PSIBLAST alignment of GI: 254780200 and protein with PDB id: 3goq

>gi|292659590|pdb|3GOQ|A Chain A, Crystal Structure Of The Tyr13met Variant Of Bacillus Subtilis Ferrochelatase Length = 310
 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 58/331 (17%), Positives = 121/331 (36%), Gaps = 34/331 (10%)

Query: 17  GKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKIKH 76
            K+G+L++ +GTP  +    + RY          +                     ++  
Sbjct: 4   KKMGLLVMAMGTP--YKEEDIERYYTH-------IRRGRKP-------------EPEMLQ 41

Query: 77  AYAKIWNTAKNESILRTHTRDQATNLAKRLESISS---IVVDWAMRYGKPSVKEIINNLR 133
                +      S L   T  QA NL + L  I           +++ +P +++ +  + 
Sbjct: 42  DLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMH 101

Query: 134 EEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRTVPPYYEDSDYISALAQS 193
           ++G    +   L P +S  +  +   +  +E   +           +Y++  +++     
Sbjct: 102 KDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVES-WYDEPKFVTYWVDR 160

Query: 194 IREHFE---SIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKI 250
           ++E +      +    ML+VS H +P      GDPY    H++A+L+ E        + +
Sbjct: 161 VKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAG--VSEYAV 218

Query: 251 CFQSR-FGRIKCLEPPTDKTVEK-LAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFV 308
            +QS        L P             G ++   +  GF +D LE  Y+  +E K +  
Sbjct: 219 GWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTD 278

Query: 309 NGGGEKFTQVPCLNSSNLSIDLLEKITRREL 339
           + G   + +    N+    ID L  +  ++L
Sbjct: 279 DIG-ASYYRPEMPNAKPEFIDALATVVLKKL 308