BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780202|ref|YP_003064615.1| hypothetical protein
CLIBASIA_00435 [Candidatus Liberibacter asiaticus str. psy62]
         (211 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|254780202|ref|YP_003064615.1| hypothetical protein CLIBASIA_00435 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039879|gb|ACT56675.1| hypothetical protein CLIBASIA_00435 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 211

 Score =  291 bits (746), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 211/211 (100%), Positives = 211/211 (100%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT
Sbjct: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG
Sbjct: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF
Sbjct: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           LEENTNLAISYCFQNPKWRLSVQTHKFIGIR
Sbjct: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211


>gi|311106693|ref|YP_003979546.1| radical SAM superfamily protein 3 [Achromobacter xylosoxidans A8]
 gi|310761382|gb|ADP16831.1| radical SAM superfamily protein 3 [Achromobacter xylosoxidans A8]
          Length = 226

 Score =  278 bits (711), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 123/209 (58%), Positives = 146/209 (69%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS KEIF TLQGEG HAGR AVFCRF+GCNLW+GRE DR SA C FCDTDF+G  G  
Sbjct: 17  MTYSAKEIFKTLQGEGAHAGRAAVFCRFAGCNLWTGRESDRASAACTFCDTDFIGTDGEG 76

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GG++   +L               RY V TGGEPLLQ+D PL+ A++ RGF IA+ETNGT
Sbjct: 77  GGKFATPELLADAIAAAWGPGATDRYVVFTGGEPLLQLDAPLLTAVHARGFTIAIETNGT 136

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           I+PP GIDWICVSPK    + ++ G ELKLV+PQ N  PE +   DF+ F LQPMDGP  
Sbjct: 137 IKPPAGIDWICVSPKGTAPVVLERGDELKLVYPQANARPEAFAHLDFDHFFLQPMDGPAR 196

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             NT  A+ YC Q+P+WRLS+QTHK+IGI
Sbjct: 197 AANTEQAVQYCMQHPQWRLSLQTHKYIGI 225


>gi|315122629|ref|YP_004063118.1| hypothetical protein CKC_04405 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496031|gb|ADR52630.1| hypothetical protein CKC_04405 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 211

 Score =  277 bits (710), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 172/211 (81%), Positives = 188/211 (89%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           MKLYS+KEIFLTLQGEG   GRVAVFCRFSGCNLWSGRE+DRL AQCRFCDTDFVG +GT
Sbjct: 1   MKLYSVKEIFLTLQGEGAQVGRVAVFCRFSGCNLWSGREKDRLFAQCRFCDTDFVGTKGT 60

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
            GGRY+ +QLADLI   WI  EKE RYCVLTGGEPLLQVD  LI+ALNKR F I+VETNG
Sbjct: 61  MGGRYSAEQLADLIASAWIPEEKEERYCVLTGGEPLLQVDSALIKALNKRNFTISVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TI+PP+GIDWICVSPKAGCDLK+K GQELKLVFPQV+  PENYI FDF+ FSLQPMDG F
Sbjct: 121 TIKPPEGIDWICVSPKAGCDLKVKNGQELKLVFPQVDAPPENYIDFDFDIFSLQPMDGSF 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           L+ENTNLAISYCF+NPKWR+S+QTHKFIGIR
Sbjct: 181 LKENTNLAISYCFKNPKWRVSLQTHKFIGIR 211


>gi|75676803|ref|YP_319224.1| hypothetical protein Nwi_2619 [Nitrobacter winogradskyi Nb-255]
 gi|74421673|gb|ABA05872.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 210

 Score =  277 bits (708), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 134/210 (63%), Positives = 155/210 (73%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIFLTLQGEG HAGR AVFCRFSGCNLWSGRE+DR SA CRFCDTDFVG  GT 
Sbjct: 1   MSYAVKEIFLTLQGEGAHAGRAAVFCRFSGCNLWSGREEDRASATCRFCDTDFVGTDGTL 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGRY               G    RY VLTGGEPLLQVD   + AL+ RGFEI +ETNGT
Sbjct: 61  GGRYASADALADTVAGQWAGPAAHRYAVLTGGEPLLQVDKAFVDALHARGFEIGIETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           + PP GIDW+CVSPKAG DL+I+ G ELKLV+PQ +  PE++    F+RFSLQPMDGP  
Sbjct: 121 LAPPDGIDWLCVSPKAGADLRIRRGHELKLVYPQADARPEDFADLAFDRFSLQPMDGPDA 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            ENT  A+ YC ++P+WRLS+QTHK +GIR
Sbjct: 181 AENTARAVDYCLRHPQWRLSLQTHKTLGIR 210


>gi|92118709|ref|YP_578438.1| hypothetical protein Nham_3243 [Nitrobacter hamburgensis X14]
 gi|91801603|gb|ABE63978.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 210

 Score =  277 bits (708), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 135/210 (64%), Positives = 156/210 (74%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIFLTLQGEG HAGR AVFCRF+GCNLWSGRE+DR SA CRFCDTDFVG+ GT+
Sbjct: 1   MSYAVKEIFLTLQGEGAHAGRAAVFCRFAGCNLWSGREEDRTSAICRFCDTDFVGMDGTR 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGRY              TG    RY VLTGGEPLLQVD   + AL+ RGFEI +ETNGT
Sbjct: 61  GGRYAAADELADTVAAQWTGSAPHRYAVLTGGEPLLQVDKAFVDALHARGFEIGIETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           I PP GIDW+CVSPKAG DL++  G ELKLV+PQ    PE++    FERFSLQPMDGP  
Sbjct: 121 IVPPDGIDWLCVSPKAGADLRVTKGHELKLVYPQAGARPEDFKDLAFERFSLQPMDGPDA 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            +NT  AI YC ++P+WRLS+QTHK +GIR
Sbjct: 181 ADNTARAIDYCMRHPQWRLSLQTHKTLGIR 210


>gi|53717820|ref|YP_106806.1| hypothetical protein BPSL0178 [Burkholderia pseudomallei K96243]
 gi|53724959|ref|YP_101992.1| hypothetical protein BMA0153 [Burkholderia mallei ATCC 23344]
 gi|67642462|ref|ZP_00441218.1| organic radical activating enzyme [Burkholderia mallei GB8 horse 4]
 gi|76808972|ref|YP_331771.1| GntS [Burkholderia pseudomallei 1710b]
 gi|121598296|ref|YP_994090.1| hypothetical protein BMASAVP1_A2794 [Burkholderia mallei SAVP1]
 gi|124385117|ref|YP_001028247.1| hypothetical protein BMA10229_A2285 [Burkholderia mallei NCTC
           10229]
 gi|126439185|ref|YP_001057215.1| organic radical activating protein [Burkholderia pseudomallei 668]
 gi|126450309|ref|YP_001081890.1| hypothetical protein BMA10247_2364 [Burkholderia mallei NCTC 10247]
 gi|134284085|ref|ZP_01770779.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|167717531|ref|ZP_02400767.1| hypothetical protein BpseD_00837 [Burkholderia pseudomallei DM98]
 gi|167736572|ref|ZP_02409346.1| hypothetical protein Bpse14_00837 [Burkholderia pseudomallei 14]
 gi|167813673|ref|ZP_02445353.1| hypothetical protein Bpse9_00961 [Burkholderia pseudomallei 91]
 gi|167822191|ref|ZP_02453662.1| hypothetical protein Bpseu9_00842 [Burkholderia pseudomallei 9]
 gi|167892283|ref|ZP_02479685.1| hypothetical protein Bpse7_00882 [Burkholderia pseudomallei 7894]
 gi|167900778|ref|ZP_02487983.1| hypothetical protein BpseN_00787 [Burkholderia pseudomallei NCTC
           13177]
 gi|167917042|ref|ZP_02504133.1| hypothetical protein BpseBC_00742 [Burkholderia pseudomallei
           BCC215]
 gi|217424912|ref|ZP_03456408.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|226194613|ref|ZP_03790208.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|237810350|ref|YP_002894801.1| radical SAM domain protein [Burkholderia pseudomallei MSHR346]
 gi|251767984|ref|ZP_02269071.2| conserved hypothetical protein [Burkholderia mallei PRL-20]
 gi|254176794|ref|ZP_04883451.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|254182243|ref|ZP_04888840.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|254188167|ref|ZP_04894679.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254203672|ref|ZP_04910032.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|254208648|ref|ZP_04914996.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|254258885|ref|ZP_04949939.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
 gi|254360298|ref|ZP_04976568.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|52208234|emb|CAH34165.1| conserved hypothetical protein [Burkholderia pseudomallei K96243]
 gi|52428382|gb|AAU48975.1| conserved hypothetical protein [Burkholderia mallei ATCC 23344]
 gi|76578425|gb|ABA47900.1| GntS [Burkholderia pseudomallei 1710b]
 gi|121227106|gb|ABM49624.1| conserved hypothetical protein [Burkholderia mallei SAVP1]
 gi|124293137|gb|ABN02406.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229]
 gi|126218678|gb|ABN82184.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
 gi|126243179|gb|ABO06272.1| conserved hypothetical protein [Burkholderia mallei NCTC 10247]
 gi|134244537|gb|EBA44641.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|147745184|gb|EDK52264.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|147750524|gb|EDK57593.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|148029538|gb|EDK87443.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|157935847|gb|EDO91517.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|160697835|gb|EDP87805.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|184212781|gb|EDU09824.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|217391932|gb|EEC31958.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|225933314|gb|EEH29306.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|237506322|gb|ACQ98640.1| radical SAM domain protein [Burkholderia pseudomallei MSHR346]
 gi|238523620|gb|EEP87057.1| organic radical activating enzyme [Burkholderia mallei GB8 horse 4]
 gi|243061139|gb|EES43325.1| conserved hypothetical protein [Burkholderia mallei PRL-20]
 gi|254217574|gb|EET06958.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
          Length = 210

 Score =  276 bits (707), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 119/210 (56%), Positives = 147/210 (70%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLW+GRE DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYTVKEIFYTLQGEGANAGRPAVFCRFAGCNLWTGREADRDGAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ +   LA  I   W  GE   R+ V TGGEP+LQ+D PL+ AL+  GF IA+ETNG
Sbjct: 61  GGKFKDAASLAARIASLWPAGEAY-RFVVCTGGEPMLQLDQPLVDALHAAGFTIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDWICVSPKA   L +  G ELK+V PQ N    +Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLESIDWICVSPKADAPLVVTKGNELKVVVPQDNQRLADYAKLDFEHFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RELNTRLAIDWCKRHPRWRLSMQTHKYLNI 209


>gi|126452181|ref|YP_001064455.1| hypothetical protein BURPS1106A_0172 [Burkholderia pseudomallei
           1106a]
 gi|167843783|ref|ZP_02469291.1| hypothetical protein BpseB_00735 [Burkholderia pseudomallei B7210]
 gi|167909000|ref|ZP_02496091.1| hypothetical protein Bpse112_00785 [Burkholderia pseudomallei 112]
 gi|242315880|ref|ZP_04814896.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|254197017|ref|ZP_04903441.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|254295716|ref|ZP_04963173.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|126225823|gb|ABN89363.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a]
 gi|157806282|gb|EDO83452.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|169653760|gb|EDS86453.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|242139119|gb|EES25521.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
          Length = 210

 Score =  276 bits (706), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 119/210 (56%), Positives = 147/210 (70%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLW+GRE DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYTVKEIFYTLQGEGANAGRPAVFCRFAGCNLWTGREADRDGAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ +   LA  I   W  GE   R+ V TGGEP+LQ+D PL+ AL+  GF IA+ETNG
Sbjct: 61  GGKFEDAASLAARIASLWPAGEAY-RFVVCTGGEPMLQLDQPLVDALHAAGFTIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDWICVSPKA   L +  G ELK+V PQ N    +Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLESIDWICVSPKADAPLVVTKGNELKVVVPQDNQRLADYAKLDFEHFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RELNTRLAIDWCKRHPRWRLSMQTHKYLNI 209


>gi|209515825|ref|ZP_03264687.1| Radical SAM domain protein [Burkholderia sp. H160]
 gi|209503673|gb|EEA03667.1| Radical SAM domain protein [Burkholderia sp. H160]
          Length = 210

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 124/210 (59%), Positives = 151/210 (71%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG+Y   D+L  +I  QW  GE E R+ V TGGEP+LQ+D PL+ AL+  GFEIA+ETNG
Sbjct: 61  GGKYRTPDELVAMIASQWPQGEGE-RFVVCTGGEPMLQLDQPLVDALHAAGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++     IDWICVSPKA   L +  G ELK+V PQ N    +Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLDTIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++PKWRLS+QTHK++ I
Sbjct: 180 RDLNTKLAIDWCKRHPKWRLSMQTHKYLNI 209


>gi|238028936|ref|YP_002913167.1| hypothetical protein bglu_1g34010 [Burkholderia glumae BGR1]
 gi|237878130|gb|ACR30463.1| Hypothetical protein bglu_1g34010 [Burkholderia glumae BGR1]
          Length = 210

 Score =  275 bits (704), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 122/210 (58%), Positives = 150/210 (71%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLW+GRE DR SA CRFCDTDFVG  G  
Sbjct: 1   MTYTVKEIFYTLQGEGANAGRPAVFCRFAGCNLWTGREADRDSAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++   + LAD +   W  GE   R+ V TGGEP+LQ+D PL+ AL+ RGFEIA+ETNG
Sbjct: 61  GGKFRTPELLADQVAALWPAGEA-HRFVVCTGGEPMLQLDQPLVDALHARGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++     IDWICVSPKA   L +  G ELK+V PQ N    +Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLDTIDWICVSPKADAPLVVTRGHELKVVIPQDNQRLADYARLDFEHFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RELNTRLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|83720295|ref|YP_440696.1| hypothetical protein BTH_I0138 [Burkholderia thailandensis E264]
 gi|167579367|ref|ZP_02372241.1| hypothetical protein BthaT_14560 [Burkholderia thailandensis TXDOH]
 gi|167617468|ref|ZP_02386099.1| hypothetical protein BthaB_14260 [Burkholderia thailandensis Bt4]
 gi|257140656|ref|ZP_05588918.1| hypothetical protein BthaA_15810 [Burkholderia thailandensis E264]
 gi|83654120|gb|ABC38183.1| conserved hypothetical protein [Burkholderia thailandensis E264]
          Length = 210

 Score =  275 bits (704), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 119/210 (56%), Positives = 147/210 (70%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLW+GRE DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYTVKEIFYTLQGEGANAGRPAVFCRFAGCNLWTGREADRGDAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ +   LA  I   W  GE   R+ V TGGEP+LQ+D PL+ AL+  GF IA+ETNG
Sbjct: 61  GGKFKDAASLAAKIASLWPPGEA-HRFVVCTGGEPMLQLDQPLVDALHAAGFTIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDWICVSPKA   L +  G ELK+V PQ N    +Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLESIDWICVSPKADAPLVVTKGNELKVVVPQDNQRLADYAKLDFEHFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RELNTKLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|167834987|ref|ZP_02461870.1| hypothetical protein Bpse38_00765 [Burkholderia thailandensis
           MSMB43]
          Length = 210

 Score =  275 bits (704), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 119/210 (56%), Positives = 148/210 (70%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLW+GRE DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYTVKEIFYTLQGEGANAGRPAVFCRFAGCNLWTGREADRDGAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ +   LA+ I   W  GE   R+ V TGGEP+LQ+D PL+ AL+  GF IA+ETNG
Sbjct: 61  GGKFKDAASLAEKIASLWPAGEA-HRFVVCTGGEPMLQLDQPLVDALHAAGFTIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDWICVSPKA   L +  G ELK+V PQ N    +Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLESIDWICVSPKADAPLVVTKGNELKVVVPQDNQHLADYAKLDFEHFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RELNTKLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|221201867|ref|ZP_03574904.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
 gi|221207627|ref|ZP_03580635.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221172473|gb|EEE04912.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221178287|gb|EEE10697.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
          Length = 210

 Score =  275 bits (704), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 120/210 (57%), Positives = 149/210 (70%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAQAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ + D L   I   W  GE   R+ V TGGEP+LQ+D PL+ AL+  GFEIA+ETNG
Sbjct: 61  GGKFKDADALVATIASLWPDGEA-HRFVVCTGGEPMLQLDQPLVDALHAAGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDWICVSPKA   L +  G ELK+V PQ N    +Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLESIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RDLNTKLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|295675134|ref|YP_003603658.1| Radical SAM domain protein [Burkholderia sp. CCGE1002]
 gi|295434977|gb|ADG14147.1| Radical SAM domain protein [Burkholderia sp. CCGE1002]
          Length = 210

