~~l~~l~~~g~~~ii~l  143 (343)
                      ..-++.++.+++.++|=++++
T Consensus        62 ~~~~~~~~~l~~~~~dl~i~~   82 (305)
T 2bln_A           62 VNHPLWVERIAQLSPDVIFSF   82 (305)
T ss_dssp             CCSHHHHHHHHHTCCSEEEEE
T ss_pred             CCCHHHHHHHHHCCCCEEEEE
T ss_conf             998999999983299999986


No 54 
>3jr7_A Uncharacterized EGV family protein COG1307; structural genomics, PSI2, MCSG, protein structure initiative; HET: PG6; 2.00A {Ruminococcus gnavus atcc 29149}
Probab=27.06  E-value=28  Score=14.17  Aligned_cols=117  Identities=10%  Similarity=0.048  Sum_probs=61.3

Q ss_pred             HCCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHH---HHHH--
Q ss_conf             10454247899999870996589963171110014689999999999871799864213345578006899---9999--
Q gi|254780200|r  119 RYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRTVPPYYEDSDYISA---LAQS--  193 (343)
Q Consensus       119 ry~~P~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l~~~~~~~~~~~I~~~~~~p~yI~a---~~~~--  193 (343)
                      .-+.|++++.++.+. .++++++.+++.-.-|.  |.++.....+.+.......++++|++..-.-+.--.   .++.  
T Consensus        79 ~TS~Ps~~~~~e~~~-~~~d~vi~i~iSs~lSg--ty~~a~~a~~~~~~e~~~~~I~ViDS~~~s~~~g~lv~~A~~l~~  155 (298)
T 3jr7_A           79 KTSCPSPERYMESYH-CDAERIYVVTLSAELSG--SYNSAVLGKNLYEEEYGEKQIHVFNSRSASVGETLIALKVQQCEK  155 (298)
T ss_dssp             EEECCCHHHHHHHHC-SSCSEEEEEESCTTTCS--HHHHHHHHHHHHHHHHCCCEEEEEECSSCTHHHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHH-HCCCCEEEEECCCCHHH--HHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHHH
T ss_conf             668989999999998-46895799965740202--799999999998876699839998488641768999999999998


Q ss_pred             -------HHHHHHHCCCCCCEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             -------9999973389986699983367502676279988899999999999726675
Q gi|254780200|r  194 -------IREHFESIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPD  245 (343)
Q Consensus       194 -------I~~~l~~~~~~~~~llfSaHglP~~~~~~gDpY~~q~~~t~~~i~~~l~~~~  245 (343)
                             |.+.+++.. +..++.|+.-.|  .++.+|=    .+-..+..+...|++.+
T Consensus       156 ~G~s~eeI~~~l~~~~-~~~~~~f~v~~L--~~L~kgG----RIs~~~~~ig~lL~ikP  207 (298)
T 3jr7_A          156 AGMTFEEVVESVECYI-EEQHTYFVLENL--DTLRKNG----RLTGIKSLVAGALNIKP  207 (298)
T ss_dssp             TTCCHHHHHHHHHHHH-HHCCEEEECSCC--HHHHHTT----CSTTCCC--CCCTTEEE
T ss_pred             CCCCHHHHHHHHHHHH-HHCEEEEEECCH--HHHHHCC----CCCHHHHHHHHHHCCEE
T ss_conf             5999999999999998-624799996987--9998779----86067999987537569


No 55 
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23
Probab=26.85  E-value=24  Score=14.60  Aligned_cols=17  Identities=12%  Similarity=0.485  Sum_probs=14.3

Q ss_pred             CEEEEEECCCCHHHHHH
Q ss_conf             66999833675026762
Q gi|254780200|r  206 EMLLVSFHQMPVSYLLK  222 (343)
Q Consensus       206 ~~llfSaHglP~~~~~~  222 (343)
                      -.+++|||||=.|.|++
T Consensus       228 rl~VISFHSLEDRiVK~  244 (285)
T 1wg8_A          228 RLVVIAFHSLEDRVVKR  244 (285)
T ss_dssp             EEEEEECSHHHHHHHHH
T ss_pred             EEEEEECCCHHHHHHHH
T ss_conf             79999717289999999


No 56 
>1xiy_A Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, oxidoreductase; 1.80A {Plasmodium falciparum} SCOP: c.47.1.10
Probab=26.02  E-value=29  Score=14.04  Aligned_cols=15  Identities=13%  Similarity=0.277  Sum_probs=7.3

Q ss_pred             HHHCCCCEEEEEECC
Q ss_conf             987099658996317
Q gi|254780200|r  132 LREEGCDRLLIFPLY  146 (343)
Q Consensus       132 l~~~g~~~ii~lPLy  146 (343)
                      +++.|+++|+++..=
T Consensus        75 ~k~~gvd~I~cisvN   89 (182)
T 1xiy_A           75 IKENNFDDIYCITNN   89 (182)
T ss_dssp             HTTSCCSEEEEEESS
T ss_pred             HHHCCCCEEEEEECC
T ss_conf             985698526899659


