PSIBLAST alignment of GI: 254780200 and protein with PDB id: 2pnj

>gi|158429459|pdb|2PNJ|A Chain A, Crystal Structure Of Human Ferrochelatase Mutant With Phe 337 Replaced By Ala Length = 359
>gi|158429460|pdb|2PNJ|B Chain B, Crystal Structure Of Human Ferrochelatase Mutant With Phe 337 Replaced By Ala Length = 359
 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 73/332 (21%), Positives = 148/332 (44%), Gaps = 12/332 (3%)

Query: 15  KFGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKI 74
           +  K G+L++N+G P+      +  +L    LD+ ++ LP    +  L  +I      KI
Sbjct: 1   RKPKTGILMLNMGGPETL--GDVHDFLLRLFLDRDLMTLP---IQNKLAPFIAKRLTPKI 55

Query: 75  KHAYAKIWNTAKNESILRTHTRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLRE 134
           +  Y +I   +  +             L +   + +        RY  P  +E I  +  
Sbjct: 56  QEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMER 115

Query: 135 EGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRT--VPPYYEDSDYISALAQ 192
           +G +R + F  YPQYS +TTG++ + +++    +   P+++   +  +      I   A 
Sbjct: 116 DGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFAD 175

Query: 193 SIREHFESI---QWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFK 249
            I +  +     + +  ++L S H +P+S + +GDPY      T + + E L +  + ++
Sbjct: 176 HILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEY-CNPYR 234

Query: 250 ICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKE-IFV 308
           + +QS+ G +  L P TD++++ L   G K++ ++    +SD +ET YE+  E  + +  
Sbjct: 235 LVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAATSDHIETLYELDIEYSQVLAK 294

Query: 309 NGGGEKFTQVPCLNSSNLSIDLLEKITRRELM 340
             G E   +   LN + L    L  +    + 
Sbjct: 295 ECGVENIRRAESLNGNPLFSKALADLVHSHIQ 326