PSIBLAST alignment of GI: 254780200 and protein with PDB id: 2q3j

>gi|185177562|pdb|2Q3J|A Chain A, Crystal Structure Of The His183ala Variant Of Bacillus Subtilis Ferrochelatase In Complex With N-Methyl Mesoporphyrin Length = 309
 Score =  149 bits (376), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 57/331 (17%), Positives = 119/331 (35%), Gaps = 34/331 (10%)

Query: 17  GKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKIKH 76
            K+G+L++  GTP  +    + RY          +                     ++  
Sbjct: 3   KKMGLLVMAYGTP--YKEEDIERYYTH-------IRRGRKP-------------EPEMLQ 40

Query: 77  AYAKIWNTAKNESILRTHTRDQATNLAKRLESISS---IVVDWAMRYGKPSVKEIINNLR 133
                +      S L   T  QA NL + L  I           +++ +P +++ +  + 
Sbjct: 41  DLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMH 100

Query: 134 EEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRTVPPYYEDSDYISALAQS 193
           ++G    +   L P +S  +  +   +  +E   +           +Y++  +++     
Sbjct: 101 KDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVES-WYDEPKFVTYWVDR 159

Query: 194 IREHFE---SIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKI 250
           ++E +      +    ML+VS   +P      GDPY    H++A+L+ E        + +
Sbjct: 160 VKETYASMPEDERENAMLIVSAASLPEKIKEFGDPYPDQLHESAKLIAEGAG--VSEYAV 217

Query: 251 CFQSR-FGRIKCLEPPTDKTVEK-LAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFV 308
            +QS        L P             G ++   +  GF +D LE  Y+  +E K +  
Sbjct: 218 GWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTD 277

Query: 309 NGGGEKFTQVPCLNSSNLSIDLLEKITRREL 339
           + G   + +    N+    ID L  +  ++L
Sbjct: 278 DIG-ASYYRPEMPNAKPEFIDALATVVLKKL 307