No 57 
>3hh8_A Metal ABC transporter substrate-binding lipoprotein; metal binding, cell membrane, copper, copper transport, ION transport; 1.87A {Streptococcus pyogenes serotype M1} PDB: 1psz_A
Probab=25.69  E-value=29  Score=14.00  Aligned_cols=199  Identities=7%  Similarity=0.023  Sum_probs=95.8

Q ss_pred             HHHHHHHHHHHHHCCCCCCCHHHHHCCCCCHHHHHHHHHHCCC----CEEEEEEC-CHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             5999999998652247843001121045424789999987099----65899631-711100146899999999998717
Q gi|254780200|r   95 TRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLREEGC----DRLLIFPL-YPQYSAATTGTAQDKVFQELIHMR  169 (343)
Q Consensus        95 t~~qa~~L~~~L~~~~~~~V~~amry~~P~i~~~l~~l~~~g~----~~ii~lPL-yPqyS~sTtgS~~~~~~~~l~~~~  169 (343)
                      +-.+.++|++     .++.|..|+-+ +|+++..+.++.....    ..++...- ..+...              .  .
T Consensus        57 ~p~di~~l~~-----Adlvv~~G~~l-E~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------------~--~  114 (294)
T 3hh8_A           57 LPEDAEKTSN-----ADVIFYNGINL-EDGGQAWFTKLVKNAQKTKNKDYFAVSDGIDVIYL--------------E--G  114 (294)
T ss_dssp             CHHHHHHHHH-----CSEEEECCTTS-SCSTTSHHHHHHHHTTCCBTTTEEETTTTSCCCBS--------------T--T
T ss_pred             CHHHHHHHHC-----CCEEEECCCCC-CHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCC--------------C--C
T ss_conf             9999999817-----99999838862-06689999998763101367755764045433445--------------6--5


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHC-CCC-CC
Q ss_conf             9986421334557800689999999999973389986699983367502676279988899999999999726-675-67
Q gi|254780200|r  170 WSPSLRTVPPYYEDSDYISALAQSIREHFESIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLS-WPD-DR  247 (343)
Q Consensus       170 ~~~~~~~I~~~~~~p~yI~a~~~~I~~~l~~~~~~~~~llfSaHglP~~~~~~gDpY~~q~~~t~~~i~~~l~-~~~-~~  247 (343)
                      ..-.-..-+++|-+|.....+++.|.+.|.+..-...          .-+-++..-|..++...-+.+.+.+. .+. .+
T Consensus       115 ~~~~~~~dpH~Wl~p~~~~~~a~~I~~~L~~~dP~~~----------~~y~~n~~~~~~~l~~l~~~~~~~l~~~~~~~~  184 (294)
T 3hh8_A          115 ASEKGKEDPHAWLNLENGIIYSKNIAKQLIAKDPKNK----------ETYEKNLKAYVAKLEKLDKEAKSKFDAIAENKK  184 (294)
T ss_dssp             CCSTTCBCCCGGGSHHHHHHHHHHHHHHHHHHCGGGH----------HHHHHHHHHHHHHHHHHHHHHHHTTTTSCGGGC
T ss_pred             CCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHCHHHH----------HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCE
T ss_conf             5556888634616467699999999999988693317----------999999999999999989999998752445550


Q ss_pred             CEEEEEC-----------------CCCCCCCCCHHHHHHHHHHHH-CCCCCEEEECCHHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             0478622-----------------577765443026899998997-6998399974405422125588875899999997
Q gi|254780200|r  248 FKICFQS-----------------RFGRIKCLEPPTDKTVEKLAH-DGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVN  309 (343)
Q Consensus       248 ~~l~fQS-----------------r~Gp~~WL~P~t~~~l~~L~~-~G~k~v~v~p~gFvsD~lETl~Eidie~~e~~~e  309 (343)
                      ..+++..                 ..+++...+|.....+.+..+ .|++-| ++-+.|-..-+|+|          +.+
T Consensus       185 ~~v~~h~a~~Yf~~~ygl~~~~~~~~~~~~e~s~~~l~~l~~~ik~~~v~~i-f~e~~~~~~~~~~l----------a~e  253 (294)
T 3hh8_A          185 LIVTSEGCFKYFSKAYGVPSAYIWEINTEEEGTPDQISSLIEKLKVIKPSAL-FVESSVDRRPMETV----------SKD  253 (294)
T ss_dssp             CEEEEESCCHHHHHHHTCCEEEEESSCCSCCCCHHHHHHHHHHHHHSCCSCE-EEETTSCSHHHHHH----------HHH
T ss_pred             EEEEECHHHHHHHHHCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCEE-EECCCCCHHHHHHH----------HHH
T ss_conf             3321060779999986981403446677554688999999999987399789-97698991999999----------998