 Score =  275 bits (703), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 123/210 (58%), Positives = 151/210 (71%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG+Y   D+L  +I  QW  GE E R+ V TGGEP+LQ+D PL+ AL+  GFEIA+ETNG
Sbjct: 61  GGKYRTPDELVAMIASQWPQGEGE-RFVVCTGGEPMLQIDQPLVDALHAAGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++     IDWICVSPKA   L +  G ELK+V PQ N    +Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLDTIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RDINTKLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|167645047|ref|YP_001682710.1| hypothetical protein Caul_1082 [Caulobacter sp. K31]
 gi|167347477|gb|ABZ70212.1| conserved hypothetical protein [Caulobacter sp. K31]
          Length = 210

 Score =  274 bits (701), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 132/209 (63%), Positives = 152/209 (72%), Gaps = 2/209 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIFLTLQGEGG AG+ AVFCRF+GCNLW+GREQDR  A C FCDTDFVG  G  
Sbjct: 1   MTYSVKEIFLTLQGEGGQAGKAAVFCRFAGCNLWTGREQDRRKAVCAFCDTDFVGTDGEG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++   D L D +E  W TG    R  V TGGEPLLQ+D PLI A + RGF IAVETNG
Sbjct: 61  GGKFVTPDALVDAVEAAW-TGGPGDRLVVCTGGEPLLQLDAPLIAAFHARGFMIAVETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P+GIDWICVSPKA   +    GQELKLV+PQ    PE +   DFERF LQPMDGP 
Sbjct: 120 TVAAPEGIDWICVSPKADAPVVQTRGQELKLVYPQDKALPERFAALDFERFYLQPMDGPD 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIG 209
            E NT LA++YC  +P+WRLSVQTHK++G
Sbjct: 180 RERNTQLAVAYCLSHPQWRLSVQTHKYLG 208


>gi|161526284|ref|YP_001581296.1| organic radical activating enzyme-like protein [Burkholderia
           multivorans ATCC 17616]
 gi|189349002|ref|YP_001944630.1| hypothetical protein BMULJ_00116 [Burkholderia multivorans ATCC
           17616]
 gi|160343713|gb|ABX16799.1| organic radical activating enzyme-like protein [Burkholderia
           multivorans ATCC 17616]
 gi|189333024|dbj|BAG42094.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
          Length = 210

 Score =  274 bits (700), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 119/210 (56%), Positives = 148/210 (70%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAQAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ + D L   I   W  GE   R+ V TGGEP+LQ+D PL+ AL+  GF IA+ETNG
Sbjct: 61  GGKFKDADALVATIAGLWPAGEA-HRFVVCTGGEPMLQLDQPLVDALHAAGFGIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDWICVSPKA   L +  G ELK+V PQ N    +Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLESIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RDLNTKLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|325518103|gb|EGC97893.1| organic radical activating enzyme-like protein [Burkholderia sp.
           TJI49]
          Length = 210

 Score =  274 bits (700), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 120/210 (57%), Positives = 149/210 (70%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ + D L   I   W  GE   R+ V TGGEP+LQ+D PL+ AL+  GFEIA+ETNG
Sbjct: 61  GGKFKDADALVATIAGLWPDGEA-HRFVVCTGGEPMLQLDQPLVDALHAAGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDWICVSPKA   L +  G ELK+V PQ N    +Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLESIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RDLNTKLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|221214677|ref|ZP_03587647.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|221165567|gb|EED98043.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
          Length = 210

 Score =  273 bits (699), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 120/210 (57%), Positives = 149/210 (70%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAQAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ + D L   I   W  GE   R+ V TGGEP+LQ+D PL+ AL+  GFEIA+ETNG
Sbjct: 61  GGKFKDADALVATIAGLWPDGEA-HRFVVCTGGEPMLQLDQPLVDALHAAGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDWICVSPKA   L +  G ELK+V PQ N    +Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLESIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RDLNTKLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|186474815|ref|YP_001856285.1| radical SAM domain-containing protein [Burkholderia phymatum
           STM815]
 gi|184191274|gb|ACC69239.1| Radical SAM domain protein [Burkholderia phymatum STM815]
          Length = 210

 Score =  273 bits (699), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 118/210 (56%), Positives = 151/210 (71%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A C+FCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRADAVCKFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++   ++LA  I   W  GE + R+ V TGGEP+LQ+D PL+ AL+ +GFEIA+ETNG
Sbjct: 61  GGKFRTPEELAAKIASLWPEGEDQ-RFVVCTGGEPMLQIDQPLVDALHAQGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++     IDWICVSPKAG  L    G ELK+V PQ N    +Y   +F+ F +QPMDGP 
Sbjct: 120 SLPVLDTIDWICVSPKAGAPLVQTKGNELKVVVPQDNQRLADYAKLEFDYFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RDINTKLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|193222302|emb|CAL61551.2| Conserved hypothetical protein [Herminiimonas arsenicoxydans]
          Length = 211

 Score =  273 bits (699), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 123/210 (58%), Positives = 149/210 (70%), Gaps = 1/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YSIKEIF TLQGEG HAGR AVFCRFSGCNLW+GRE DR +A C+FCDTDFVG  G  
Sbjct: 1   MTYSIKEIFYTLQGEGAHAGRPAVFCRFSGCNLWTGRESDRATAVCQFCDTDFVGTDGEG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ +  +LA+ I   W       +Y V TGGEPLLQ+D  LI A++  GFEIA+ETNG
Sbjct: 61  GGKFADAVKLANTINALWPASYAASKYVVFTGGEPLLQLDTELINAMHAVGFEIAIETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P G+DWICVSPK G  L ++ G ELK+V PQ+  S   Y   DF+ F +QPMDGP 
Sbjct: 121 TLPVPAGVDWICVSPKMGSQLVVRKGSELKVVIPQLAQSLAAYEDLDFQHFFVQPMDGPL 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E+NT LAI  C +NPKW+LS+QTHK + I
Sbjct: 181 AEQNTRLAIEICKKNPKWKLSLQTHKLLQI 210


>gi|312797586|ref|YP_004030508.1| Queuosine biosynthesis protein QueE [Burkholderia rhizoxinica HKI
           454]
 gi|312169361|emb|CBW76364.1| Queuosine biosynthesis protein QueE [Burkholderia rhizoxinica HKI
           454]
          Length = 263

 Score =  273 bits (698), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 122/212 (57%), Positives = 148/212 (69%), Gaps = 3/212 (1%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGREQDR  A CRFCDTDFVG  G  
Sbjct: 51  MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREQDRADAVCRFCDTDFVGTDGEN 110

Query: 62  GGRY-NVDQLADLIEEQWITGEK--EGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVET 118
           GG+Y + D L   I   W  GE   + R+ V TGGEP+LQ+D  LI AL++  F IAVET
Sbjct: 111 GGKYRDADALVAKIASLWPPGEAAAQYRFVVCTGGEPMLQLDAALIDALHRERFVIAVET 170

Query: 119 NGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDG 178
           NGT+    GIDW+CVSPKAG  + +  G ELK+V PQ N     Y   DFE F +QPMDG
Sbjct: 171 NGTLPVLPGIDWVCVSPKAGSSIVVTRGNELKVVIPQDNQPLSEYARLDFEHFLVQPMDG 230

Query: 179 PFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           P  E NT LA+ +C ++P+WRLS+QTHK++ I
Sbjct: 231 PSRELNTKLAVDWCKRHPQWRLSMQTHKYLNI 262


>gi|192289792|ref|YP_001990397.1| hypothetical protein Rpal_1382 [Rhodopseudomonas palustris TIE-1]
 gi|192283541|gb|ACE99921.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 210

 Score =  273 bits (698), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 139/211 (65%), Positives = 167/211 (79%), Gaps = 2/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIFLTLQGEG HAGR AVFCRF+GCNLW+GREQDR  A C+FCDTDF+G  GT 
Sbjct: 1   MSYAVKEIFLTLQGEGAHAGRAAVFCRFAGCNLWTGREQDRDQATCKFCDTDFIGTDGTL 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GGRY + + LAD I EQW+ G+   RY V+TGGEPLLQ+D  LI AL+ RGF I VETNG
Sbjct: 61  GGRYASAEHLADTIAEQWV-GDARDRYVVITGGEPLLQLDGELITALHARGFAIGVETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TIEPP GIDW+CVSPKAG +L+I+ G ELKLV+PQ +  PE +   +FERFSLQPMDGP 
Sbjct: 120 TIEPPAGIDWLCVSPKAGAELRIRRGDELKLVYPQPDAMPEEFAALEFERFSLQPMDGPD 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            ++NT  AI+YC ++P+WRLS+QTHK  GIR
Sbjct: 180 RDDNTTRAIAYCLKHPQWRLSLQTHKITGIR 210


>gi|115353224|ref|YP_775063.1| organic radical activating enzyme-like protein [Burkholderia
           ambifaria AMMD]
 gi|170703437|ref|ZP_02894209.1| organic radical activating enzyme-like protein [Burkholderia
           ambifaria IOP40-10]
 gi|171319449|ref|ZP_02908554.1| organic radical activating enzyme-like protein [Burkholderia
           ambifaria MEX-5]
 gi|172062096|ref|YP_001809748.1| organic radical activating enzyme-like protein [Burkholderia
           ambifaria MC40-6]
 gi|115283212|gb|ABI88729.1| organic radical activating enzyme-like protein [Burkholderia
           ambifaria AMMD]
 gi|170131652|gb|EDT00208.1| organic radical activating enzyme-like protein [Burkholderia
           ambifaria IOP40-10]
 gi|171095341|gb|EDT40322.1| organic radical activating enzyme-like protein [Burkholderia
           ambifaria MEX-5]
 gi|171994613|gb|ACB65532.1| organic radical activating enzyme-like protein [Burkholderia
           ambifaria MC40-6]
          Length = 210

 Score =  272 bits (697), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 119/210 (56%), Positives = 149/210 (70%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ + + L   I   W  GE   R+ V TGGEP+LQ+D PL+ AL+  GFEIA+ETNG
Sbjct: 61  GGKFKDAEALVATIAGLWPDGEA-HRFVVCTGGEPMLQLDQPLVDALHAAGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDWICVSPKA   L +  G ELK+V PQ N    +Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLETIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RDLNTKLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|148261740|ref|YP_001235867.1| organic radical activating-like protein [Acidiphilium cryptum JF-5]
 gi|146403421|gb|ABQ31948.1| Organic radical activating enzymes-like protein [Acidiphilium
           cryptum JF-5]
          Length = 211

 Score =  272 bits (697), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 130/210 (61%), Positives = 153/210 (72%), Gaps = 1/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR SA CRFCDTDFVG  G  
Sbjct: 1   MAYSVKEIFPTLQGEGRNAGRAAVFCRFAGCNLWSGREEDRASATCRFCDTDFVGTDGPG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GGR+ +   LA  I+  W          V TGGEPLLQ+D PLI+A++  GFEIAVETNG
Sbjct: 61  GGRFADAAGLARAIQAAWSAACTRDALVVFTGGEPLLQLDAPLIEAVHDAGFEIAVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TIEPP GIDW+CVSPK G +L ++ G ELKLV+PQ   +PE + G DF  F LQPMDGP 
Sbjct: 121 TIEPPPGIDWLCVSPKEGAELVVRQGSELKLVYPQKEATPERFAGLDFAHFLLQPMDGPD 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              NT  AI YC  +P+WRLS+QTHK++GI
Sbjct: 181 RAANTRAAIEYCLTHPQWRLSMQTHKYLGI 210


>gi|323524432|ref|YP_004226585.1| Radical SAM domain-containing protein [Burkholderia sp. CCGE1001]
 gi|323381434|gb|ADX53525.1| Radical SAM domain protein [Burkholderia sp. CCGE1001]
          Length = 210

 Score =  272 bits (697), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 121/210 (57%), Positives = 152/210 (72%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG+Y   ++L  +I  QW  GE + R+ V TGGEP+LQ+D PL+ AL+  GFEIA+ETNG
Sbjct: 61  GGKYRTPEELVQMIASQWPEGEGQ-RFVVCTGGEPMLQIDAPLVDALHAAGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDWICVSPKA   L +  G ELK+V PQ N    +Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLETIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLSDYAKLDFEYFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RDINTRLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|107024049|ref|YP_622376.1| organic radical activating enzymes-like [Burkholderia cenocepacia
           AU 1054]
 gi|116691136|ref|YP_836759.1| organic radical activating enzymes-like protein [Burkholderia
           cenocepacia HI2424]
 gi|170734467|ref|YP_001766414.1| organic radical activating enzyme-like protein [Burkholderia
           cenocepacia MC0-3]
 gi|105894238|gb|ABF77403.1| organic radical activating enzymes-like protein [Burkholderia
           cenocepacia AU 1054]
 gi|116649225|gb|ABK09866.1| organic radical activating enzymes-like protein [Burkholderia
           cenocepacia HI2424]
 gi|169817709|gb|ACA92292.1| organic radical activating enzyme-like protein [Burkholderia
           cenocepacia MC0-3]
          Length = 210

 Score =  272 bits (697), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 119/210 (56%), Positives = 148/210 (70%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ +   L   I   W  GE   R+ V TGGEP+LQ+D PL+ AL+  GFEIA+ETNG
Sbjct: 61  GGKFKDAAALVATIAGLWPEGEAN-RFVVCTGGEPMLQLDQPLVDALHAAGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDWICVSPKA   L +  G ELK+V PQ N    +Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLESIDWICVSPKADAPLVVTKGNELKVVVPQDNQRLADYAKLDFEYFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RDLNTKLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|167561072|ref|ZP_02353988.1| hypothetical protein BoklE_00844 [Burkholderia oklahomensis EO147]
          Length = 210

 Score =  272 bits (697), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 118/210 (56%), Positives = 148/210 (70%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYTVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRDGAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ + + LA  I   W  GE   R+ V TGGEP+LQ+D  L+ AL+  GF IA+ETNG
Sbjct: 61  GGKFKDAESLAAQIASLWPEGEA-HRFVVCTGGEPMLQLDQALVDALHAAGFTIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDW+CVSPKA   L +  G ELK+V PQ N    +Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLESIDWVCVSPKADAPLVVTKGNELKVVVPQDNQRLADYAKLDFEHFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++PKWRLS+QTHK++ I
Sbjct: 180 RDFNTKLAIDWCKRHPKWRLSMQTHKYLNI 209


>gi|206558876|ref|YP_002229636.1| hypothetical protein BCAL0474 [Burkholderia cenocepacia J2315]
 gi|198034913|emb|CAR50785.1| conserved hypothetical protein [Burkholderia cenocepacia J2315]
          Length = 210

 Score =  272 bits (696), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 119/210 (56%), Positives = 148/210 (70%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ +   L   I   W  GE   R+ V TGGEP+LQ+D PL+ AL+  GFEIA+ETNG
Sbjct: 61  GGKFKDAAALVATIAGLWPEGEA-HRFVVCTGGEPMLQLDQPLVDALHAAGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDWICVSPKA   L +  G ELK+V PQ N    +Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLESIDWICVSPKADAPLVVTKGNELKVVVPQDNQRLADYAKLDFEYFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RDLNTKLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|78067938|ref|YP_370707.1| organic radical activating-like protein [Burkholderia sp. 383]
 gi|77968683|gb|ABB10063.1| Organic radical activating enzymes-like protein [Burkholderia sp.
           383]
          Length = 210

 Score =  272 bits (696), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 118/210 (56%), Positives = 149/210 (70%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ + + L   I   W  GE   R+ V TGGEP+LQ+D PL+ AL+  GFEIA+ETNG
Sbjct: 61  GGKFKDAEALVATIAGLWPEGEA-HRFVVCTGGEPMLQLDQPLVDALHAAGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDWICVSPKA   L +  G ELK+V PQ N    +Y   DFE + +QPMDGP 
Sbjct: 120 SLPVLESIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYYLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RDLNTKLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|300691566|ref|YP_003752561.1| hypothetical protein RPSI07_1920 [Ralstonia solanacearum PSI07]
 gi|299078626|emb|CBJ51283.1| conserved protein of unknown function (Organic radical activating
           enzymes) [Ralstonia solanacearum PSI07]
          Length = 212

