RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780201|ref|YP_003064614.1| hypothetical protein CLIBASIA_00430 [Candidatus Liberibacter asiaticus str. psy62] (394 letters) >gnl|CDD|179282 PRK01345, PRK01345, heat shock protein HtpX; Provisional. Length = 317 Score = 28.8 bits (65), Expect = 2.6 Identities = 11/22 (50%), Positives = 17/22 (77%) Query: 302 EVYRRVIDLAKRAGFPTKRLHL 323 E+YR V DLA+RAG P ++++ Sbjct: 68 ELYRMVRDLARRAGLPMPKVYI 89 >gnl|CDD|162465 TIGR01652, ATPase-Plipid, phospholipid-translocating P-type ATPase, flippase. This model describes the P-type ATPase responsible for transporting phospholipids from one leaflet of bilayer membranes to the other. These ATPases are found only in eukaryotes. Length = 1057 Score = 27.7 bits (62), Expect = 5.8 Identities = 11/65 (16%), Positives = 24/65 (36%), Gaps = 1/65 (1%) Query: 14 IENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWL 73 I NL + L++ + I I + ++++ S + + +F FWL Sbjct: 966 IVNLKIALEINRWNWISLITIWGSI-LVWLIFVIVYSSIFPSPAFYKAAPRVMGTFGFWL 1024 Query: 74 RSFLA 78 + Sbjct: 1025 VLLVI 1029 >gnl|CDD|165222 PHA02896, PHA02896, A-type inclusion like protein; Provisional. Length = 616 Score = 27.3 bits (60), Expect = 7.0 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 5/53 (9%) Query: 111 MSNSRMPFDSEKFLYVKE-----LFEGWNDRPSSPKKSGLTIKSKIAIVVHCY 158 MSN RMP S K Y+ L+ G ND + SG + KI+ +V Y Sbjct: 96 MSNDRMPDISTKGRYILYFVMFLLYMGNNDTKFNYSDSGRNVSKKISEIVTDY 148 >gnl|CDD|177753 PLN00149, PLN00149, potassium transporter; Provisional. Length = 779 Score = 27.1 bits (60), Expect = 8.2 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Query: 237 KKSQREGYHPIEGIIW----RRWLFFDLLGFSDIAIRIINTFEQNPCL 280 KK+QR G+ + GI+ +F DL FS ++I+I T P L Sbjct: 264 KKTQRGGWMSLGGILLCITGSEAMFADLGHFSQLSIKIAFTSLVYPSL 311 >gnl|CDD|185530 PTZ00258, PTZ00258, GTP-binding protein; Provisional. Length = 390 Score = 26.8 bits (60), Expect = 8.6 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 226 DRYDYLCKIHGKKSQ 240 +R+D+LCK KS Sbjct: 68 ERFDWLCKHFKPKSI 82 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.328 0.143 0.447 Gapped Lambda K H 0.267 0.0684 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 6,756,106 Number of extensions: 447680 Number of successful extensions: 989 Number of sequences better than 10.0: 1 Number of HSP's gapped: 989 Number of HSP's successfully gapped: 14 Length of query: 394 Length of database: 5,994,473 Length adjustment: 95 Effective length of query: 299 Effective length of database: 3,941,713 Effective search space: 1178572187 Effective search space used: 1178572187 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 58 (26.2 bits)