PSIBLAST alignment of GI: 254780200 and protein with PDB id: 1c9e

>gi|7546417|pdb|1C9E|A Chain A, Structure Of Ferrochelatase With Copper(Ii) N- Methylmesoporphyrin Complex Bound At The Active Site Length = 306
 Score =  149 bits (376), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 58/330 (17%), Positives = 120/330 (36%), Gaps = 34/330 (10%)

Query: 18  KIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKIKHA 77
           K+G+L++  GTP  +    + RY          +                     ++   
Sbjct: 1   KMGLLVMAYGTP--YKEEDIERYYTH-------IRRGRKP-------------EPEMLQD 38

Query: 78  YAKIWNTAKNESILRTHTRDQATNLAKRLESISS---IVVDWAMRYGKPSVKEIINNLRE 134
               +      S L   T  QA NL + L  I           +++ +P +++ +  + +
Sbjct: 39  LKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHK 98

Query: 135 EGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRTVPPYYEDSDYISALAQSI 194
           +G    +   L P +S  +  +   +  +E   +           +Y++  +++     +
Sbjct: 99  DGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVES-WYDEPKFVTYWVDRV 157

Query: 195 REHFE---SIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKIC 251
           +E +      +    ML+VS H +P      GDPY    H++A+L+ E        + + 
Sbjct: 158 KETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAG--VSEYAVG 215

Query: 252 FQSR-FGRIKCLEPPTDKTVEK-LAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVN 309
           +QS        L P             G ++   +  GF +D LE  Y+  +E K +  +
Sbjct: 216 WQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDD 275

Query: 310 GGGEKFTQVPCLNSSNLSIDLLEKITRREL 339
            G   + +    N+    ID L  +  ++L
Sbjct: 276 IG-ASYYRPEMPNAKPEFIDALATVVLKKL 304