BLAST/PSIBLAST alignment of GI: 254780200 and GI: 327189611 at iteration 1
>gi|327189611|gb|EGE56761.1| ferrochelatase protein [Rhizobium etli CNPAF512] Length = 361
 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 196/338 (57%), Positives = 247/338 (73%)

Query: 5   SFAPRNHPKVKFGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFG 64
           S  P +HP V  GK+GVLLVNLGTPDG D+ S+RRYLREFL D+RV+E   W+W PILFG
Sbjct: 23  SLRPADHPAVMSGKVGVLLVNLGTPDGTDYTSMRRYLREFLTDRRVIEWSRWKWYPILFG 82

Query: 65  YILNFRPSKIKHAYAKIWNTAKNESILRTHTRDQATNLAKRLESISSIVVDWAMRYGKPS 124
            +LN RP K+  AY  IWN  KNES LRT+TR+Q+  +A+RL+ + ++ VDWAMRYG PS
Sbjct: 83  IVLNRRPQKVGKAYELIWNKEKNESFLRTYTRNQSELMAERLKDLDNVKVDWAMRYGTPS 142

Query: 125 VKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRTVPPYYEDS 184
           +   I  L++EGCDR+++FPLYPQY+AATT T  DK FQ+L+ MRW P+LRTVP Y++D 
Sbjct: 143 IASRIEALKQEGCDRIVLFPLYPQYAAATTATVNDKAFQKLLSMRWQPALRTVPDYHDDE 202

Query: 185 DYISALAQSIREHFESIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWP 244
            YI ALAQS+ +H  S+ W P+ML+ SFH +P+SY  +GDPY C C KT RLL+E L   
Sbjct: 203 TYIDALAQSVEKHLSSLDWKPDMLIASFHGIPMSYFKQGDPYYCQCQKTGRLLRERLGLT 262

Query: 245 DDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAK 304
            + F + FQSRFG  + L+P TDKTVEKLA DG+K +A+I PGF SDCLET  EIA +A 
Sbjct: 263 QENFMVTFQSRFGPEEWLQPYTDKTVEKLARDGVKRIAVINPGFVSDCLETLEEIAEQAA 322

Query: 305 EIFVNGGGEKFTQVPCLNSSNLSIDLLEKITRRELMGW 342
             F   GGEKF  +PCLN S   + +LEK+ RREL GW
Sbjct: 323 HSFHENGGEKFAHIPCLNDSEDGMKVLEKVVRRELQGW 360