Q ss_pred             CCCCEEE--EECCCCC----CHHHHHHHHHHHH
Q ss_conf             5997589--8168987----9899999999999
Q gi|254780200|r  310 GGGEKFT--QVPCLNS----SNLSIDLLEKITR  336 (343)
Q Consensus       310 ~Gg~~~~--rvp~lN~----~~~fi~~La~lv~  336 (343)
                      .|..-..  ....+..    .+.|+++|...+.
T Consensus       254 ~gv~i~~~l~~d~l~~~~~~~~~Y~~~m~~N~~  286 (294)
T 3hh8_A          254 SGIPIYSEIFTDSIAKKGKPGDSYYAMMKWNLD  286 (294)
T ss_dssp             HCCCEEEEECSSSCCCTTSTTCSHHHHHHHHHH
T ss_pred             HCCCEECCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             199764113655677889874679999999999


No 58 
>3e2v_A 3'-5'-exonuclease; structural genomics, hydrolase, PSI-2, protein structure initiative; 1.50A {Saccharomyces cerevisiae YJM789}
Probab=25.31  E-value=30  Score=13.96  Aligned_cols=24  Identities=8%  Similarity=0.213  Sum_probs=13.6

Q ss_pred             CCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             045424789999987099658996
Q gi|254780200|r  120 YGKPSVKEIINNLREEGCDRLLIF  143 (343)
Q Consensus       120 y~~P~i~~~l~~l~~~g~~~ii~l  143 (343)
                      +-.+-++++|+..++.||+++++.
T Consensus        35 ~hd~Dl~~Vl~rA~~~GV~~ii~~   58 (401)
T 3e2v_A           35 YHPADYVKLLERAAQRHVKNALVT   58 (401)
T ss_dssp             CSCCCHHHHHHHHHHTTEEEEEEC
T ss_pred             CCCCCHHHHHHHHHHCCCCEEEEE
T ss_conf             771379999999998799989991


No 59 
>2pa6_A Enolase; glycolysis, lyase, magnesium, metal-binding, structural genomics, NPPSFA; 1.85A {Methanocaldococcus jannaschii}
Probab=24.15  E-value=31  Score=13.81  Aligned_cols=185  Identities=12%  Similarity=0.146  Sum_probs=92.5

Q ss_pred             CCCEEEEEEC-CHHHHHH--HHHHHHHHHHHHHHHH-CCC-----CCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             9965899631-7111001--4689999999999871-799-----86421334557800689999999999973389986
Q gi|254780200|r  136 GCDRLLIFPL-YPQYSAA--TTGTAQDKVFQELIHM-RWS-----PSLRTVPPYYEDSDYISALAQSIREHFESIQWTPE  206 (343)
Q Consensus       136 g~~~ii~lPL-yPqyS~s--TtgS~~~~~~~~l~~~-~~~-----~~~~~I~~~~~~p~yI~a~~~~I~~~l~~~~~~~~  206 (343)
                      .+++.+++|. ++-|+.+  ....++..+.+.+.+. +..     .+=-|.+++-+.+.-++.+.+.|..+    ....+
T Consensus       167 diQEfmIiP~ga~sf~eal~~~~eV~~~lk~~l~~k~g~~~~~vgDEGGfap~~~~~eeaL~li~~Ai~~a----G~~~d  242 (427)
T 2pa6_A          167 DLQEFMIMPVGATSISEAVRMGSEVYHVLKNVILEKYGKNAVNVGDEGGFAPPLKTSREALDLLTESVKKA----GYEDE  242 (427)
T ss_dssp             SSSEEEEECTTCSSHHHHHHHHHHHHHHHHHHHHHHHCTTSCCBCTTSCBCCSCCSHHHHHHHHHHHHHHH----TCTTT
T ss_pred             CHHHEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHC----CCCCC
T ss_conf             62232663688898999999999999999877553037777751788676899999799999999999972----87643


