RPSBLAST alignment for GI: 254780200 and conserved domain: KOG1321

>gnl|CDD|36535 KOG1321, KOG1321, KOG1321, Protoheme ferro-lyase (ferrochelatase) [Coenzyme transport and metabolism]. Length = 395
 Score =  149 bits (377), Expect = 1e-36
 Identities = 89/340 (26%), Positives = 157/340 (46%), Gaps = 33/340 (9%)

Query: 9   RNHPKVKFGKIGVLLVNLGTP----DGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFG 64
            +    K  K G+LL+N+G P    D  DF      L     D  ++ LP++  +  L  
Sbjct: 29  SSSVAQKKPKTGILLLNMGGPETLDDVQDF------LYRLFADPDIIPLPAFLQKT-LAK 81

Query: 65  YILNFRPSKIKHAYAKIWNTAKNESILRTHTRDQATNLAKRLESISSIVVDW----AMRY 120
           +I   R  K++  Y +I       S +R  T  QA  + K L+               RY
Sbjct: 82  FIAKRRTPKVQEQYREI----GGGSPIRKWTEYQAEEMCKILDKKCPETAPHKPYVGFRY 137

Query: 121 GKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIH------MRWSPSL 174
             P  +E +  ++++G  R + F  YPQYS +T+G++ ++++++         ++WS   
Sbjct: 138 AHPLTEEALEQIKKDGVTRAVAFSQYPQYSCSTSGSSLNELWRQFREDGYERDIKWS--- 194

Query: 175 RTVPPYYEDSDYISALAQSIRE---HFESIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCH 231
             +  +      I A A++I +    F        ++L S H +P+S +  GDPY     
Sbjct: 195 -IIDRWPTREGLIKAFAENIEKELQTFPEPVRDDVVILFSAHSLPMSVVNAGDPYPAEIA 253

Query: 232 KTARLLKEFLSWPDDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSD 291
            T  L+ E L + +  +++ +QS+ G +  L P TD+ +E L   G+K+L ++   F S+
Sbjct: 254 ATVDLIMEELKYKNP-YRLAWQSKVGPLPWLGPATDEVIEGLGKKGVKNLLLVPIAFVSE 312

Query: 292 CLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLL 331
            +ET +EI  E  E  +  G E + +V  LN +   I+ L
Sbjct: 313 HIETLHEIDIEYIEEALKKGVENWKRVESLNGNPTFIEGL 352