 Score =  272 bits (695), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 123/212 (58%), Positives = 148/212 (69%), Gaps = 2/212 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG + GR AVFCRF+GCNLWSGRE DR +A C+FCDTDFVG  GT+
Sbjct: 1   MTYAVKEIFYTLQGEGANTGRAAVFCRFAGCNLWSGREADRATAICQFCDTDFVGTDGTQ 60

Query: 62  GGRY-NVDQLADLIEEQWIT-GEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
           GG+Y   D LAD +  QW           V TGGEPLLQ+D PLI AL+ RGFEIA+ETN
Sbjct: 61  GGKYPTADALADTVVAQWPADATGGQPLVVCTGGEPLLQLDRPLIDALHARGFEIAIETN 120

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGP 179
           GT+  P GIDW+CVSPK G +L +  G ELK+V PQ +   + Y   DF  F LQPMDGP
Sbjct: 121 GTLAVPDGIDWVCVSPKMGAELVVTRGDELKVVIPQQDQDLDAYERLDFRHFFLQPMDGP 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              +NT LA+  C + P+W LS+QTHK +GIR
Sbjct: 181 LARQNTALAVDLCQRRPRWHLSLQTHKMLGIR 212


>gi|326405234|ref|YP_004285316.1| hypothetical protein ACMV_30870 [Acidiphilium multivorum AIU301]
 gi|325052096|dbj|BAJ82434.1| hypothetical protein ACMV_30870 [Acidiphilium multivorum AIU301]
          Length = 211

 Score =  272 bits (695), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 130/210 (61%), Positives = 152/210 (72%), Gaps = 1/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR SA CRFCDTDFVG  G  
Sbjct: 1   MAYSVKEIFPTLQGEGRNAGRAAVFCRFAGCNLWSGREEDRASATCRFCDTDFVGTDGPG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GGR+ +   LA  I+  W          V TGGEPLLQ+D PLI+A++  GFEIAVETNG
Sbjct: 61  GGRFADAAGLARAIQAAWPAACTRDALVVFTGGEPLLQLDAPLIEAVHDAGFEIAVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TIEPP GIDW+CVSPK G +L ++ G ELKLV+PQ   +PE + G DF  F LQPMDGP 
Sbjct: 121 TIEPPPGIDWLCVSPKEGAELVVRQGSELKLVYPQKEATPERFAGLDFAHFLLQPMDGPD 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              NT  AI YC  +P+WRLS QTHK++GI
Sbjct: 181 RAANTRAAIEYCLTHPQWRLSTQTHKYLGI 210


>gi|134297293|ref|YP_001121028.1| organic radical activating enzyme-like protein [Burkholderia
           vietnamiensis G4]
 gi|134140450|gb|ABO56193.1| organic radical activating enzyme-like protein [Burkholderia
           vietnamiensis G4]
          Length = 210

 Score =  272 bits (695), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 119/210 (56%), Positives = 147/210 (70%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRADAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ +   L   I   W  GE   R+ V TGGEP+LQ+D PL+ AL+  GFEIA+ETNG
Sbjct: 61  GGKFKDAAALVATIAGLWPHGEA-HRFVVCTGGEPMLQIDQPLVDALHAAGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++     IDWICVSPKA   L +  G ELK+V PQ N    +Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLDTIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RDINTKLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|167568301|ref|ZP_02361175.1| hypothetical protein BoklC_00570 [Burkholderia oklahomensis C6786]
          Length = 210

 Score =  271 bits (694), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 118/210 (56%), Positives = 148/210 (70%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYTVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRDGAVCRFCDTDFVGADGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ + + LA  I   W  GE   R+ V TGGEP+LQ+D  L+ AL+  GF IA+ETNG
Sbjct: 61  GGKFKDAESLAAQIASLWPEGEA-HRFVVCTGGEPMLQLDQALVDALHAAGFTIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDW+CVSPKA   L +  G ELK+V PQ N    +Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLESIDWVCVSPKADAPLVVTKGNELKVVVPQDNQRLADYAKLDFEHFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++PKWRLS+QTHK++ I
Sbjct: 180 RDFNTKLAIDWCKRHPKWRLSMQTHKYLNI 209


>gi|170694006|ref|ZP_02885162.1| conserved hypothetical protein [Burkholderia graminis C4D1M]
 gi|170141078|gb|EDT09250.1| conserved hypothetical protein [Burkholderia graminis C4D1M]
          Length = 210

 Score =  271 bits (694), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 120/210 (57%), Positives = 150/210 (71%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRADAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG+Y     L  +I  QW  GE + R+ V TGGEP+LQ+D PL+ AL+  GFEIA+ETNG
Sbjct: 61  GGKYRTAADLVQMIASQWPEGEGQ-RFVVCTGGEPMLQIDQPLVDALHAAGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDWICVSPKA   L +  G ELK+V PQ N    +Y   DF+ F +QPMDGP 
Sbjct: 120 SLPVLETIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLSDYAKLDFDYFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RDINTRLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|134094603|ref|YP_001099678.1| hypothetical protein HEAR1379 [Herminiimonas arsenicoxydans]
          Length = 248

 Score =  271 bits (694), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 123/209 (58%), Positives = 149/209 (71%), Gaps = 1/209 (0%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            YSIKEIF TLQGEG HAGR AVFCRFSGCNLW+GRE DR +A C+FCDTDFVG  G  G
Sbjct: 39  TYSIKEIFYTLQGEGAHAGRPAVFCRFSGCNLWTGRESDRATAVCQFCDTDFVGTDGEGG 98

Query: 63  GRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G++ +  +LA+ I   W       +Y V TGGEPLLQ+D  LI A++  GFEIA+ETNGT
Sbjct: 99  GKFADAVKLANTINALWPASYAASKYVVFTGGEPLLQLDTELINAMHAVGFEIAIETNGT 158

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           +  P G+DWICVSPK G  L ++ G ELK+V PQ+  S   Y   DF+ F +QPMDGP  
Sbjct: 159 LPVPAGVDWICVSPKMGSQLVVRKGSELKVVIPQLAQSLAAYEDLDFQHFFVQPMDGPLA 218

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           E+NT LAI  C +NPKW+LS+QTHK + I
Sbjct: 219 EQNTRLAIEICKKNPKWKLSLQTHKLLQI 247


>gi|39934265|ref|NP_946541.1| hypothetical protein RPA1190 [Rhodopseudomonas palustris CGA009]
 gi|39648113|emb|CAE26633.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 210

 Score =  271 bits (694), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 139/211 (65%), Positives = 167/211 (79%), Gaps = 2/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIFLTLQGEG HAGR AVFCRF+GCNLW+GREQDR  A C+FCDTDF+G  GT 
Sbjct: 1   MSYAVKEIFLTLQGEGAHAGRAAVFCRFAGCNLWTGREQDRDQATCKFCDTDFIGTDGTL 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GGRY + + LAD I EQW+ G+   RY V+TGGEPLLQ+D  LI AL+ RGF I VETNG
Sbjct: 61  GGRYASAEHLADTIAEQWV-GDARDRYVVITGGEPLLQLDGELITALHARGFAIGVETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TIEPP GIDW+CVSPKAG +L+I+ G ELKLV+PQ +  PE +   +FERFSLQPMDGP 
Sbjct: 120 TIEPPVGIDWLCVSPKAGAELRIRRGDELKLVYPQPDAMPEEFAALEFERFSLQPMDGPE 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            ++NT  AI+YC ++P+WRLS+QTHK  GIR
Sbjct: 180 RDDNTTRAIAYCLKHPQWRLSLQTHKITGIR 210


>gi|17546168|ref|NP_519570.1| hypothetical protein RSc1449 [Ralstonia solanacearum GMI1000]
 gi|17428464|emb|CAD15151.1| probable organic radical activating enzyme protein [Ralstonia
           solanacearum GMI1000]
          Length = 212

 Score =  271 bits (694), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 125/212 (58%), Positives = 147/212 (69%), Gaps = 2/212 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG + GR AVFCRF+GCNLWSGRE DR +A C+FCDTDFVG  GT 
Sbjct: 1   MTYAVKEIFYTLQGEGANTGRAAVFCRFAGCNLWSGREADRAAAICQFCDTDFVGTDGTL 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGR-YCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
           GG+Y   D LAD +  QW      GR   V TGGEPLLQ+D PLI AL+ RGFEIA+ETN
Sbjct: 61  GGKYPTADALADTVAAQWPAAATGGRPLVVCTGGEPLLQLDRPLIDALHARGFEIAIETN 120

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGP 179
           GT+  P GIDW+CVSPK G +L +  G ELK+V PQ     + Y   DF  F LQPMDGP
Sbjct: 121 GTLAVPDGIDWVCVSPKMGAELVVTRGDELKVVIPQPGQDLDAYERLDFRHFFLQPMDGP 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
               NT LA+  C + P+W LS+QTHK +GIR
Sbjct: 181 LARRNTALAVELCQRRPRWHLSLQTHKMLGIR 212


>gi|154253588|ref|YP_001414412.1| hypothetical protein Plav_3149 [Parvibaculum lavamentivorans DS-1]
 gi|154157538|gb|ABS64755.1| conserved hypothetical protein [Parvibaculum lavamentivorans DS-1]
          Length = 210

 Score =  271 bits (693), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 135/209 (64%), Positives = 155/209 (74%), Gaps = 1/209 (0%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +YS+KEIF TLQGEG +AGR +VFCRFSGCNLWSGRE+DR  A C FCDTDFVG  G  G
Sbjct: 1   MYSVKEIFYTLQGEGANAGRPSVFCRFSGCNLWSGREEDRADAVCTFCDTDFVGTNGEGG 60

Query: 63  GRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G++ +V  LAD IE+ W +G    R+ V TGGEPLLQ+D PLI AL+ RGFEIAVETNGT
Sbjct: 61  GKFRDVAALADAIEKTWESGAAHNRFVVCTGGEPLLQLDAPLIAALHSRGFEIAVETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           I  P+GIDWICVSPKA  +LK   G ELKLV+PQ    PE +   DF  F LQPMDG   
Sbjct: 121 IVAPEGIDWICVSPKADAELKQTSGHELKLVYPQHKAQPERFEQLDFRYFYLQPMDGADA 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           EENT  A +YC  +PKWRLS+QTHK IGI
Sbjct: 181 EENTRAATAYCLAHPKWRLSLQTHKLIGI 209


>gi|16127389|ref|NP_421953.1| hypothetical protein CC_3159 [Caulobacter crescentus CB15]
 gi|221236197|ref|YP_002518634.1| queuosine biosynthesis protein QueE [Caulobacter crescentus NA1000]
 gi|13424829|gb|AAK25121.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220965370|gb|ACL96726.1| queuosine biosynthesis protein QueE [Caulobacter crescentus NA1000]
          Length = 210

 Score =  271 bits (693), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 128/208 (61%), Positives = 147/208 (70%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIFLTLQGEGG AG+ AVFCRFSGCNLWSGREQDR  A C FCDTDFVG  G  
Sbjct: 1   MTYSVKEIFLTLQGEGGQAGKAAVFCRFSGCNLWSGREQDRAKAVCTFCDTDFVGTDGEN 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GG++   +      E   TG  + R  V TGGEP LQ+D   I AL+ RGF+IAVETNGT
Sbjct: 61  GGKFATAEDLAAAVEAQWTGGPDDRLVVCTGGEPFLQLDDAAIAALHARGFQIAVETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           I  P G+DWICVSPKA   +    GQELKLVFPQ    PE +   DFERF LQPMDGP  
Sbjct: 121 ITAPAGVDWICVSPKADAPVVQTSGQELKLVFPQEKAMPERFAALDFERFYLQPMDGPDR 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIG 209
           + NT LA++YC  +P+WRLSVQTHK++G
Sbjct: 181 DANTQLAVAYCLSHPQWRLSVQTHKYLG 208


>gi|299134645|ref|ZP_07027837.1| Radical SAM domain protein [Afipia sp. 1NLS2]
 gi|298590455|gb|EFI50658.1| Radical SAM domain protein [Afipia sp. 1NLS2]
          Length = 210

 Score =  271 bits (693), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 135/211 (63%), Positives = 156/211 (73%), Gaps = 2/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIFLTLQGEG  AGR AVFCRF+GCNLWSGREQDR  A C+FCDTDFVG  GT 
Sbjct: 1   MSYAVKEIFLTLQGEGMQAGRPAVFCRFAGCNLWSGREQDRAEAVCQFCDTDFVGTDGTL 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GGRY   D LA+ I   W       R+ VLTGGEP+LQ+D  LI AL+ RGF IAVETNG
Sbjct: 61  GGRYATADDLAERIAATWGPDS-RHRFVVLTGGEPMLQIDDALIAALHARGFMIAVETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P G+DWICVSPKA  +L I+ G ELKLV+PQ   +PE+Y    F+ F LQPMDGP 
Sbjct: 120 TLPAPPGLDWICVSPKADTELAIRQGHELKLVYPQRQNAPEDYTALAFQHFLLQPMDGPD 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           LE+NT  AI YC ++P+WRLSVQTHK IGIR
Sbjct: 180 LEQNTARAIDYCLRHPQWRLSVQTHKTIGIR 210


>gi|85714274|ref|ZP_01045262.1| hypothetical protein NB311A_15022 [Nitrobacter sp. Nb-311A]
 gi|85698721|gb|EAQ36590.1| hypothetical protein NB311A_15022 [Nitrobacter sp. Nb-311A]
          Length = 210

 Score =  271 bits (693), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 136/210 (64%), Positives = 154/210 (73%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y+IKE+FLTLQGEG HAGR AVFCRFSGCNLWSGRE+DR SA C FCDTDFVG  GT 
Sbjct: 1   MSYAIKEVFLTLQGEGAHAGRAAVFCRFSGCNLWSGREKDRASATCAFCDTDFVGTDGTL 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGRY+              G    RY VLTGGEPLLQVD   I AL+ R FEI +ETNGT
Sbjct: 61  GGRYDTADALAETVAAQWIGPAAHRYAVLTGGEPLLQVDKAFIDALHARRFEIGIETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           I PP GIDW+CVSPKAG DL++  G ELKLV+PQ N+ PE++    FERFSLQPMDGP  
Sbjct: 121 IVPPDGIDWLCVSPKAGADLRVTKGHELKLVYPQENIRPEDFKDLAFERFSLQPMDGPDA 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            +NT  AI YC ++P+WRLS+QTHK IGIR
Sbjct: 181 ADNTARAIDYCLRHPQWRLSLQTHKTIGIR 210


>gi|300311525|ref|YP_003775617.1| organic radical activating enzyme protein [Herbaspirillum
           seropedicae SmR1]
 gi|300074310|gb|ADJ63709.1| organic radical activating enzyme protein [Herbaspirillum
           seropedicae SmR1]
          Length = 229

 Score =  271 bits (692), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 122/209 (58%), Positives = 148/209 (70%), Gaps = 1/209 (0%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            YSIKEIF TLQGEG HAGR AVFCRFSGCNLW+GRE+DR+ A C+FCDTDFVG  G  G
Sbjct: 20  TYSIKEIFYTLQGEGAHAGRPAVFCRFSGCNLWTGREEDRVRAICQFCDTDFVGTDGENG 79

Query: 63  GRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G++ +  +LA  I+  W       +Y V TGGEPLLQ+D  LI+A++  GFEIA+ETNGT
Sbjct: 80  GKFKSPAELAAKIDSLWPARYAPSKYVVFTGGEPLLQLDAALIEAMHAVGFEIAIETNGT 139

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           I+ P G+DWICVSPK G +LK++ G ELK+V PQ     + Y   DF+ F LQPMDG   
Sbjct: 140 IDVPDGVDWICVSPKMGSELKVRRGSELKVVVPQPGQPLDEYEKLDFQHFLLQPMDGLQA 199

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             NT LAI     NPKW+LS+QTHK + I
Sbjct: 200 AANTRLAIEMVKNNPKWKLSIQTHKLLNI 228


>gi|187922325|ref|YP_001893967.1| radical SAM protein [Burkholderia phytofirmans PsJN]
 gi|187713519|gb|ACD14743.1| Radical SAM domain protein [Burkholderia phytofirmans PsJN]
          Length = 210