Q ss_pred             -E--EEEEECCCCH--HHHHHCC-CCHHHHHHHHHHHHHHH-------CCCCCCCE--EEEECCCCCCCC----CCHHHH
Q ss_conf             -6--9998336750--2676279-98889999999999972-------66756704--786225777654----430268
Q gi|254780200|r  207 -M--LLVSFHQMPV--SYLLKGD-PYGCHCHKTARLLKEFL-------SWPDDRFK--ICFQSRFGRIKC----LEPPTD  267 (343)
Q Consensus       207 -~--llfSaHglP~--~~~~~gD-pY~~q~~~t~~~i~~~l-------~~~~~~~~--l~fQSr~Gp~~W----L~P~t~  267 (343)
                       .  |=..|+.+=.  +|.-+|. --..|..+....+.++.       ++.+++|.  ..+.++++ ..-    |--.-.
T Consensus       243 v~i~lD~AAsefy~~g~Y~~~~~~~~~~e~i~~y~~li~~yPI~sIEDp~~e~D~~gw~~lt~~l~-~~ivGDDl~~Tn~  321 (427)
T 2pa6_A          243 VVFALDAAASEFYKDGYYYVEGKKLTREELLDYYKALVDEYPIVSIEDPFHEEDFEGFAMITKELD-IQIVGDDLFVTNV  321 (427)
T ss_dssp             CEEEEECCGGGGEETTEEEETTEEECHHHHHHHHHHHHHHSCEEEEECCSCTTCHHHHHHHHHHSS-SEEEESTTTTTCH
T ss_pred             EEEEEEHHHHHCCCCCEEECCCCCCCHHHHHHHHHHHHHHCCEEEEECCCCHHHHHHHHHHHHHCC-EEEECHHHHCCCH
T ss_conf             243210555523238806614775588999999999998699889968987565999999998639-3897705405768


Q ss_pred             HHHHHHHHCCCCCEEEECC---HHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             9999899769983999744---05422125588875899999997599758981689879899999999
Q gi|254780200|r  268 KTVEKLAHDGIKSLAIITP---GFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEK  333 (343)
Q Consensus       268 ~~l~~L~~~G~k~v~v~p~---gFvsD~lETl~Eidie~~e~~~e~Gg~~~~rvp~lN~~~~fi~~La~  333 (343)
                      +.|++-.+++.-+-+++=|   |-++|-+|+        -+++.++|.....--.+=-+.+.||.-||=
T Consensus       322 ~rl~~gi~~~~~nailiK~NQiGTvtet~ea--------~~la~~~g~~~ivShRSGETeD~~iaDLAV  382 (427)
T 2pa6_A          322 ERLRKGIEMKAANALLLKVNQIGTLSEAVDA--------AQLAFRNGYGVVVSHRSGETEDTTIADLSV  382 (427)
T ss_dssp             HHHHHHHHHTCCSEEEECHHHHCSHHHHHHH--------HHHHHTTTCEEEEECCSSCCSCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCEEECCCCCCCHHHHHHH--------HHHHHHCCCEEEEECCCCCCCCHHHHHHHH
T ss_conf             9999876516775305325442009999999--------999998799899957888866205999998


No 60 
>2hbv_A 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase; ACMSD, TIM-barrel, metaloenzyme, lyase; 1.65A {Pseudomonas fluorescens} SCOP: c.1.9.15 PDB: 2hbx_A
Probab=23.83  E-value=31  Score=13.77  Aligned_cols=76  Identities=5%  Similarity=-0.048  Sum_probs=39.6

Q ss_pred             CHHHHHHHHHHCCCCEEEEEECCHHHHHHH----HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             247899999870996589963171110014----6899999999998717998642133455780068999999999997
Q gi|254780200|r  124 SVKEIINNLREEGCDRLLIFPLYPQYSAAT----TGTAQDKVFQELIHMRWSPSLRTVPPYYEDSDYISALAQSIREHFE  199 (343)
Q Consensus       124 ~i~~~l~~l~~~g~~~ii~lPLyPqyS~sT----tgS~~~~~~~~l~~~~~~~~~~~I~~~~~~p~yI~a~~~~I~~~l~  199 (343)
                      .+++-++.|.+.|+++.|++|..+.+....    +....+.+.+.+.+....-.-+++.--.-++...+.-.+.++...+
T Consensus        59 ~~~~~l~~Md~~gId~avl~~~~~~~~~~~~~~~~~~~~~~~N~~~~~~~~~~p~R~~~~~~v~~~~~~~a~~el~r~~~  138 (334)
T 2hbv_A           59 DPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVA  138 (334)
T ss_dssp             CHHHHHHHHHHHTCSEEEEEECGGGCCTTSCHHHHHHHHHHHHHHHHHHHTTCTTTEEECBCCCTTSHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             99999999998699689990674020366788999999999999999999878994776676796478999999998655


No 61 
>2odf_A AGR_C_3887P, hypothetical protein ATU2144; structural genomics, unknown function, PSI-2, MCSG, protein structure initiative; 1.90A {Agrobacterium tumefaciens str} SCOP: c.56.5.9
Probab=23.60  E-value=32  Score=13.74  Aligned_cols=37  Identities=14%  Similarity=0.290  Sum_probs=26.3

