RPSBLAST alignment of GI: 254780200 and protein with PDBid: 1lbq

>1lbq_A Ferrochelatase; rossmann fold, PI-helix, lyase; 2.40A {Saccharomyces cerevisiae} SCOP: c.92.1.1 PDB: 1l8x_A Length = 362
 Score =  289 bits (741), Expect = 6e-79
 Identities = 75/337 (22%), Positives = 147/337 (43%), Gaps = 20/337 (5%)

Query: 15  KFGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKI 74
           K    G++L+N+G P   +      +L +   D  ++ + +  ++  +  YI  FR  KI
Sbjct: 4   KRSPTGIVLMNMGGPSKVE--ETYDFLYQLFADNDLIPISAK-YQKTIAKYIAKFRTPKI 60

Query: 75  KHAYAKIWNTAKNESILRTHTRDQATNLAKRLESI----SSIVVDWAMRYGKPSVKEIIN 130
           +  Y +I       S +R  +  QAT + K L+      +      A RY KP   E   
Sbjct: 61  EKQYREIGG----GSPIRKWSEYQATEVCKILDKTCPETAPHKPYVAFRYAKPLTAETYK 116

Query: 131 NLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQEL--IHMRWSPSLRTVPPYYEDSDYIS 188
            + ++G  + + F  YP +S +TTG++ +++++++  +    S S   +  +  +   I 
Sbjct: 117 QMLKDGVKKAVAFSQYPHFSYSTTGSSINELWRQIKALDSERSISWSVIDRWPTNEGLIK 176

Query: 189 ALAQSIREHFESI---QWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPD 245
           A +++I +  +          +LL S H +P+  +  GD Y      T   + + L +  
Sbjct: 177 AFSENITKKLQEFPQPVRDKVVLLFSAHSLPMDVVNTGDAYPAEVAATVYNIMQKLKFK- 235

Query: 246 DRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKE 305
           + +++ +QS+ G    L   T +  E L    +  L  I   F+SD +ET +EI      
Sbjct: 236 NPYRLVWQSQVGPKPWLGAQTAEIAEFLG-PKVDGLMFIPIAFTSDHIETLHEIDLGV-- 292

Query: 306 IFVNGGGEKFTQVPCLNSSNLSIDLLEKITRRELMGW 342
           I  +   +KF +   LN +   I+ +  + +  L   
Sbjct: 293 IGESEYKDKFKRCESLNGNQTFIEGMADLVKSHLQSN 329