 Score =  271 bits (692), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 122/210 (58%), Positives = 149/210 (70%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           G +Y   D L  +I  QW  GE E R+ V TGGEP+LQ+D PL+ AL+  GFEIA+ETNG
Sbjct: 61  GDKYRTADDLVKMIAAQWPEGEGE-RFVVCTGGEPMLQIDQPLVDALHAAGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDWICVSPKA   L +  G ELK+V PQ N     Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLETIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLSEYAKLDFEYFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RDLNTRLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|330818676|ref|YP_004362381.1| hypothetical protein bgla_1g38230 [Burkholderia gladioli BSR3]
 gi|327371069|gb|AEA62425.1| hypothetical protein bgla_1g38230 [Burkholderia gladioli BSR3]
          Length = 210

 Score =  270 bits (691), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 118/210 (56%), Positives = 152/210 (72%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLW+GRE DR +A CRFCDTDFVG  G  
Sbjct: 1   MTYTVKEIFYTLQGEGANAGRPAVFCRFAGCNLWTGREADRETAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++   +QLA ++   W  GE   R+ V TGGEP+LQ+D PL+ AL+ +GFEIA+ETNG
Sbjct: 61  GGKFKTPEQLAAMVASLWPEGEAN-RFVVCTGGEPMLQLDQPLVDALHAQGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDWICVSPKA   L +  G ELK+V PQ N    +Y   DF+ F +QPMDGP 
Sbjct: 120 SLPVLETIDWICVSPKADAPLVVTKGHELKVVVPQDNQRLADYARLDFDYFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RDINTKLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|307728151|ref|YP_003905375.1| Radical SAM domain-containing protein [Burkholderia sp. CCGE1003]
 gi|307582686|gb|ADN56084.1| Radical SAM domain protein [Burkholderia sp. CCGE1003]
          Length = 210

 Score =  270 bits (691), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 120/210 (57%), Positives = 153/210 (72%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG+Y + ++L  +I  QW  GE + R+ V TGGEP+LQ+D PL+ AL+  GFEIA+ETNG
Sbjct: 61  GGKYRSAEELVRMIASQWPQGEGQ-RFVVCTGGEPMLQIDQPLVDALHAAGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDWICVSPKA   L +  G ELK+V PQ N    +Y   DF+ F +QPMDGP 
Sbjct: 120 SLPVLETIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLSDYAKLDFQYFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RDINTRLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|302383449|ref|YP_003819272.1| hypothetical protein Bresu_2339 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194077|gb|ADL01649.1| conserved hypothetical protein [Brevundimonas subvibrioides ATCC
           15264]
          Length = 211

 Score =  270 bits (691), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 128/211 (60%), Positives = 152/211 (72%), Gaps = 1/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KE FLT+QGEGG AGR AVF RF+GCNLWSGREQDR  A C FCDT+FVG  G  
Sbjct: 1   MTYSVKETFLTVQGEGGQAGRPAVFLRFAGCNLWSGREQDRAKAVCSFCDTEFVGTDGDG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ +   L+D +   WI  + + +  V TGGEPLLQ+D PLI+AL+ RGF+IAVETNG
Sbjct: 61  GGKFADAGVLSDHVASMWIGRDGDPKLVVCTGGEPLLQLDAPLIEALHARGFDIAVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P GIDW+CVSPKA   +    GQELKLVFPQ    P  +   DFERF LQPMDGP 
Sbjct: 121 TLAAPTGIDWVCVSPKAAAPVVQTSGQELKLVFPQALAMPHRFEALDFERFWLQPMDGPD 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              NT  A+ YC +NPKWRLSVQTHK+IG+R
Sbjct: 181 QAANTAAALDYCLKNPKWRLSVQTHKYIGVR 211


>gi|86748323|ref|YP_484819.1| hypothetical protein RPB_1198 [Rhodopseudomonas palustris HaA2]
 gi|86571351|gb|ABD05908.1| Radical SAM [Rhodopseudomonas palustris HaA2]
          Length = 210

 Score =  270 bits (690), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 138/211 (65%), Positives = 166/211 (78%), Gaps = 2/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIFLTLQGEG HAGR +VFCRF+GCNLW+GREQDR  A C+FCDTDFVG  GT 
Sbjct: 1   MSYAVKEIFLTLQGEGAHAGRASVFCRFAGCNLWTGREQDRHDAVCQFCDTDFVGTDGTL 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GGRY +  +LAD I  QW+  +   RY V+TGGEPLLQ+D  LI AL+K+GFE+ VETNG
Sbjct: 61  GGRYGDAGKLADTIAAQWVGAD-TDRYVVITGGEPLLQLDAELIDALHKQGFEVGVETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TIEPP GIDW+CVSPKAG  ++++ G ELKLV+PQ +  PE +   DFERFSLQPMDGP 
Sbjct: 120 TIEPPAGIDWLCVSPKAGTQIRVQCGNELKLVYPQPDAMPEQFTSLDFERFSLQPMDGPD 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            ++NT  AI YC ++P+WRLSVQTHK IGIR
Sbjct: 180 RDDNTRRAIDYCLRHPQWRLSVQTHKVIGIR 210


>gi|27377594|ref|NP_769123.1| hypothetical protein bll2483 [Bradyrhizobium japonicum USDA 110]
 gi|27350739|dbj|BAC47748.1| bll2483 [Bradyrhizobium japonicum USDA 110]
          Length = 210

 Score =  270 bits (690), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 140/211 (66%), Positives = 161/211 (76%), Gaps = 2/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIFLTLQGEG HAGR +VFCRF+GCNLWSGRE DR  A C+FCDTDFVG  GT 
Sbjct: 1   MSYAVKEIFLTLQGEGAHAGRASVFCRFAGCNLWSGREADRQDATCKFCDTDFVGTDGTL 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GGRY +  +LAD I  QW T   + RY VLTGGEPLLQVD  LI AL+ RGFEI VETNG
Sbjct: 61  GGRYASAVELADTIAAQW-TASNDNRYVVLTGGEPLLQVDDALIDALHARGFEIGVETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TI  P G+DWICVSPK G +L ++ G ELKLV+PQ   +PE + G  FERFSLQPMDGP 
Sbjct: 120 TIAAPDGLDWICVSPKGGSELVLRRGHELKLVYPQALAAPETFEGLAFERFSLQPMDGPE 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           + ENT  AI YC ++P+WRLSVQTHK +GIR
Sbjct: 180 VAENTARAIDYCLRHPQWRLSVQTHKSLGIR 210


>gi|91781440|ref|YP_556646.1| hypothetical protein Bxe_A4406 [Burkholderia xenovorans LB400]
 gi|91685394|gb|ABE28594.1| Conserved hypothetical protein [Burkholderia xenovorans LB400]
          Length = 210

 Score =  270 bits (690), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 123/210 (58%), Positives = 150/210 (71%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG+Y   + L  +I  QW  GE E R+ V TGGEP+LQ+D PL+ AL+  GFEIA+ETNG
Sbjct: 61  GGKYRTAEDLVRMIASQWPQGEGE-RFVVCTGGEPMLQIDQPLVDALHAAGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDWICVSPKA   L +  G ELK+V PQ N     Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLETIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLSEYAKLDFEYFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 REINTRLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|194289720|ref|YP_002005627.1| hypothetical protein RALTA_A1615 [Cupriavidus taiwanensis LMG
           19424]
 gi|193223555|emb|CAQ69560.1| conserved hypothetical protein, NrdG domain (Organic radical
           activating enzymes) [Cupriavidus taiwanensis LMG 19424]
          Length = 211

 Score =  269 bits (689), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 122/211 (57%), Positives = 151/211 (71%), Gaps = 1/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR SA C+FCDTDFVG  GT+
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRAAVFCRFAGCNLWSGREEDRASAVCQFCDTDFVGTDGTR 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG+Y    +LA ++  +W  G       V TGGEPLLQ+D PLI+AL+  GFEIA+ETNG
Sbjct: 61  GGKYRTAAELAAVVASEWPQGAGGKPLVVCTGGEPLLQLDAPLIEALHAHGFEIAIETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TI  P GIDW+CVSPK G +L +  G ELK+V PQ       Y   DF  F +Q MDGP 
Sbjct: 121 TIAVPPGIDWVCVSPKMGSELVVTRGDELKVVIPQDGQDFAAYEKLDFRHFLVQAMDGPL 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             ENT  A+++C ++P+WRLS+QTHK +GIR
Sbjct: 181 ARENTAAAVAFCQRHPRWRLSLQTHKLLGIR 211


>gi|284028807|ref|YP_003378738.1| hypothetical protein Kfla_0827 [Kribbella flavida DSM 17836]
 gi|283808100|gb|ADB29939.1| conserved hypothetical protein [Kribbella flavida DSM 17836]
          Length = 211

 Score =  269 bits (689), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 116/210 (55%), Positives = 149/210 (70%), Gaps = 1/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y +KEIF TLQGEG HAGR AVFCRF+ CNLW+GRE+DR  A C FCDTDFVG  G  
Sbjct: 1   MSYKVKEIFYTLQGEGSHAGRPAVFCRFASCNLWTGREKDRARAICSFCDTDFVGTDGPG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ + + LA  +E+ W     + R  V TGGEPLLQ+D   + AL++RGF +AVETNG
Sbjct: 61  GGKFASAEDLARAVEDAWPHDGHDQRMVVCTGGEPLLQLDADAVSALHERGFYVAVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T  PPQG+DW+CVSPK G +L +  G ELKLV+PQ    P  +   +FE F LQPMD P 
Sbjct: 121 TQIPPQGLDWLCVSPKIGAELIVTSGDELKLVYPQAGGDPAQFEHLEFEHFRLQPMDSPD 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            ++NT  A+ YC ++P+W+LS+QTHK++GI
Sbjct: 181 RQQNTAAAVEYCLKHPRWQLSLQTHKYLGI 210


>gi|293605772|ref|ZP_06688146.1| GntS protein [Achromobacter piechaudii ATCC 43553]
 gi|292815821|gb|EFF74928.1| GntS protein [Achromobacter piechaudii ATCC 43553]
          Length = 210

 Score =  269 bits (689), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 121/209 (57%), Positives = 145/209 (69%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y+ KEIF TLQGEG HAGR AVFCRF+GCNLW+GRE DR SA C FCDTDF+G  G  
Sbjct: 1   MTYTAKEIFKTLQGEGAHAGRAAVFCRFAGCNLWTGRESDRASAACTFCDTDFIGTDGEG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GG++    L           + + RY V TGGEPLLQ+D PL+ A++ RGF +A+ETNGT
Sbjct: 61  GGKFATPDLLADTIAATWGPDTQDRYVVFTGGEPLLQLDAPLLTAIHARGFTVAIETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           ++ P GIDWICVSPK    + I  G ELKLV+PQ N  PE +   DFE F LQPMDGP  
Sbjct: 121 VKAPAGIDWICVSPKGTAPIVIDRGDELKLVYPQHNALPETFAHLDFEHFFLQPMDGPAR 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             NT  A+ YC Q+P+WRLS+QTHK+IGI
Sbjct: 181 VANTEQAVQYCMQHPQWRLSLQTHKYIGI 209


>gi|296161371|ref|ZP_06844178.1| Radical SAM domain protein [Burkholderia sp. Ch1-1]
 gi|295888357|gb|EFG68168.1| Radical SAM domain protein [Burkholderia sp. Ch1-1]
          Length = 210

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 122/210 (58%), Positives = 150/210 (71%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG+Y   + L  +I  QW  GE E R+ V TGGEP+LQ+D PL+ AL+  GFEIA+ETNG
Sbjct: 61  GGKYRTAEDLVRMIASQWPQGEGE-RFVVCTGGEPMLQIDQPLVDALHAAGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++   + IDWICVSPKA   L +  G ELK+V PQ N     Y   DFE F +QPMDGP 
Sbjct: 120 SLPVLETIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLSEYAKLDFEYFLVQPMDGPS 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 180 RDINTKLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|91975780|ref|YP_568439.1| hypothetical protein RPD_1300 [Rhodopseudomonas palustris BisB5]
 gi|91682236|gb|ABE38538.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 210

 Score =  269 bits (687), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 137/210 (65%), Positives = 158/210 (75%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIFLTLQGEG HAGR +VFCRF+GCNLW+GREQDR  A CRFCDTDFVG  GT 
Sbjct: 1   MSYAVKEIFLTLQGEGAHAGRASVFCRFAGCNLWTGREQDRDQAACRFCDTDFVGTDGTL 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGRY               G +  RY V+TGGEPLLQ+D  LI AL K+GF I VETNGT
Sbjct: 61  GGRYTDAGELAGAIAAQWAGAELDRYVVITGGEPLLQLDAELIAALQKQGFAIGVETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           IEPP GIDW+CVSPKAG +L++K G ELKLV+PQ    PE +   DFERFSLQPMDGP  
Sbjct: 121 IEPPPGIDWLCVSPKAGAELRVKRGNELKLVYPQPGAMPEQFAALDFERFSLQPMDGPAR 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           +E+T LAI+YC ++P+WRLSVQTHK IGIR
Sbjct: 181 DEHTRLAIAYCLRHPQWRLSVQTHKTIGIR 210


>gi|86742064|ref|YP_482464.1| hypothetical protein Francci3_3380 [Frankia sp. CcI3]
 gi|86568926|gb|ABD12735.1| conserved hypothetical protein [Frankia sp. CcI3]
          Length = 212

 Score =  269 bits (687), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 122/212 (57%), Positives = 147/212 (69%), Gaps = 2/212 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
            +Y IKEIF TLQGEG  +GR AVFCRF+ CNLW+GRE+DR  A C+FCDTDFVG  G  
Sbjct: 1   MVYRIKEIFYTLQGEGVRSGRPAVFCRFALCNLWTGRERDRHRAVCQFCDTDFVGTDGPD 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEG-RYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
           GG +   D LAD +  +W +       Y V TGGEPLLQ+D P + AL+ RGFE+AVETN
Sbjct: 61  GGVFDTPDDLADAVAARWPSDAPGALPYVVCTGGEPLLQLDTPAVSALHTRGFEVAVETN 120

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGP 179
           GT   P G+DW+CVSPKAG  L++  G ELKLVFPQ    PE + G +F    LQPMDGP
Sbjct: 121 GTCPAPAGLDWVCVSPKAGAPLRLTTGDELKLVFPQPGAGPELFAGLEFGHHLLQPMDGP 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             E NT  A+ YC  +P+WRLS+QTHK +GIR
Sbjct: 181 HREANTRAALDYCLAHPRWRLSIQTHKILGIR 212


>gi|152981565|ref|YP_001353700.1| organic radical activating enzyme [Janthinobacterium sp. Marseille]
 gi|151281642|gb|ABR90052.1| organic radical activating enzyme [Janthinobacterium sp. Marseille]
          Length = 211

 Score =  269 bits (687), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 122/210 (58%), Positives = 146/210 (69%), Gaps = 1/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIF TLQGEG HAGR AVFCRFSGCNLW+GRE DR +A C+FCDTDFVG  G  
Sbjct: 1   MTYSVKEIFYTLQGEGAHAGRPAVFCRFSGCNLWTGRESDRATAVCQFCDTDFVGTNGEG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ +   LA  I   W       +Y V TGGEPLLQ+D  LI A++  GFEIA+ETNG
Sbjct: 61  GGKFVDGSTLAHTINALWPESYAASKYVVFTGGEPLLQLDTELIDAMHAVGFEIAIETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P G+DWICVSPK G  L ++ G ELK+V PQ   S   Y   +FE F +QPMDGP 
Sbjct: 121 TLPVPAGVDWICVSPKMGSQLVVRKGSELKVVIPQAEQSLAAYEALEFEHFFVQPMDGPL 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E+NT LAI  C +NPKW+LS+QTHK + I
Sbjct: 181 AEQNTKLAIDVCKRNPKWKLSLQTHKLLQI 210


>gi|209886114|ref|YP_002289971.1| radical SAM [Oligotropha carboxidovorans OM5]
 gi|209874310|gb|ACI94106.1| radical SAM [Oligotropha carboxidovorans OM5]
          Length = 210