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHH
Q ss_conf             334557800689999999999973389986699983367502
Q gi|254780200|r  177 VPPYYEDSDYISALAQSIREHFESIQWTPEMLLVSFHQMPVS  218 (343)
Q Consensus       177 I~~~~~~p~yI~a~~~~I~~~l~~~~~~~~~llfSaHglP~~  218 (343)
                      |..||.  -|=+++.+.|++..+...   ..+|++.||.|-.
T Consensus       123 i~~yy~--PYH~al~~~l~~~~~~~g---~~llid~HSf~p~  159 (257)
T 2odf_A          123 TSALYV--PFHDRVSEIIAERQAAGR---KVVVVTIHSFTPV  159 (257)
T ss_dssp             HHHTHH--HHHHHHHHHHHHHHHTTC---CCEEEEEEEECSE
T ss_pred             HHHHHH--HHHHHHHHHHHHHHHHCC---CEEEEEECCCCCC
T ss_conf             999999--999999999999998569---7799995778852


No 62 
>3c8f_A Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A*
Probab=23.24  E-value=32  Score=13.69  Aligned_cols=148  Identities=11%  Similarity=0.120  Sum_probs=60.2

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHCCCCCHHHHHHHHHHCCCCEEEEEECCH---HHHHHHHHHHHHHHH
Q ss_conf             87404577759999999986522478430011210454247899999870996589963171---110014689999999
Q gi|254780200|r   86 KNESILRTHTRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYP---QYSAATTGTAQDKVF  162 (343)
Q Consensus        86 gg~SPL~~~t~~qa~~L~~~L~~~~~~~V~~amry~~P~i~~~l~~l~~~g~~~ii~lPLyP---qyS~sTtgS~~~~~~  162 (343)
                      .||=|+...-  ....+.+.+.+. ++.+.+-....-+..++.++++. .+++.+ .+.+.-   ..-..-+|+..+.+.
T Consensus        76 sGGEP~l~~~--~l~~l~~~~k~~-g~~~~l~TnG~~~~~~~~~~~l~-~~~d~v-~id~~~~~~~~~~~~~g~~~~~vl  150 (245)
T 3c8f_A           76 SGGEAILQAE--FVRDWFRACKKE-GIHTCLDTNGFVRRYDPVIDELL-EVTDLV-MLDLKQMNDEIHQNLVGVSNHRTL  150 (245)
T ss_dssp             EESCGGGGHH--HHHHHHHHHHTT-TCCEEEEECCCCCCCCHHHHHHH-HTCSEE-EEECCCSSHHHHHHHHSSCSHHHH
T ss_pred             CCCCCCCCHH--HHHHHHHHHHHH-CCCEEEECCCCCCCCHHHHHHHH-CCCCEE-EEECCCCCHHHHHHHHCCCCHHHH
T ss_conf             5556534699--999999988864-38479977886555345666652-357579-984354678899987386508999


Q ss_pred             HHH---HHHCCCC--CCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHH-HHHCCC---------CH
Q ss_conf             999---8717998--64213345578006899999999999733899866999833675026-762799---------88
Q gi|254780200|r  163 QEL---IHMRWSP--SLRTVPPYYEDSDYISALAQSIREHFESIQWTPEMLLVSFHQMPVSY-LLKGDP---------YG  227 (343)
Q Consensus       163 ~~l---~~~~~~~--~~~~I~~~~~~p~yI~a~~~~I~~~l~~~~~~~~~llfSaHglP~~~-~~~gDp---------Y~  227 (343)
                      +.+   .+.+...  ++.+++.+.+++..+..+++.+++. ..   ....-+.-||.+.... ..-+.+         ..
T Consensus       151 ~~l~~l~~~g~~v~i~~~~i~g~~d~~e~i~~i~~~i~~l-~~---~~~v~l~py~~~g~~k~~~~~~~y~~~~~~~p~~  226 (245)
T 3c8f_A          151 EFAKYLANKNVKVWIRYVVVPGWSDDDDSAHRLGEFTRDM-GN---VEKIELLPYHELGKHKWVAMGEEYKLDGVKPPKK  226 (245)
T ss_dssp             HHHHHHHHHTCCEEEEEEECTTTTCCHHHHHHHHHHHHHH-CC---EEEEEEEECCCCSHHHHHHTTCCCTTTTCCCCCH
T ss_pred             HHHHHHHHCCCCEEEEEEEECCCCCCHHHHHHHHHHHHHC-CC---CCEEEEECCCCCCCCHHHHCCCCCCCCCCCCCCH
T ss_conf             9999999789989999999899489999999999999857-99---7558884476166411665185454457899999


Q ss_pred             HHHHHHHHHHHHHHCC
Q ss_conf             8999999999997266
Q gi|254780200|r  228 CHCHKTARLLKEFLSW  243 (343)
Q Consensus       228 ~q~~~t~~~i~~~l~~  243 (343)
                      .+..+ ++.+++..|+
T Consensus       227 e~l~~-~~~~~~~~G~  241 (245)
T 3c8f_A          227 ETMER-VKGILEQYGH  241 (245)
T ss_dssp             HHHHH-HHHHHHTTTC
T ss_pred             HHHHH-HHHHHHHCCC
T ss_conf             99999-9999998599


