HHsearch alignment for GI: 254780202 and conserved domain: COG1060

>COG1060 ThiH Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only].
Probab=92.87  E-value=0.24  Score=29.87  Aligned_cols=80  Identities=14%  Similarity=0.188  Sum_probs=46.5

Q ss_pred             CCCCCEEEEECCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEECCCCC
Q ss_conf             1373159997689888--75553333236888877575232588866078999999999875216678738998077200
Q gi|254780202|r   19 HAGRVAVFCRFSGCNL--WSGREQDRLSAQCRFCDTDFVGIQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPL   96 (211)
Q Consensus        19 ~~G~p~vFiRl~GCnL--~c~~~~~~~~~~C~~CDT~y~~~~~~~~~~~~~~~i~~~i~~~~~~~~~~~~~VviTGGEPl   96 (211)
T Consensus        50 ~~~~~vtyv~n~~in~TN~C~-------~~C~fCaF-~~~~~~~~~y~Ls~eeI~~~~~~~~~~---G~~Evli~gG~~p  118 (370)
T COG1060          50 RVGDGVTYVVNRNINYTNICV-------NDCTFCAF-YRKPGDPKAYTLSPEEILEEVREAVKR---GITEVLIVGGEHP  118 (370)
T ss_pred             CCCCCEEEEEEECCCCCHHHC-------CCCCCCCC-CCCCCCCCCCCCCHHHHHHHHHHHHHC---CCEEEEEECCCCC
T ss_conf             368857999752578532331-------79972623-457888655316999999999999875---9869998057687


Q ss_pred             CCCC---CHHHHHHHH
Q ss_conf             0035---178999986
Q gi|254780202|r   97 LQVD---VPLIQALNK  109 (211)
Q Consensus        97 lq~l---~~L~~~l~~  109 (211)
T Consensus       119 ~~~~~y~~~~~~~ik~  134 (370)
T COG1060         119 ELSLEYYEELFRTIKE  134 (370)
T ss_pred             CCCHHHHHHHHHHHHH
T ss_conf             7436799999999988