 Score =  268 bits (686), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 139/211 (65%), Positives = 158/211 (74%), Gaps = 2/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIFLTLQGEG HAGR AVFCRF+GCNLW+GREQDR  A CRFCDTDFVG  GT 
Sbjct: 1   MSYAVKEIFLTLQGEGAHAGRTAVFCRFAGCNLWTGREQDRADATCRFCDTDFVGTDGTL 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GGRY   D LAD I   W  G    R+ VLTGGEPLLQ+DV LI+AL+ R F IAVETNG
Sbjct: 61  GGRYATADALADQIAATWGEGT-THRFVVLTGGEPLLQIDVELIEALHARHFMIAVETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P G+DWICVSPKA  +L I+ G ELKLV+PQ   +PE+Y    F  FSLQPMDGP 
Sbjct: 120 TLPAPPGLDWICVSPKADTELAIRQGHELKLVYPQAENTPEDYAALAFAHFSLQPMDGPD 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           L +NT  AI YC ++P+WRLSVQTHK IGIR
Sbjct: 180 LAQNTERAIDYCLRHPQWRLSVQTHKTIGIR 210


>gi|197106204|ref|YP_002131581.1| hypothetical protein PHZ_c2743 [Phenylobacterium zucineum HLK1]
 gi|196479624|gb|ACG79152.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 241

 Score =  268 bits (686), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 130/209 (62%), Positives = 147/209 (70%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIFLTLQGEGG AGR AVFCRF+GCNLWSGRE+DR  A C FCDTDFVG+ G  
Sbjct: 32  MSYAVKEIFLTLQGEGGQAGRPAVFCRFAGCNLWSGREEDREKAVCTFCDTDFVGMDGPG 91

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGR+          E    G    R  VLTGGEPLLQVD  LI+AL+ RGF IA+ETNGT
Sbjct: 92  GGRFADAAALAAAIEAQWAGGPNDRLVVLTGGEPLLQVDEALIEALHARGFSIALETNGT 151

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           +  P GIDWICVSPKA   +    GQELKLVFPQ    PE +   DFERF LQPMDGP  
Sbjct: 152 LPVPPGIDWICVSPKADAPVVQTRGQELKLVFPQEKALPERFEHLDFERFLLQPMDGPDR 211

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             NT  AI+YC  +P+WRLSVQTHK++GI
Sbjct: 212 AANTRAAIAYCLAHPRWRLSVQTHKYLGI 240


>gi|89901390|ref|YP_523861.1| organic radical activating-like protein [Rhodoferax ferrireducens
           T118]
 gi|89346127|gb|ABD70330.1| Organic radical activating enzymes-like [Rhodoferax ferrireducens
           T118]
          Length = 211

 Score =  268 bits (685), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 110/210 (52%), Positives = 145/210 (69%), Gaps = 1/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIF TLQGEG HAGR AVFCRF+GCNLWSG E  R SA C+FCDTDFVG  G  
Sbjct: 1   MTYSVKEIFYTLQGEGHHAGRPAVFCRFAGCNLWSGAEDSRASAVCQFCDTDFVGTDGEG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ + + LA  I + W       +Y V TGGEPLLQ++  LI A++  GFE+A+ETNG
Sbjct: 61  GGKFRDAETLAAAINQLWPASYPASKYVVFTGGEPLLQLNAALIDAMHDAGFEVAIETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P+G+DW+CVSPK G  L ++ G E+K+V PQ     ++Y    F+ + +Q MDGP 
Sbjct: 121 TLPVPEGVDWVCVSPKMGSALVVRAGNEIKVVIPQAGQVLDDYACLAFDHYFVQAMDGPL 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +EN  +AI YC  +P+W+LS+QTHK + I
Sbjct: 181 QKENLRMAIDYCKAHPQWKLSLQTHKLLQI 210


>gi|113867905|ref|YP_726394.1| organic radical activating enzyme [Ralstonia eutropha H16]
 gi|113526681|emb|CAJ93026.1| organic radical activating enzyme [Ralstonia eutropha H16]
          Length = 211

 Score =  268 bits (685), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 122/211 (57%), Positives = 152/211 (72%), Gaps = 1/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR SA C+FCDTDFVG  GT+
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRAAVFCRFAGCNLWSGREEDRASAVCQFCDTDFVGTDGTR 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG+Y   ++LA ++  +W  G       V TGGEPLLQ+D PLI AL+ +GFEIA+ETNG
Sbjct: 61  GGKYRTAEELAAVVASEWPQGAGGQPLVVCTGGEPLLQLDAPLIDALHAQGFEIAIETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TI  P GIDW+CVSPK G +L +  G ELK+V PQ       Y   DF  F +Q MDGP 
Sbjct: 121 TIAVPPGIDWVCVSPKMGSELVVTRGDELKVVIPQEGQDFAAYEQLDFRHFLVQAMDGPL 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             ENT  A+++C ++P+WRLS+QTHK +GIR
Sbjct: 181 ARENTAAAVAFCQRHPRWRLSLQTHKLLGIR 211


>gi|299067500|emb|CBJ38699.1| conserved protein of unknown function (Organic radical activating
           enzymes) [Ralstonia solanacearum CMR15]
          Length = 212

 Score =  268 bits (685), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 124/212 (58%), Positives = 147/212 (69%), Gaps = 2/212 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG + GR AVFCRF+GCNLWSGRE DR +A C+FCDTDFVG  GT 
Sbjct: 1   MTYAVKEIFYTLQGEGANTGRAAVFCRFAGCNLWSGREADRATAICQFCDTDFVGTDGTL 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGR-YCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
           GG+Y   D LAD +  QW      GR   V TGGEPLLQ+D  LI AL+ RGFEIA+ETN
Sbjct: 61  GGKYPTADALADTVAAQWPVAATGGRPLVVCTGGEPLLQLDRLLIDALHARGFEIAIETN 120

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGP 179
           GT+  P GIDW+CVSPK G +L +  G ELK+V PQ     + Y   DF  F LQPMDGP
Sbjct: 121 GTLAVPDGIDWVCVSPKLGAELVVTRGDELKVVIPQPGQDLDAYERLDFRHFFLQPMDGP 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              +NT LA+  C + P+W LS+QTHK +GIR
Sbjct: 181 LARQNTALAVELCQRRPRWHLSLQTHKMLGIR 212


>gi|295688231|ref|YP_003591924.1| radical SAM domain-containing protein [Caulobacter segnis ATCC
           21756]
 gi|295430134|gb|ADG09306.1| Radical SAM domain protein [Caulobacter segnis ATCC 21756]
          Length = 210

 Score =  268 bits (685), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 126/208 (60%), Positives = 146/208 (70%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIFLTLQGEGG AG+ AVFCRFSGCNLWSGREQDR  A C FCDTDFVG  G  
Sbjct: 1   MTYSVKEIFLTLQGEGGQAGKAAVFCRFSGCNLWSGREQDRAKAVCTFCDTDFVGTDGEN 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GG++          E   TG  + R  V TGGEP LQ+D   I AL+ RGF+IAVE+NGT
Sbjct: 61  GGKFATADDLAAAVEAQWTGGPDDRLVVCTGGEPFLQLDEAAIAALHARGFQIAVESNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           I+ P  IDWIC+SPKA   +    GQELKLVFPQ    PE +   DFERF LQPMDGP  
Sbjct: 121 IQAPPEIDWICISPKADAPVVQTSGQELKLVFPQEKAMPERFADLDFERFYLQPMDGPDR 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIG 209
           + NT LA++YC  +P+WRLSVQTHK++G
Sbjct: 181 DRNTQLAVAYCLSHPQWRLSVQTHKYLG 208


>gi|115522971|ref|YP_779882.1| hypothetical protein RPE_0946 [Rhodopseudomonas palustris BisA53]
 gi|115516918|gb|ABJ04902.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 210

 Score =  268 bits (685), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 131/210 (62%), Positives = 149/210 (70%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIFLTLQGEG HAGR AVFCRF+GCNLWSGRE DR +A C+FCDTDFVG  GT 
Sbjct: 1   MSYAVKEIFLTLQGEGAHAGRAAVFCRFTGCNLWSGREDDRAAATCQFCDTDFVGTDGTL 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGRY               G+   RY VLTGGEPLLQVD  LI+AL+ RGF I VETNGT
Sbjct: 61  GGRYLSASDLAEAIAAQWRGDAASRYVVLTGGEPLLQVDDALIEALHDRGFSIGVETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
             PP+ IDW+CVSPKAG +L ++ G ELKLV+PQ    PE +    FERFSLQPMDGP  
Sbjct: 121 QMPPEDIDWVCVSPKAGTELTLRYGDELKLVYPQEGAEPELFEALAFERFSLQPMDGPDA 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             N   AI YC  +P+WRLSVQTHK +GIR
Sbjct: 181 AANIQAAIDYCLSHPQWRLSVQTHKTLGIR 210


>gi|241662994|ref|YP_002981354.1| hypothetical protein Rpic12D_1394 [Ralstonia pickettii 12D]
 gi|309782087|ref|ZP_07676817.1| GntS [Ralstonia sp. 5_7_47FAA]
 gi|240865021|gb|ACS62682.1| conserved hypothetical protein [Ralstonia pickettii 12D]
 gi|308919153|gb|EFP64820.1| GntS [Ralstonia sp. 5_7_47FAA]
          Length = 212

 Score =  267 bits (684), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 123/212 (58%), Positives = 151/212 (71%), Gaps = 2/212 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG + GR AVFCRF+GCNLWSGRE DR +A C+FCDTDFVG  GT+
Sbjct: 1   MTYAVKEIFYTLQGEGANTGRAAVFCRFAGCNLWSGREADRATAVCQFCDTDFVGTDGTQ 60

Query: 62  GGRYN-VDQLADLIEEQWITGEKEGRYCVL-TGGEPLLQVDVPLIQALNKRGFEIAVETN 119
           GG+Y   D LAD +  +W      G+  V+ TGGEPLLQ+D PLI AL+ RGFEIA+ETN
Sbjct: 61  GGKYTTADALADTVAAEWPASATGGKPLVICTGGEPLLQLDKPLIDALHARGFEIAIETN 120

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGP 179
           GTI  P+GIDW+CVSPK G +L +  G ELK+V PQ     + Y   DF+ F LQ MDGP
Sbjct: 121 GTITVPEGIDWVCVSPKMGSELVVTRGDELKVVIPQDGQDLDAYERLDFQHFFLQAMDGP 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              +NT  A+  C + P+WRLS+QTHK +GIR
Sbjct: 181 LARQNTAAAVELCQRRPRWRLSLQTHKMLGIR 212


>gi|316932735|ref|YP_004107717.1| Radical SAM domain-containing protein [Rhodopseudomonas palustris
           DX-1]
 gi|315600449|gb|ADU42984.1| Radical SAM domain protein [Rhodopseudomonas palustris DX-1]
          Length = 210

 Score =  267 bits (684), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 135/210 (64%), Positives = 159/210 (75%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIFLTLQGEG HAGR AVFCRF+GCNLW+GREQDR  A C+FCDTDF+G  GT 
Sbjct: 1   MSYAVKEIFLTLQGEGAHAGRAAVFCRFAGCNLWTGREQDRDEATCKFCDTDFIGTDGTL 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGRY   +L      +  TG+   RY V+TGGEPLLQ+D  LI AL+ RGF I VETNGT
Sbjct: 61  GGRYAGAELLADTIAEQWTGDPRKRYVVITGGEPLLQLDGELIAALHTRGFAIGVETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           IEPP GIDW+CVSPKAG +L+I+ G ELKLV+PQ    PE +   DFERFSLQPMDGP  
Sbjct: 121 IEPPDGIDWLCVSPKAGAELRIRRGDELKLVYPQPGAMPEQFAALDFERFSLQPMDGPER 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           ++NT  AI+YC  +P+WRLS+QTHK  GIR
Sbjct: 181 DDNTTRAIAYCLMHPQWRLSLQTHKITGIR 210


>gi|187928417|ref|YP_001898904.1| hypothetical protein Rpic_1329 [Ralstonia pickettii 12J]
 gi|187725307|gb|ACD26472.1| conserved hypothetical protein [Ralstonia pickettii 12J]
          Length = 212

 Score =  267 bits (683), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 122/212 (57%), Positives = 151/212 (71%), Gaps = 2/212 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG + GR AVFCRF+GCNLWSGRE DR +A C+FCDTDFVG  GT+
Sbjct: 1   MTYAVKEIFYTLQGEGANTGRAAVFCRFAGCNLWSGREADRATAVCQFCDTDFVGTDGTQ 60

Query: 62  GGRYN-VDQLADLIEEQWITGEKEGRYCVL-TGGEPLLQVDVPLIQALNKRGFEIAVETN 119
           GG+Y   + LAD +  +W      G+  V+ TGGEPLLQ+D PLI AL+ RGFEIA+ETN
Sbjct: 61  GGKYTTAEALADTVAAEWPASATGGKPLVICTGGEPLLQLDKPLIDALHARGFEIAIETN 120

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGP 179
           GTI  P+GIDW+CVSPK G +L +  G ELK+V PQ     + Y   DF+ F LQ MDGP
Sbjct: 121 GTIAVPEGIDWVCVSPKMGSELVVTRGDELKVVIPQDGQDLDAYERLDFQHFFLQAMDGP 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              +NT  A+  C + P+WRLS+QTHK +GIR
Sbjct: 181 LARQNTAAAVELCQRRPRWRLSLQTHKMLGIR 212


>gi|288942462|ref|YP_003444702.1| radical SAM domain-containing protein [Allochromatium vinosum DSM
           180]
 gi|288897834|gb|ADC63670.1| radical SAM domain-containing protein [Allochromatium vinosum DSM
           180]
          Length = 215

 Score =  267 bits (683), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 127/214 (59%), Positives = 145/214 (67%), Gaps = 5/214 (2%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y +KE F TLQGEG  AGR AVFCRFSGCNLWSGREQDR  A CRFCDTDF G  G  
Sbjct: 1   MSYWVKESFYTLQGEGAQAGRAAVFCRFSGCNLWSGREQDRDRAICRFCDTDFRGTDGEG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEG----RYCVLTGGEPLLQVDVPLIQALNKRGFEIAV 116
           GGRY + D LA+ +   W TG         Y V TGGEPLLQ+D PLI AL+  GFE+AV
Sbjct: 61  GGRYRDADVLAEHLRALWPTGAGADASDRPYVVCTGGEPLLQLDAPLIDALHGSGFEVAV 120

Query: 117 ETNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPM 176
           ETNGT   P G+DWICVSPKAG    +  G ELKL++PQ  + PE + G  F  F LQPM
Sbjct: 121 ETNGTRPAPPGLDWICVSPKAGATTVLIEGDELKLIYPQPGLEPERFEGLGFRHFFLQPM 180

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           DGP    NT LA+ YC   P+WRLS+QTHK++GI
Sbjct: 181 DGPQSNANTRLAVDYCKARPRWRLSLQTHKWLGI 214


>gi|317404069|gb|EFV84524.1| hypothetical protein HMPREF0005_04153 [Achromobacter xylosoxidans
           C54]
          Length = 210

 Score =  267 bits (683), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 119/209 (56%), Positives = 145/209 (69%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y+ KEIF TLQGEG HAGR AVFCRF+GCNLW+GRE DR SA C FCDTDF+G  G  
Sbjct: 1   MTYTAKEIFKTLQGEGAHAGRAAVFCRFAGCNLWTGRESDRASAACTFCDTDFIGTDGDG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GG++   +L     E     +   RY V TGGEPLLQ+D  L+  ++ RGF +A+ETNGT
Sbjct: 61  GGKFASPELLADAIEAAWGPDTANRYIVFTGGEPLLQLDEALLAVVHARGFTVAIETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           ++PP GIDWICVSPK    + I+ G ELKLV+PQ N  P  +   DF+ F LQPMDGP  
Sbjct: 121 VQPPPGIDWICVSPKGTAPVVIERGNELKLVYPQANALPPRFEHLDFDHFFLQPMDGPAR 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             NT  A+ YC Q+P+WRLS+QTHK+IGI
Sbjct: 181 LANTEQAVQYCMQHPQWRLSLQTHKYIGI 209


>gi|73541537|ref|YP_296057.1| hypothetical protein Reut_A1848 [Ralstonia eutropha JMP134]
 gi|72118950|gb|AAZ61213.1| conserved hypothetical protein [Ralstonia eutropha JMP134]
          Length = 211