No 63 
>2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A
Probab=22.49  E-value=32  Score=13.71  Aligned_cols=53  Identities=8%  Similarity=0.033  Sum_probs=28.2

Q ss_pred             HHHHHHHHHHHHHCCCCCCCHHHHHCCCCCHHHHHHHHHHCCCCEEEEEECCH
Q ss_conf             59999999986522478430011210454247899999870996589963171
Q gi|254780200|r   95 TRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYP  147 (343)
Q Consensus        95 t~~qa~~L~~~L~~~~~~~V~~amry~~P~i~~~l~~l~~~g~~~ii~lPLyP  147 (343)
                      .......+...+.+.+-.....-..+......+.+..+...+++-+++++..+
T Consensus        75 ~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~vdgiii~~~~~  127 (332)
T 2hsg_A           75 YAELARGIEDIATMYKYNIILSNSDQNQDKELHLLNNMLGKQVDGIIFMSGNV  127 (332)
T ss_dssp             HHHHHHHHHHHHHHHTCEEEEEECCSHHHHHHHHHHHTSCCSSCCEEECCSSC
T ss_pred             HHHHHHHHHHHHHHHHHHEEECCCCCCHHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             14678899999876312212001343137899999999864841999346779


No 64 
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A*
Probab=22.46  E-value=33  Score=13.59  Aligned_cols=26  Identities=12%  Similarity=0.269  Sum_probs=13.5

Q ss_pred             CCCCHHHHHHHHHHCCCCEEEEEECCH
Q ss_conf             454247899999870996589963171
Q gi|254780200|r  121 GKPSVKEIINNLREEGCDRLLIFPLYP  147 (343)
Q Consensus       121 ~~P~i~~~l~~l~~~g~~~ii~lPLyP  147 (343)
                      |.|...+.++.|++.|+.-|-+ |+.+
T Consensus        30 ~~~~~~~~~~~~k~~G~N~vRl-~~~~   55 (302)
T 1bqc_A           30 WYPQHTQAFADIKSHGANTVRV-VLSN   55 (302)
T ss_dssp             TCTTCTTHHHHHHHTTCSEEEE-EECC
T ss_pred             CCCCHHHHHHHHHHCCCCEEEE-ECCC
T ss_conf             4500699999999769988997-0316


No 65 
>1j6o_A TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} SCOP: c.1.9.12
Probab=22.24  E-value=34  Score=13.56  Aligned_cols=24  Identities=8%  Similarity=0.110  Sum_probs=15.1

Q ss_pred             CCCCHHHHHHHHHHCCCCEEEEEE
Q ss_conf             454247899999870996589963
Q gi|254780200|r  121 GKPSVKEIINNLREEGCDRLLIFP  144 (343)
Q Consensus       121 ~~P~i~~~l~~l~~~g~~~ii~lP  144 (343)
                      .....+++++++++.|++.++...
T Consensus        25 ~~~d~~~vl~~a~~~gv~~ii~~~   48 (268)
T 1j6o_A           25 FDDDRNAVISSFEENNIEFVVNVG   48 (268)
T ss_dssp             GTTTHHHHHHTTTTTTEEEEEEEC
T ss_pred             HCCCHHHHHHHHHHCCCCEEEEEC
T ss_conf             465999999999988998899905


No 66 
>1xwy_A DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc ION, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.1.9.12
Probab=20.60  E-value=36  Score=13.33  Aligned_cols=56  Identities=13%  Similarity=0.020  Sum_probs=29.2

Q ss_pred             CCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             542478999998709965899631711100146899999999998717998642133455780068999
Q gi|254780200|r  122 KPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRTVPPYYEDSDYISAL  190 (343)
Q Consensus       122 ~P~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l~~~~~~~~~~~I~~~~~~p~yI~a~  190 (343)
                      ....+++++..++.|+.+++...        |+-...+.+.+...+..   .  +...+.-||.+++..
T Consensus        18 ~~d~~~vl~~a~~~gV~~ii~~~--------~~~~~~~~~~~la~~~~---~--i~~~~GiHP~~~~~~   73 (264)
T 1xwy_A           18 AKDRDDVVACAFDAGVNGLLITG--------TNLRESQQAQKLARQYS---S--CWSTAGVHPHDSSQW   73 (264)
T ss_dssp             TTTHHHHHHHHHHTTCCEEEECC--------CSHHHHHHHHHHHHHST---T--EEEEECCCGGGGGGC
T ss_pred             CCCHHHHHHHHHHCCCCEEEEEC--------CCHHHHHHHHHHHHHCC---C--EEEEEEECCCHHHCC
T ss_conf             06899999999988998899953--------89999999999997589---8--589961181523204


No 67 
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens}
Probab=20.57  E-value=36  Score=13.33  Aligned_cols=21  Identities=19%  Similarity=0.390  Sum_probs=16.5