 Score =  267 bits (682), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 122/211 (57%), Positives = 155/211 (73%), Gaps = 1/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR +A C+FCDTDFVG  GT+
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRAAVFCRFAGCNLWSGREEDRATAVCQFCDTDFVGTDGTR 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG+Y   ++LA  +  +W  G       V TGGEPLLQ+D PLI AL+ +GFEIA+ETNG
Sbjct: 61  GGKYRTAEELAGAVASEWPQGAGGKPLVVCTGGEPLLQLDAPLIDALHAQGFEIAIETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TI+ P GIDW+CVSPK G +L ++ G ELK+V PQV      Y   DF+ F +Q MDGP 
Sbjct: 121 TIKVPPGIDWVCVSPKMGSELVVRKGDELKVVIPQVGQDFAAYEQLDFQYFLVQAMDGPL 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             ENT  A+++C ++P+WRLS+QTHK +GIR
Sbjct: 181 ARENTAAAVAFCQRHPRWRLSLQTHKLLGIR 211


>gi|220926506|ref|YP_002501808.1| radical SAM domain-containing protein [Methylobacterium nodulans
           ORS 2060]
 gi|219951113|gb|ACL61505.1| radical SAM domain-containing protein [Methylobacterium nodulans
           ORS 2060]
          Length = 210

 Score =  266 bits (681), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 124/209 (59%), Positives = 149/209 (71%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG  AGR AVFCRF+GCNLWSGRE DR  A CRFCDTDFVG  G  
Sbjct: 1   MSYAVKEIFHTLQGEGAQAGRAAVFCRFAGCNLWSGREADRADAICRFCDTDFVGTDGEG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGR+   +           G ++GRY V TGGEPLLQ+D PL+ A++ RGF  AVETNGT
Sbjct: 61  GGRFADAEALAAAIAAAWGGGRDGRYVVFTGGEPLLQLDAPLLAAVHARGFATAVETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
            + P+G+DWICVSPKAG  L+I  G ELKLV+PQ  + PE+ +G DF  F LQPMDGP  
Sbjct: 121 QDAPEGLDWICVSPKAGAPLRITRGDELKLVYPQAGLRPEDLVGLDFRHFWLQPMDGPDR 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             NT  A++YC ++ +WRLS+QTHK IGI
Sbjct: 181 LANTEAAVAYCLRDARWRLSLQTHKLIGI 209


>gi|254418815|ref|ZP_05032539.1| hypothetical protein BBAL3_1125 [Brevundimonas sp. BAL3]
 gi|196184992|gb|EDX79968.1| hypothetical protein BBAL3_1125 [Brevundimonas sp. BAL3]
          Length = 211

 Score =  266 bits (681), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 130/211 (61%), Positives = 150/211 (71%), Gaps = 1/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS KE+FLT+QGEGG AGR AVF RF+GCNLWSGREQDR SA C FCDTDFVG  G  
Sbjct: 1   MTYSAKEVFLTVQGEGGQAGRPAVFLRFAGCNLWSGREQDRASAVCSFCDTDFVGTDGDG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++   D LAD +   W     + +  V TGGEPLLQ+D PLI AL+ R FEIA+E+NG
Sbjct: 61  GGKFATADLLADHVAAMWRGRAGDPKLVVCTGGEPLLQLDPPLIAALHARDFEIAIESNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P GIDWICVSPKA  DL    GQELKLV+PQ    P+ +    FERF LQPMDGP 
Sbjct: 121 TLAAPDGIDWICVSPKADADLIQVKGQELKLVYPQAKALPDRFEHLAFERFWLQPMDGPD 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             ENT  AI YC  +P+WRLSVQTHK+IG+R
Sbjct: 181 QAENTAAAIEYCLTHPQWRLSVQTHKYIGVR 211


>gi|300023287|ref|YP_003755898.1| radical SAM protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525108|gb|ADJ23577.1| Radical SAM domain protein [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 208

 Score =  266 bits (681), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 118/208 (56%), Positives = 140/208 (67%), Gaps = 1/208 (0%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y++KEIF TLQGEG +AGR AVFCRF+GCNLW+GRE DR  A C+FCDTDFVG  G  G
Sbjct: 1   MYAVKEIFYTLQGEGTNAGRPAVFCRFAGCNLWTGREVDRAKAVCQFCDTDFVGTDGEGG 60

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
           GR+               G       VLTGGEP+LQVD  L+ AL+ RGF IA+ETNGT+
Sbjct: 61  GRFRTADDLARACRAA-CGSDGDMLVVLTGGEPMLQVDQELVDALHARGFTIAIETNGTL 119

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
              + IDWICVSPKAG  L+ K G ELKLV+PQ  V P +Y    F+   LQPMDG   E
Sbjct: 120 PVLETIDWICVSPKAGSQLQQKHGHELKLVYPQEGVDPADYADLAFQTRFLQPMDGATRE 179

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            NT  A++YC  NP WRLS+QTHK +GI
Sbjct: 180 ANTQAAVAYCKANPGWRLSLQTHKLLGI 207


>gi|124265719|ref|YP_001019723.1| hypothetical protein Mpe_A0526 [Methylibium petroleiphilum PM1]
 gi|124258494|gb|ABM93488.1| conserved hypothetical protein [Methylibium petroleiphilum PM1]
          Length = 211

 Score =  266 bits (680), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 123/211 (58%), Positives = 152/211 (72%), Gaps = 1/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KE+F TLQGEG HAGR AVFCRF+GCNLWSGRE DR  A CRFCDT+FVG  GT 
Sbjct: 1   MTYSVKEVFYTLQGEGSHAGRPAVFCRFAGCNLWSGREADRADAVCRFCDTEFVGTDGTG 60

Query: 62  GGRYNV-DQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ + + LA  +   W  G+   R+ VLTGGEPLLQVD PLI AL+ + FEIAVETNG
Sbjct: 61  GGKFTIAESLASHVAAHWPAGDAGPRFVVLTGGEPLLQVDAPLIDALHAQRFEIAVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           ++  P GIDW+CVSPKAG  L  + GQELK+V PQ  +      G DF +  +QPMDGP 
Sbjct: 121 SVPAPPGIDWLCVSPKAGAPLLQRSGQELKVVVPQGGIDLGELDGLDFAQRRVQPMDGPD 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           L  NT+ A+ +C  +P+W+LS+QTHK +GIR
Sbjct: 181 LAANTDWAVRWCLAHPRWQLSLQTHKLLGIR 211


>gi|94310513|ref|YP_583723.1| hypothetical protein Rmet_1571 [Cupriavidus metallidurans CH34]
 gi|93354365|gb|ABF08454.1| organic radical activating enzyme [Cupriavidus metallidurans CH34]
          Length = 211

 Score =  265 bits (678), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 124/211 (58%), Positives = 153/211 (72%), Gaps = 1/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRFSGCNLW+GRE+DR  A C+FCDTDFVG  GT 
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRAAVFCRFSGCNLWTGREEDRARAVCQFCDTDFVGTDGTL 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG+Y   D+LA ++  +W  G       V TGGEPLLQ+D PLI AL+ RGFEIA+ETNG
Sbjct: 61  GGKYKTADELAAVVAAEWPQGAGGKPLVVCTGGEPLLQLDAPLIGALHARGFEIAIETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TIE P+GIDW+CVSPK G +L +K G ELK+V PQ       Y   DF+ F +Q MDGP 
Sbjct: 121 TIEVPEGIDWVCVSPKMGSELVVKKGDELKVVIPQDGQDFAAYEQLDFQYFMVQAMDGPL 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             +NT  A+ +C ++P+WRLS+QTHK +GIR
Sbjct: 181 ARQNTAAAVEFCQRHPRWRLSLQTHKLLGIR 211


>gi|91787388|ref|YP_548340.1| hypothetical protein Bpro_1494 [Polaromonas sp. JS666]
 gi|91696613|gb|ABE43442.1| conserved hypothetical protein [Polaromonas sp. JS666]
          Length = 211

 Score =  265 bits (678), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 127/211 (60%), Positives = 146/211 (69%), Gaps = 1/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y +KEIF TLQGEG +AGR AVFCRF+GCNLWSGREQDR +A C+FCDTDFVG  GT 
Sbjct: 1   MSYQVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREQDRATAVCQFCDTDFVGTDGTL 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ + D LA LIE QW   ++  R  V+TGGEPLLQVDV LI AL+ RGF+IAVETNG
Sbjct: 61  GGKFADADALARLIEAQWPADDRAHRLVVMTGGEPLLQVDVALIAALHARGFQIAVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TI  P GIDWICVSPKAG     + GQELK+V+PQ            F    LQPMD   
Sbjct: 121 TIAAPAGIDWICVSPKAGAPWIQREGQELKVVWPQAGFELAELEAARFTHRFLQPMDNAR 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             +NT   I+ C Q P WRLS+QTHK  GIR
Sbjct: 181 RADNTQACIALCMQRPAWRLSLQTHKITGIR 211


>gi|302558410|ref|ZP_07310752.1| GntS family protein [Streptomyces griseoflavus Tu4000]
 gi|302476028|gb|EFL39121.1| GntS family protein [Streptomyces griseoflavus Tu4000]
          Length = 213

 Score =  265 bits (678), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 121/213 (56%), Positives = 149/213 (69%), Gaps = 2/213 (0%)

Query: 1   MKL-YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M + Y IKEIF TLQGEG HAGR AVFCRFS CNLW+GRE DR  A C+FCDTDFVG  G
Sbjct: 1   MNMTYLIKEIFYTLQGEGSHAGRPAVFCRFSRCNLWTGREADRSRAICQFCDTDFVGTDG 60

Query: 60  TKGGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVET 118
             GGR+   + LAD +E  W + ++  R+ V TGGEPLLQ+D   I AL+ RGFE+AVET
Sbjct: 61  EGGGRFRTAEDLADAVEAAWPSTDRAHRFVVCTGGEPLLQLDEDAIAALHARGFEVAVET 120

Query: 119 NGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDG 178
           NGT   P GIDW+CVSPK G  L +  G ELKLV+PQ    P  + G DF+   LQP+D 
Sbjct: 121 NGTRPAPHGIDWLCVSPKIGSQLVLTSGDELKLVYPQAGGDPAQFEGLDFQHLRLQPLDD 180

Query: 179 PFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              E++T  A+ YC +NP+W LS+QTHK++GI+
Sbjct: 181 ANREDHTRAAVEYCMKNPRWTLSLQTHKYLGIQ 213


>gi|300704193|ref|YP_003745795.1| hypothetical protein RCFBP_11899 [Ralstonia solanacearum CFBP2957]
 gi|299071856|emb|CBJ43184.1| conserved protein of unknown function (Organic radical activating
           enzymes) [Ralstonia solanacearum CFBP2957]
          Length = 212

 Score =  265 bits (677), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 125/212 (58%), Positives = 148/212 (69%), Gaps = 2/212 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG + GR AVFCRF+GCNLWSGRE DR +A C+FCDTDFVG  GT 
Sbjct: 1   MTYAVKEIFYTLQGEGANTGRAAVFCRFAGCNLWSGREADRAAAVCQFCDTDFVGTDGTL 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGR-YCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
           GG+Y   D LAD +  QW      GR   V TGGEPLLQ+D  LI AL+ RGFEIAVETN
Sbjct: 61  GGKYPTADALADTVAAQWPADATGGRPLVVCTGGEPLLQLDRCLIDALHARGFEIAVETN 120

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGP 179
           GT+  P+GIDW+CVSPK G +L +  G ELK+V PQ     + Y   DF  F LQPMDGP
Sbjct: 121 GTVAVPEGIDWVCVSPKMGAELVVTRGDELKVVIPQSGQDLDAYERLDFRHFFLQPMDGP 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              +NT LA+  C + P+W LS+QTHK +GIR
Sbjct: 181 LARQNTALAVELCQRRPRWHLSLQTHKMLGIR 212


>gi|167585085|ref|ZP_02377473.1| organic radical activating enzyme-like protein [Burkholderia
           ubonensis Bu]
          Length = 210

 Score =  265 bits (677), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 113/209 (54%), Positives = 143/209 (68%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAQALCRFCDTDFVGTDGEN 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GG++                 +  R+ V TGGEP+LQ+D PL+ AL+  GFEIA+ETNG+
Sbjct: 61  GGKFKDAAALAAQVASLWPDGEAHRFVVCTGGEPMLQLDQPLVDALHAAGFEIAIETNGS 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           +   + IDWICVSPKA   L +  G ELK+V PQ N    +Y   DF+ F +QPMDGP  
Sbjct: 121 LPVLESIDWICVSPKADVPLVVTKGNELKVVIPQDNQRLADYAKLDFDYFLVQPMDGPSR 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           + NT LAI +C ++P+WRLS+QTHK++ I
Sbjct: 181 DLNTKLAIDWCKRHPQWRLSMQTHKYLNI 209


>gi|260223401|emb|CBA33932.1| hypothetical protein Csp_B21500 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 225

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 125/211 (59%), Positives = 146/211 (69%), Gaps = 1/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y +KEIF TLQGEG HAGR AVFCRF+GCNLWSGREQDR +A C+FCDTDFVG  GT 
Sbjct: 15  MAYQVKEIFYTLQGEGSHAGRPAVFCRFAGCNLWSGREQDRATAVCKFCDTDFVGTDGTL 74

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++     LA+ I  QW  G+   R+ V+TGGEPLLQVD  LI AL+  GF+IAVETNG
Sbjct: 75  GGKFSTAQALAERIAAQWPAGDTAHRFVVMTGGEPLLQVDTALIDALHALGFQIAVETNG 134

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P+GIDWICVSPKAG     + G ELKLV+PQ  ++ E     DF+   LQPMD P 
Sbjct: 135 TVLVPEGIDWICVSPKAGSQWIQRQGHELKLVWPQAGITLEECEAADFKHRYLQPMDSPQ 194

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              N    I+ C Q P WRLS+QTHK  GIR
Sbjct: 195 RAANIETCITQCMQRPAWRLSLQTHKITGIR 225


>gi|182679140|ref|YP_001833286.1| radical SAM domain-containing protein [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182635023|gb|ACB95797.1| Radical SAM domain protein [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 211

 Score =  263 bits (672), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 128/210 (60%), Positives = 145/210 (69%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M  Y++KEIFLTLQGEG  AGR AVFCRF+GCNLWSGRE DR  A CRFCDTDFVG+ G 
Sbjct: 1   MSHYAVKEIFLTLQGEGAQAGRPAVFCRFTGCNLWSGREADRAQAICRFCDTDFVGMDGL 60

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
            GGR+          E   T     RY V TGGEPLLQ+D  LI+ ++ RGF IAVETNG
Sbjct: 61  GGGRFESASSLADAIETAWTAGPAHRYVVFTGGEPLLQLDETLIKEIHARGFTIAVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TI PP G+DWICVSPKAG  LKI  G ELKLVFPQ  + PE +    F+ F LQPMD   
Sbjct: 121 TIAPPPGLDWICVSPKAGAPLKITQGSELKLVFPQEALDPEEFRALSFQHFWLQPMDNAN 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           L  NT  A +YC  +P+WRLS+QTHK IGI
Sbjct: 181 LARNTTEATAYCLAHPQWRLSLQTHKLIGI 210


>gi|13474945|ref|NP_106515.1| hypothetical protein msl8680 [Mesorhizobium loti MAFF303099]
 gi|14025701|dbj|BAB52301.1| msl8680 [Mesorhizobium loti MAFF303099]
          Length = 211

 Score =  262 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 121/210 (57%), Positives = 147/210 (70%), Gaps = 1/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE DR  A C FCDTDFVG+ G  
Sbjct: 1   MSYAVKEIFYTLQGEGRNAGRAAVFCRFAGCNLWSGREGDRAKAFCGFCDTDFVGVDGPG 60

Query: 62  GGRYNVDQLADL-IEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           G  ++  +   L +E+ W       R+ VLTGGEPLLQ+D  L++AL+   FEIAVETNG
Sbjct: 61  GRHFDTARQLALAVEQAWRGQGAGQRFVVLTGGEPLLQIDEELLEALHCLAFEIAVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TI  P GIDW+CVSPK    L +  G ELKLV+PQ+   PE++    FE   LQPMDGP 
Sbjct: 121 TIPTPAGIDWLCVSPKCNARLVVMAGDELKLVYPQIGAEPEHFEVLAFEHLLLQPMDGPE 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E NT  A++YC  NP+WRLS+QTHKF+GI
Sbjct: 181 REANTAAAVAYCLANPRWRLSLQTHKFLGI 210


>gi|330994295|ref|ZP_08318223.1| 7-carboxy-7-deazaguanine synthase-like protein [Gluconacetobacter
           sp. SXCC-1]
 gi|329758762|gb|EGG75278.1| 7-carboxy-7-deazaguanine synthase-like protein [Gluconacetobacter
           sp. SXCC-1]
          Length = 211

 Score =  262 bits (670), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 124/210 (59%), Positives = 148/210 (70%), Gaps = 1/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG HAGR AVFCRF+GCNLWSG E+DR  A CRFCDTDF+G  G  
Sbjct: 1   MSYTVKEIFPTLQGEGAHAGRTAVFCRFTGCNLWSGLERDRARATCRFCDTDFIGTDGAG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GGR+ +   LAD I   W   +++  + V TGGEPLLQ+D  LI A++ RGFEIAVETNG
Sbjct: 61  GGRFASASLLADAIAAHWPAPDRKAAFVVFTGGEPLLQLDDALITAVHARGFEIAVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P GIDWICVSPKAG  L    G ELKLV+PQ ++ P    G DF +F LQPMD   
Sbjct: 121 TLRAPGGIDWICVSPKAGAPLVQTSGHELKLVYPQPDLLPGQVAGLDFSQFWLQPMDNAA 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + NT  A+ YC  +P+WRLS+QTHK IGI
Sbjct: 181 RDHNTRAAVDYCLHHPQWRLSLQTHKLIGI 210


>gi|163856911|ref|YP_001631210.1| hypothetical protein Bpet2600 [Bordetella petrii DSM 12804]
 gi|163260639|emb|CAP42941.1| conserved hypothetical protein [Bordetella petrii]
          Length = 391

 Score =  262 bits (670), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 119/209 (56%), Positives = 139/209 (66%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS KEIF TLQGEG  AGR AVFCRF+GCNLWSGRE DR  A C FCDTDFVG  G  
Sbjct: 182 MTYSTKEIFKTLQGEGAQAGRAAVFCRFAGCNLWSGREADRAGAVCTFCDTDFVGTDGPG 241

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GG++                  + RY V TGGEPLLQ+D  L+QA++  GF +A+ETNGT
Sbjct: 242 GGKFASAAQLADAIAAAWGPGTQDRYVVFTGGEPLLQLDAALLQAVHGHGFTVAIETNGT 301

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           +  P GIDWICVSPK    + I+ G ELKLV+PQ    PE Y   DF+ F LQPMDGP  
Sbjct: 302 LPAPAGIDWICVSPKGSARVVIERGHELKLVYPQAEARPEAYAHLDFQHFFLQPMDGPAR 361

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             NT  A+ YC Q+P+WRLS+QTHK+IGI
Sbjct: 362 AANTQQAVQYCMQHPQWRLSLQTHKYIGI 390


>gi|158422696|ref|YP_001523988.1| hypothetical protein AZC_1072 [Azorhizobium caulinodans ORS 571]
 gi|158329585|dbj|BAF87070.1| conserved hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 212

 Score =  262 bits (670), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 128/211 (60%), Positives = 150/211 (71%), Gaps = 2/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG  AGR AVFCRF+GCNLWSGRE+DR SA CRFCDTDFVG+ G  
Sbjct: 1   MSYAVKEIFKTLQGEGAQAGRAAVFCRFAGCNLWSGREEDRASAICRFCDTDFVGMDGEG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGR-YCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
           GGR+ +   LA  I   W      GR Y V TGGEPLLQ+D  LI+A++  GFEIA+ETN
Sbjct: 61  GGRFADAPSLAATIARTWGEKGAGGRPYVVFTGGEPLLQLDAALIEAVHAEGFEIAIETN 120

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGP 179
           GT+  P GIDWICVSPKAG ++  + G ELKLV+PQ  V PE   G  FE + LQPMDGP
Sbjct: 121 GTLPAPAGIDWICVSPKAGAEIVQRTGSELKLVYPQPEVPPEAVAGLTFEHYFLQPMDGP 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              ENT   I+YC  +P+WRLS+QTHK  GI
Sbjct: 181 ARIENTQAVIAYCLAHPQWRLSLQTHKITGI 211


>gi|85813929|emb|CAF31558.1| putative fortimicin production protein [Micromonospora
           olivasterospora]
          Length = 212

 Score =  262 bits (669), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 119/211 (56%), Positives = 143/211 (67%), Gaps = 3/211 (1%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y +KEIF TLQGEG HAGR AVFCRF+ CNLW+GRE++R  A C+FCDTDFVG  G  G
Sbjct: 1   MYRVKEIFYTLQGEGSHAGRPAVFCRFTSCNLWTGREEERHRAICQFCDTDFVGTDGPGG 60

Query: 63  GRYNVDQLADLIEEQWITGEKEGR---YCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
           GR+               GE   R   Y V TGGEPLLQ+D   ++AL+  GFE+AVETN
Sbjct: 61  GRFATAAELAAAVVAAWRGEDHPRSRPYVVCTGGEPLLQLDEAAVRALHDAGFEVAVETN 120

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGP 179
           GT   P GIDW+CVSPKAG DL +  G +LKLV+PQ    P  + G DF  F LQPMDGP
Sbjct: 121 GTRPAPPGIDWVCVSPKAGADLVLTRGDDLKLVYPQPGAEPARFEGLDFAHFMLQPMDGP 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               NT  A+ YC ++P+WRLS+QTHK+IGI
Sbjct: 181 DRVANTEAAVRYCLEHPQWRLSLQTHKYIGI 211


>gi|237745834|ref|ZP_04576314.1| organic radical activating enzyme [Oxalobacter formigenes HOxBLS]
 gi|229377185|gb|EEO27276.1| organic radical activating enzyme [Oxalobacter formigenes HOxBLS]
          Length = 234

 Score =  261 bits (668), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 120/208 (57%), Positives = 146/208 (70%), Gaps = 1/208 (0%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           YS+KEIF TLQGEG   GR AVFCRFSGCNLWSGREQDR  A CRFCDTDFVG  G +GG
Sbjct: 26  YSVKEIFYTLQGEGARTGRPAVFCRFSGCNLWSGREQDRARAICRFCDTDFVGTSGERGG 85

Query: 64  RYN-VDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
           ++   ++LA +I   W     E RY V TGGEPLLQ+D PLI  +++ GFEIA+ETNGTI
Sbjct: 86  KFPEAEKLASVIISLWPREHAENRYVVFTGGEPLLQLDRPLIGIMHRAGFEIAIETNGTI 145

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P+G+DW+CVSPK G  L +K G ELK+V PQ   +  +Y    F  F +QPMDG   E
Sbjct: 146 PVPEGVDWVCVSPKVGSTLVVKSGDELKVVIPQAGQNLADYEDLSFSHFYVQPMDGENRE 205

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            N  +AI  C +NPKW+L +QTHK++ I
Sbjct: 206 RNIKMAIDTCLKNPKWKLGLQTHKYLQI 233


>gi|237748637|ref|ZP_04579117.1| organic radical activating enzyme [Oxalobacter formigenes OXCC13]
 gi|229379999|gb|EEO30090.1| organic radical activating enzyme [Oxalobacter formigenes OXCC13]
          Length = 219

 Score =  261 bits (667), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 122/209 (58%), Positives = 146/209 (69%), Gaps = 1/209 (0%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            YS+KEIF TLQGEG  +GR AVFCRFSGCNLWSGRE DR  + CRFCDTDFVG  G  G
Sbjct: 10  TYSVKEIFYTLQGEGARSGRPAVFCRFSGCNLWSGREADRSRSVCRFCDTDFVGTDGVNG 69

Query: 63  GRYN-VDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G++   + L+  IE  W  G  E RY V TGGEPLLQ+D  LI A++ +GFEIA+ETNGT
Sbjct: 70  GKFAQAEDLSSFIESLWPAGFMENRYVVFTGGEPLLQLDAALIDAMHGKGFEIAIETNGT 129

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           +  P GIDW+CVSPKAG DL + GG ELK+V PQ      +Y    F  F +QPMDG   
Sbjct: 130 LAVPDGIDWVCVSPKAGADLAVAGGDELKVVVPQPGQILADYESLAFTHFYVQPMDGENR 189

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +N  +AI  C QNPKW+LS+QTHK++ I
Sbjct: 190 LQNVKIAIDTCLQNPKWKLSLQTHKYLQI 218


>gi|103488122|ref|YP_617683.1| hypothetical protein Sala_2645 [Sphingopyxis alaskensis RB2256]
 gi|98978199|gb|ABF54350.1| conserved hypothetical protein [Sphingopyxis alaskensis RB2256]
          Length = 210

 Score =  261 bits (667), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 125/210 (59%), Positives = 148/210 (70%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG   GR AVFCRF+GCNLWSGRE DR ++ C FCDTDFVG+ G+ 
Sbjct: 1   MSYAVKEIFKTLQGEGAQMGRAAVFCRFAGCNLWSGREGDRTTSVCTFCDTDFVGMDGSG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGR+  DQ      E    G +  RY VLTGGEPLLQVD  L+ AL+ RGFEIA+ETNGT
Sbjct: 61  GGRFADDQALADAIESEWAGARADRYVVLTGGEPLLQVDQDLVDALHTRGFEIAIETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
              P+G+DWICVSPKA  +L +  G ELKLV+PQ   +PE +    FE F LQPMD P  
Sbjct: 121 QPAPRGLDWICVSPKADAELVLLAGNELKLVYPQEKAAPERFEHLAFEHFFLQPMDSPTA 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             N   AI+YC QNP+WRLS+Q+HK IGIR
Sbjct: 181 AANLEAAITYCTQNPRWRLSLQSHKMIGIR 210


>gi|170748800|ref|YP_001755060.1| hypothetical protein Mrad2831_2382 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655322|gb|ACB24377.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 210

 Score =  261 bits (667), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 120/209 (57%), Positives = 143/209 (68%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG  AGR AVFCRF+GCNLWSGRE DR +A CRFCDTDFVG+ G  
Sbjct: 1   MAYAVKEIFHTLQGEGAQAGRAAVFCRFAGCNLWSGREADRAAAACRFCDTDFVGMDGEG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGR+               G  E RY V TGGEPLLQ+D PLI+A++  GFEIA+ETNGT
Sbjct: 61  GGRFADAASLADAIAATWAGGAENRYVVFTGGEPLLQLDTPLIEAVHAAGFEIAIETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           +  P GIDWICVSPK    L    G ELKLV+PQ +  P  ++G  F+   LQPMDGP  
Sbjct: 121 LPAPPGIDWICVSPKGSNALAQVSGHELKLVYPQADADPAAFVGLAFQHRFLQPMDGPDR 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             +T  AI+YC ++ +WRLS+QTHK IGI
Sbjct: 181 AASTEAAIAYCRRDARWRLSLQTHKMIGI 209


>gi|326318538|ref|YP_004236210.1| Radical SAM domain-containing protein [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323375374|gb|ADX47643.1| Radical SAM domain protein [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 212

 Score =  261 bits (667), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 129/212 (60%), Positives = 147/212 (69%), Gaps = 2/212 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIF TLQGEGG AG  AVFCRF+GCNLWSGRE+DR SA CRFCDTDFVG  GT 
Sbjct: 1   MTYSVKEIFYTLQGEGGQAGMPAVFCRFAGCNLWSGREEDRSSAICRFCDTDFVGTDGTL 60

Query: 62  GGRYN-VDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG+Y   D LAD+I  QW   + + R  VLTGGEPLLQ+D PLI AL+ RG  IAVE+NG
Sbjct: 61  GGKYAQADALADVIAAQWPAHDADHRLVVLTGGEPLLQLDTPLIDALHARGMRIAVESNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGF-DFERFSLQPMDGP 179
           T+  P GIDW+CVSPKAG     + GQELKLV+PQ             FE   LQPMDGP
Sbjct: 121 TVAAPPGIDWLCVSPKAGAPWVQRAGQELKLVWPQPGFDLAELENATRFEHRFLQPMDGP 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
               NT+L I+ C + P WRLS+QTHK  GIR
Sbjct: 181 EQAANTSLCIAACMERPAWRLSLQTHKLTGIR 212


>gi|121603954|ref|YP_981283.1| hypothetical protein Pnap_1045 [Polaromonas naphthalenivorans CJ2]
 gi|120592923|gb|ABM36362.1| conserved hypothetical protein [Polaromonas naphthalenivorans CJ2]
          Length = 211

 Score =  260 bits (666), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 126/211 (59%), Positives = 144/211 (68%), Gaps = 1/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y +KEIF TLQGEG HAGR A+FCRF+GCNLWSGRE DR +A CRFCDTDFVG  GT 
Sbjct: 1   MSYQVKEIFYTLQGEGSHAGRPAIFCRFAGCNLWSGREPDRATAVCRFCDTDFVGTDGTL 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ N + LA  IE QW  G+   R+ V+TGGEPLLQVD  LI AL+ RGF IAVETNG
Sbjct: 61  GGKFKNAEALAGCIEAQWPAGDSAHRFVVMTGGEPLLQVDGALIAALHARGFVIAVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TI  P GIDWICVSPKAG     + G ELK+V+PQ  +         F    LQPMD P 
Sbjct: 121 TIAAPPGIDWICVSPKAGAPWIQREGHELKVVWPQPALDWAELEAARFTHRYLQPMDNPA 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              NT   I+ C +NP WRLS+QTHK  GIR
Sbjct: 181 WRNNTEACIALCLENPAWRLSLQTHKITGIR 211


>gi|58039977|ref|YP_191941.1| hypothetical protein GOX1543 [Gluconobacter oxydans 621H]
 gi|58002391|gb|AAW61285.1| Hypothetical protein GOX1543 [Gluconobacter oxydans 621H]
          Length = 213

 Score =  260 bits (666), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 124/212 (58%), Positives = 146/212 (68%), Gaps = 3/212 (1%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KE+F+TLQGEG   GR +VFCRF+GCNLWSGREQDR +A C FCDTDF+G  G  
Sbjct: 1   MSYAVKEMFVTLQGEGAQTGRASVFCRFAGCNLWSGREQDRATAACSFCDTDFIGTDGEG 60

Query: 62  GGRY-NVDQLADLIEEQWI--TGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVET 118
           GGR+   D LAD I   W     E   RY V TGGEPLLQ+D  LI A+  RGFEIAVET
Sbjct: 61  GGRFETADALADTIAACWTSTADESGRRYVVFTGGEPLLQLDDALIAAVKARGFEIAVET 120

Query: 119 NGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDG 178
           NGTI  P GIDW+CVSPK G  L    G ELKLV+PQ  + PE +    F  F LQPMDG
Sbjct: 121 NGTIAAPAGIDWVCVSPKPGGALVQTEGAELKLVYPQPELPPEMFEKLSFRHFWLQPMDG 180

Query: 179 PFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           P    NT  A+++C ++P+WRLS+QTHK IGI
Sbjct: 181 PDRIANTEAAVAHCLRHPRWRLSLQTHKLIGI 212


>gi|329902674|ref|ZP_08273228.1| Queuosine Biosynthesis QueE Radical SAM [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327548646|gb|EGF33296.1| Queuosine Biosynthesis QueE Radical SAM [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 207

 Score =  260 bits (665), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 114/205 (55%), Positives = 141/205 (68%), Gaps = 1/205 (0%)

Query: 7   KEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRY- 65
           KEIF TLQGEG HAGR AVFCRF+GCNLWSGRE DR +A C+FCDTDFVG  G  GG++ 
Sbjct: 2   KEIFYTLQGEGTHAGRPAVFCRFAGCNLWSGRESDRATAVCQFCDTDFVGTDGVMGGKFA 61

Query: 66  NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIEPP 125
           + + LA  +   W       ++ V+TGGEP+LQ+D+ LI AL+ +GF IA+ETNGT+  P
Sbjct: 62  DAESLAATVNSLWPADYPASKFIVITGGEPMLQLDLALIDALHAQGFMIAIETNGTLPVP 121

Query: 126 QGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLEENT 185
             +DWICVSPK G  L  + G ELK+V PQ+      Y   DFE F LQPMD P    NT
Sbjct: 122 PEVDWICVSPKMGSKLVQRSGNELKVVIPQLGQDLLMYEALDFEHFYLQPMDSPTAARNT 181