Q ss_pred             CCCHHHHHHHHHHCCCCEEEE
Q ss_conf             542478999998709965899
Q gi|254780200|r  122 KPSVKEIINNLREEGCDRLLI  142 (343)
Q Consensus       122 ~P~i~~~l~~l~~~g~~~ii~  142 (343)
                      .|.+++.|++|++.|+.-.++
T Consensus        72 ~pg~~e~L~~Lk~~g~~~~i~   92 (205)
T 3m9l_A           72 APGAVELVRELAGRGYRLGIL   92 (205)
T ss_dssp             CTTHHHHHHHHHHTTCEEEEE
T ss_pred             CCCHHHHHHHHHHCCCEEEEE
T ss_conf             817999999999889959998


No 68 
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xmp_A*
Probab=20.54  E-value=36  Score=13.33  Aligned_cols=22  Identities=23%  Similarity=0.178  Sum_probs=9.2

Q ss_pred             HHHHHCCCCCCCEEEEECCCCC
Q ss_conf             9997266756704786225777
Q gi|254780200|r  237 LKEFLSWPDDRFKICFQSRFGR  258 (343)
Q Consensus       237 i~~~l~~~~~~~~l~fQSr~Gp  258 (343)
                      +.+.+|++.++..+.|-+|+.+
T Consensus       221 ~~~~~~i~~~~~iil~vGr~~~  242 (416)
T 2x6q_A          221 ILERFDVDPEKPIITQVSRFDP  242 (416)
T ss_dssp             HHHHTTCCTTSCEEEEECCCCT
T ss_pred             HHHHCCCCCCCEEEEEEECCCH
T ss_conf             9998094989918999804703


No 69 
>3ke8_A 4-hydroxy-3-methylbut-2-ENYL diphosphate reductase; induced FIT mechanism, FS4-iron-sulfure-cluster, 3Fe-4S, iron, iron-sulfur; HET: EIP; 1.70A {Escherichia coli} PDB: 3ke9_A* 3kef_A* 3kel_A 3kem_A* 3f7t_A
Probab=20.47  E-value=37  Score=13.32  Aligned_cols=30  Identities=17%  Similarity=0.207  Sum_probs=14.4

Q ss_pred             HHHHHHHHCCCCCEEEECCHHHHCCHHHHHHH
Q ss_conf             99998997699839997440542212558887
Q gi|254780200|r  268 KTVEKLAHDGIKSLAIITPGFSSDCLETSYEI  299 (343)
Q Consensus       268 ~~l~~L~~~G~k~v~v~p~gFvsD~lETl~Ei  299 (343)
                      +.+.+|+++  -.+.++-=|.=|-|---|+|+
T Consensus       215 ~a~~~La~~--vD~miVVGg~nSSNT~~L~ei  244 (326)
T 3ke8_A          215 EAVRALAEQ--AEVVLVVGSKNSSNSNRLAEL  244 (326)
T ss_dssp             HHHHHHHTT--CSEEEEECCTTCHHHHHHHHH
T ss_pred             HHHHHHHHH--CCEEEEECCCCCCCHHHHHHH
T ss_conf             999999976--779999888899648899999


No 70 
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A*
Probab=20.34  E-value=37  Score=13.30  Aligned_cols=25  Identities=20%  Similarity=0.473  Sum_probs=19.3

Q ss_pred             HHCCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             21045424789999987099658996
Q gi|254780200|r  118 MRYGKPSVKEIINNLREEGCDRLLIF  143 (343)
Q Consensus       118 mry~~P~i~~~l~~l~~~g~~~ii~l  143 (343)
                      .+=+.|+.++ ++.|++.|++.||-|
T Consensus        23 ~~sgqP~~~d-l~~L~~~GiktVInL   47 (157)
T 3gxh_A           23 LSSGLPNEQQ-FSLLKQAGVDVVINL   47 (157)
T ss_dssp             EEEBCCCHHH-HHHHHHTTCCEEEEC
T ss_pred             EECCCCCHHH-HHHHHHCCCCEEEEC
T ss_conf             1258989999-999998699899989


No 71 
>1pzx_A Hypothetical protein APC36103; structural genomics, two domains containing mixed alpha/beta structures, PSI; HET: PLM; 2.00A {Geobacillus stearothermophilus} SCOP: c.119.1.1
Probab=20.32  E-value=37  Score=13.30  Aligned_cols=183  Identities=17%  Similarity=0.154  Sum_probs=87.7

Q ss_pred             HCCCCCHHH---HHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHH---HHHH
Q ss_conf             104542478---9999987099658996317111001468999999999987179986421334557800689---9999
Q gi|254780200|r  119 RYGKPSVKE---IINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRTVPPYYEDSDYIS---ALAQ  192 (343)
Q Consensus       119 ry~~P~i~~---~l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l~~~~~~~~~~~I~~~~~~p~yI~---a~~~  192 (343)
                      +-+.|++.+   +.+++.++| ++|+++++-..-|.  |-.+...+.+.+.......++++|++..-.-+.-.   ..++
T Consensus        61 ~TS~ps~~~~~~~~~~l~~~g-~~ii~i~iSs~lSg--ty~~a~~a~~~~~~~~~~~~I~viDS~~~s~~~g~lv~~a~~  137 (289)
T 1pzx_A           61 KTAQPSPLAMKELFLPYAKEN-RPCLYIAFSSKLSG--TYQTAMAVRSELLDEYPEFRLTIIDSKCASLGQGLAVMKAVE  137 (289)
T ss_dssp             EEECCCHHHHHHHHHHHHHTT-CCEEEEECCTTTCS--HHHHHHHHHHHHHHHSTTCCEEEEECCCCHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHCCC-CEEEEEECCCCHHH--HHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHH
T ss_conf             657899999999999985189-84999986640517--999999999987744799749999289702889999999999


Q ss_pred             HH---------HHHHHHCCCCCCEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEC-C---CCCC
Q ss_conf             99---------999973389986699983367502676279988899999999999726675670478622-5---7776
Q gi|254780200|r  193 SI---------REHFESIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKICFQS-R---FGRI  259 (343)
Q Consensus       193 ~I---------~~~l~~~~~~~~~llfSaHglP~~~~~~gDpY~~q~~~t~~~i~~~l~~~~~~~~l~fQS-r---~Gp~  259 (343)
                      .+         .+.+++.. +..++.|+--.|  .++.+|-    .+-..+..+...|++++   -+.+-. +   ++..
T Consensus       138 ~~~~G~s~~ei~~~l~~~~-~~~~~~f~v~~L--~~L~kgG----Ris~~~~~ig~lL~IkP---Ii~~~~G~i~~~~k~  207 (289)
T 1pzx_A          138 LAKQNTPYNLLCETIESYC-RHMEHIFTVDNL--DYLARGG----RISKTAAAFGGLLNIKP---LLHVEDGALIPLEKW  207 (289)
T ss_dssp             HHHTTCCHHHHHHHHHHHH-HTEEEEEECSCH--HHHHHHT----SCC----------CEEE---EEEEETTEEEEEEEE
T ss_pred             HHHCCCCHHHHHHHHHHHH-HCCEEEEEECCH--HHHHHCC----CCHHHHHHHHHHHCEEE---EEEEECCEEEEEEEE
T ss_conf             9984999999999999998-367599997987--9998779----83688999985008079---999729959997665


Q ss_pred             CCCCHHHHHHHHHHHHCC--CCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             544302689999899769--983999744054221255888758999999975997589816
Q gi|254780200|r  260 KCLEPPTDKTVEKLAHDG--IKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVP  319 (343)
Q Consensus       260 ~WL~P~t~~~l~~L~~~G--~k~v~v~p~gFvsD~lETl~Eidie~~e~~~e~Gg~~~~rvp  319 (343)
                      .=.+=.....++.+.+.+  .+.. .+.++. ++|.|...++--..++.   .|...+...+
T Consensus       208 R~~kka~~~l~~~~~~~~~~~~~~-~i~i~~-~~~~e~~~~l~~~l~~~---~~~~~i~~~~  264 (289)
T 1pzx_A          208 RGRKKVLKRMVELMGERGDDLQKQ-TIGISH-ADDEETALELKQMIEET---HGCTRFFLSD  264 (289)
T ss_dssp             ESHHHHHHHHHHHHHHHCSSGGGS-EEEEEE-SSCHHHHHHHHHHHHHH---TCCCEEEEEE
T ss_pred             ECHHHHHHHHHHHHHHHHCCCCCC-EEEEEC-CCCHHHHHHHHHHHHHH---CCCCEEEEEE
T ss_conf             009999999999999862478972-899992-89999999999999877---6997299999


No 72 
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, rossmann fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A*
Probab=20.12  E-value=37  Score=13.27  Aligned_cols=23  Identities=17%  Similarity=0.283  Sum_probs=14.5

Q ss_pred             CCCHHHHHHHHHHCCCCEEEEEE
Q ss_conf             54247899999870996589963
Q gi|254780200|r  122 KPSVKEIINNLREEGCDRLLIFP  144 (343)
Q Consensus       122 ~P~i~~~l~~l~~~g~~~ii~lP  144 (343)
                      .+.+.+++.++.+.|+.-++++.
T Consensus        74 ~~~v~~a~~e~~~~Gik~~viit   96 (288)
T 2nu8_A           74 APFCKDSILEAIDAGIKLIITIT   96 (288)
T ss_dssp             GGGHHHHHHHHHHTTCSEEEECC
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             58999999999977997899964


Done!