Query: 186 NLAISYCFQNPKWRLSVQTHKFIGI 210
             AI +C ++PKW+LSVQTHK + I
Sbjct: 182 ERAIDHCKRHPKWKLSVQTHKILQI 206


>gi|33596287|ref|NP_883930.1| hypothetical protein BPP1653 [Bordetella parapertussis 12822]
 gi|33602051|ref|NP_889611.1| hypothetical protein BB3075 [Bordetella bronchiseptica RB50]
 gi|33566056|emb|CAE36954.1| conserved hypothetical protein [Bordetella parapertussis]
 gi|33576489|emb|CAE33567.1| conserved hypothetical protein [Bordetella bronchiseptica RB50]
          Length = 210

 Score =  260 bits (665), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 115/209 (55%), Positives = 140/209 (66%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KE+F TLQGEG  AGR AVFCRF+GCNLW+GRE DR  A C FCDTDFVG  G  
Sbjct: 1   MAYSVKELFKTLQGEGAQAGRAAVFCRFAGCNLWTGRESDRAGAACTFCDTDFVGTDGQG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GG++                    RY V TGGEPLLQ+D  L+QA++ +GF +A+ETNGT
Sbjct: 61  GGKFADAAGLADAIAACWGEHPADRYVVFTGGEPLLQLDEALLQAVHAQGFTVAIETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           + PP GIDWICVSPK    + ++ G ELKLVFPQ +  PE +    FE F LQPMDGP  
Sbjct: 121 LPPPPGIDWICVSPKGRAPVVVERGHELKLVFPQADARPEAFAHLAFEHFFLQPMDGPAR 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             +T  A+ YC  +P+WRLS+QTHK+IGI
Sbjct: 181 AAHTAQAVQYCLDHPQWRLSLQTHKYIGI 209


>gi|20804093|emb|CAD31296.1| HYPOTHETICAL CONSERVED PROTEIN [Mesorhizobium loti R7A]
          Length = 211

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 120/208 (57%), Positives = 145/208 (69%), Gaps = 1/208 (0%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE DR  A C FCDTDFVG+ G  GG
Sbjct: 3   YAVKEIFYTLQGEGRNAGRAAVFCRFAGCNLWSGREGDRARAFCEFCDTDFVGVDGPGGG 62

Query: 64  RY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
            +    + A  +E+ W       R  VLTGGEPLLQ+D  L++AL+   FEIAVETNGTI
Sbjct: 63  HFATAQEFALAVEQAWRGSGTRQRLVVLTGGEPLLQIDEELLEALHSLAFEIAVETNGTI 122

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
               GIDW+CVSPK    L +  G ELKLV+P++   PE++    FE   LQPMDGP  E
Sbjct: 123 PTLAGIDWLCVSPKCNARLVVMAGDELKLVYPRIGAEPEHFEVLAFEHLLLQPMDGPERE 182

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            NT  A++YC  NP+WRLS+QTHKF+GI
Sbjct: 183 ANTAAAVAYCLANPRWRLSLQTHKFLGI 210


>gi|148253795|ref|YP_001238380.1| hypothetical protein BBta_2298 [Bradyrhizobium sp. BTAi1]
 gi|146405968|gb|ABQ34474.1| hypothetical protein BBta_2298 [Bradyrhizobium sp. BTAi1]
          Length = 210

 Score =  259 bits (663), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 130/210 (61%), Positives = 150/210 (71%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF+TLQGEG  AGR AVFCRF+GCNLWSGRE DR +A CRFCDTDFVG  GT 
Sbjct: 1   MSYAVKEIFMTLQGEGALAGRAAVFCRFAGCNLWSGREADRATATCRFCDTDFVGTDGTF 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGRY+             TG    RY +LTGGEPLLQVD  LI AL+ R F + +ETNGT
Sbjct: 61  GGRYDDAAALAAAIAGQWTGGAADRYTILTGGEPLLQVDADLIAALHARDFAVGIETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           + PP GIDWICVSPKAG +LK++ G ELKLV+PQ    PE +    F+RFSLQPMDGP  
Sbjct: 121 LIPPDGIDWICVSPKAGAELKLQQGHELKLVYPQDGAEPERFADLAFQRFSLQPMDGPEA 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             NT  AI YC  +P+WRLS+QTHK IGIR
Sbjct: 181 AANTARAIQYCQHHPQWRLSLQTHKMIGIR 210


>gi|146339025|ref|YP_001204073.1| hypothetical protein BRADO1974 [Bradyrhizobium sp. ORS278]
 gi|146191831|emb|CAL75836.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 210

 Score =  259 bits (663), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 131/210 (62%), Positives = 152/210 (72%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF+TLQGEG  AGR AVFCRF+GCNLWSGRE DR +A CRFCDTDFVG+ GT 
Sbjct: 1   MSYAVKEIFMTLQGEGAQAGRAAVFCRFAGCNLWSGREADRATATCRFCDTDFVGVDGTL 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGRY              TG    RY +LTGGEPLLQVD  LI AL+ +GF + +ETNGT
Sbjct: 61  GGRYETAAALAEAIAGQWTGGAADRYTILTGGEPLLQVDADLIAALHAQGFAVGIETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           + PP GIDWICVSPKAG +LK++ G ELKLV+PQ    P+ + G  FERFSLQPMDGP  
Sbjct: 121 LIPPDGIDWICVSPKAGAELKLRHGHELKLVYPQAGTEPDKFEGLAFERFSLQPMDGPDA 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             NT  AI YC + P+WRLS+QTHK IGIR
Sbjct: 181 AANTARAIHYCQRRPQWRLSLQTHKMIGIR 210


>gi|224824585|ref|ZP_03697692.1| conserved hypothetical protein [Lutiella nitroferrum 2002]
 gi|224603078|gb|EEG09254.1| conserved hypothetical protein [Lutiella nitroferrum 2002]
          Length = 209

 Score =  259 bits (663), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 124/209 (59%), Positives = 146/209 (69%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y++KEIF TLQGEG  AGR AVFCRF+GCNLWSG+E+ R  A C+FCDTDFVG     G
Sbjct: 1   MYTVKEIFYTLQGEGRQAGRAAVFCRFAGCNLWSGKERHRAKAICQFCDTDFVGTGPDGG 60

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
                +QLA+ I   W  G     + V TGGEPLLQ+D PLI AL+ RGFEIAVETNGT+
Sbjct: 61  KFKTAEQLAERIAGAWPAGAGGTPFVVCTGGEPLLQLDAPLIDALHARGFEIAVETNGTV 120

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P GIDW+CVSPKAG  L    G ELKLV+PQ  + PE+  G  F+ F LQPMDGP + 
Sbjct: 121 AAPPGIDWLCVSPKAGAPLLQTSGHELKLVYPQPTLMPESVAGLAFQNFYLQPMDGPDVA 180

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            NT  AI+YC   P+WRLSVQTHK + IR
Sbjct: 181 ANTRAAIAYCMAQPQWRLSVQTHKVLNIR 209


>gi|34498964|ref|NP_903179.1| hypothetical protein CV_3509 [Chromobacterium violaceum ATCC 12472]
 gi|34104813|gb|AAQ61170.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 211

 Score =  259 bits (662), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 126/211 (59%), Positives = 144/211 (68%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M  Y++KEIF TLQGEG  AGR AVFCRF+GCNLWSGRE+DR  A C+FCDTDFVG    
Sbjct: 1   MTTYTVKEIFYTLQGEGRQAGRAAVFCRFAGCNLWSGREEDRAKAVCQFCDTDFVGAGPD 60

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
            G       LA  I  +W        Y V TGGEPLLQ+D  LI AL+ +GFEIAVETNG
Sbjct: 61  GGKFDGAAALAARIAAEWPKDAGGSPYVVCTGGEPLLQLDAELIGALHAQGFEIAVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P G+DWICVSPKAG +LK + G ELKLV+PQ    PE     DF  F LQPMDGP 
Sbjct: 121 TVAAPAGLDWICVSPKAGAELKQRAGDELKLVYPQAAQMPETVADLDFGTFYLQPMDGPE 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           L  NT  AI+YC  +P+WRLSVQTHK + IR
Sbjct: 181 LAANTRAAIAYCMAHPQWRLSVQTHKVVDIR 211


>gi|187478511|ref|YP_786535.1| hypothetical protein BAV2019 [Bordetella avium 197N]
 gi|115423097|emb|CAJ49628.1| conserved hypothetical protein [Bordetella avium 197N]
          Length = 210

 Score =  259 bits (662), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 125/210 (59%), Positives = 144/210 (68%), Gaps = 2/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS KEIF TLQGEG  AGR AVFCRFSGCNLWSGRE DR +A C FCDTDFVG  G  
Sbjct: 1   MTYSAKEIFKTLQGEGAQAGRAAVFCRFSGCNLWSGRESDRAAAACTFCDTDFVGSDGEG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ +   LAD I   W       RY V TGGEPLLQ+D  LI A++ +GF IA+ETNG
Sbjct: 61  GGKFRDAQALADTIARTWGPDRAG-RYVVFTGGEPLLQLDEALIDAVHAQGFTIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P G+DWICVSPK    +    GQELKLVFPQV   PE + G DFE F LQP+D P 
Sbjct: 120 TLPVPAGVDWICVSPKGRAPVVQTRGQELKLVFPQVEAPPEAFAGLDFEHFFLQPLDSPL 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              +T  A+ YC  +P+WRLSVQTHK+IGI
Sbjct: 180 RRAHTEAAVQYCMAHPQWRLSVQTHKYIGI 209


>gi|33593629|ref|NP_881273.1| hypothetical protein BP2659 [Bordetella pertussis Tohama I]
 gi|33563702|emb|CAE42935.1| conserved hypothetical protein [Bordetella pertussis Tohama I]
          Length = 210

 Score =  259 bits (661), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 115/209 (55%), Positives = 140/209 (66%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KE+F TLQGEG  AGR AVFCRF+GCNLW+GRE DR  A C FCDTDFVG  G  
Sbjct: 1   MAYSVKELFKTLQGEGAQAGRAAVFCRFAGCNLWTGRESDRAGAACTFCDTDFVGTDGQG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GG++                    RY V TGGEPLLQ+D  L+QA++ +GF +A+ETNGT
Sbjct: 61  GGKFADAAGLADAIAACWGEHPADRYVVFTGGEPLLQLDEALLQAVHAQGFTVAIETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           + PP GIDWICVSPK    + ++ G ELKLVFPQ +  PE +    FE F LQPMDGP  
Sbjct: 121 LPPPPGIDWICVSPKGRAPVVVERGHELKLVFPQADARPEAFAHLAFEHFFLQPMDGPAR 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             +T  A+ YC  +P+WRLS+QTHK+IGI
Sbjct: 181 AAHTTQAVQYCLDHPQWRLSLQTHKYIGI 209


>gi|120612485|ref|YP_972163.1| hypothetical protein Aave_3844 [Acidovorax citrulli AAC00-1]
 gi|120590949|gb|ABM34389.1| conserved hypothetical protein [Acidovorax citrulli AAC00-1]
          Length = 212

 Score =  258 bits (660), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 128/212 (60%), Positives = 146/212 (68%), Gaps = 2/212 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIF TLQGEGG AG  AVFCRF+GCNLWSGRE+DR SA CRFCDTDFVG  GT 
Sbjct: 1   MTYSVKEIFYTLQGEGGQAGMPAVFCRFAGCNLWSGREEDRSSAVCRFCDTDFVGTDGTL 60

Query: 62  GGRYN-VDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG+Y   + LAD+I  QW   + + R  VLTGGEPLLQ+D PLI AL+ RG  IAVE+NG
Sbjct: 61  GGKYAQAEALADVIAAQWPAHDADHRLVVLTGGEPLLQLDTPLIDALHARGMRIAVESNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGF-DFERFSLQPMDGP 179
           T+  P GIDW+CVSPKAG     + GQELKLV+PQ             FE   LQPMDGP
Sbjct: 121 TVAAPPGIDWLCVSPKAGAPWVQRAGQELKLVWPQPGFDLAELESATRFEHRFLQPMDGP 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
               NT L I+ C + P WRLS+QTHK  GIR
Sbjct: 181 DQAANTGLCIAACMERPAWRLSLQTHKLTGIR 212


>gi|83859604|ref|ZP_00953124.1| hypothetical protein OA2633_06384 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851963|gb|EAP89817.1| hypothetical protein OA2633_06384 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 209

 Score =  258 bits (660), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 122/210 (58%), Positives = 151/210 (71%), Gaps = 3/210 (1%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KE+FLT+QGEGG  GR AVF RF+GCNLWSG E+DR SA C+FCDTDFVG+ G  
Sbjct: 1   MTYSVKEMFLTVQGEGGQTGRPAVFLRFAGCNLWSGLERDRASAICQFCDTDFVGVDGVN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++   + LAD +   W  G +   Y V TGGEPLLQ+D PLI AL++ GF IAVETNG
Sbjct: 61  GGKFKTAEALADKVASLWPGGGEP--YVVCTGGEPLLQLDAPLIDALHEAGFRIAVETNG 118

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TI+ P+GIDW+CVSPK+   LK   G ELKLV+PQ    PE + G DF++F LQPMDGP 
Sbjct: 119 TIKAPEGIDWVCVSPKSTAPLKQTSGDELKLVYPQPEAMPELFSGLDFKQFRLQPMDGPD 178

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             +N   A  YC Q+P+W LS+QTHK+I +
Sbjct: 179 QMKNAQAAFEYCLQHPQWMLSLQTHKWINV 208


>gi|154247119|ref|YP_001418077.1| hypothetical protein Xaut_3190 [Xanthobacter autotrophicus Py2]
 gi|154161204|gb|ABS68420.1| conserved hypothetical protein [Xanthobacter autotrophicus Py2]
          Length = 211

 Score =  258 bits (660), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 127/210 (60%), Positives = 150/210 (71%), Gaps = 1/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KE+FLTLQGEG  AGR AVFCRF+GCNLWSGRE DR  AQCRFCDTDFVG+ G  
Sbjct: 1   MAYAVKEMFLTLQGEGAQAGRAAVFCRFAGCNLWSGREDDRAEAQCRFCDTDFVGMDGEG 60

Query: 62  GGRYNVDQLADLIEEQ-WITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GGR+             W +   E R+ V TGGEPLLQ+D  L+ A++  GFEIAVETNG
Sbjct: 61  GGRFADAATLAAAIAATWGSAAPERRFVVFTGGEPLLQLDTALVDAVHALGFEIAVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T++ P GIDWIC+SPKAG DLK+  G ELKLVFPQ  ++PE   G DF  F LQPMDGP 
Sbjct: 121 TVDAPGGIDWICMSPKAGTDLKVTRGHELKLVFPQPGLAPEGLAGLDFTHFFLQPMDGPD 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              NT  A++YC  +P+WRLS+QTHK IGI
Sbjct: 181 RLRNTEAAVAYCLSHPRWRLSLQTHKMIGI 210


>gi|296445573|ref|ZP_06887529.1| Radical SAM domain protein [Methylosinus trichosporium OB3b]
 gi|296256978|gb|EFH04049.1| Radical SAM domain protein [Methylosinus trichosporium OB3b]
          Length = 210

 Score =  258 bits (660), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 121/210 (57%), Positives = 141/210 (67%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KE F TLQGEG H GR AVFCRF+GCNLWSGRE DR  A CRFCDTDFVG  G  
Sbjct: 1   MAYAVKEAFKTLQGEGRHVGRAAVFCRFAGCNLWSGREIDRAEAVCRFCDTDFVGTNGEG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGR+               GE+E R+ VLTGGEP+LQ+D  L+ AL+  GFEIA+ETNGT
Sbjct: 61  GGRFETAAALAAHLAGLWGGERERRFVVLTGGEPMLQIDAALVDALHDAGFEIAIETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
              P  IDWICVSPKAG  L    G ELKLV+PQ    PE + G  F+ F LQPMDGP  
Sbjct: 121 RAAPSEIDWICVSPKAGAPLVQSSGDELKLVYPQPGAEPELFEGLAFDHFLLQPMDGPEA 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            +NT  A+ YC  +P+WR S+QTHK IG+R
Sbjct: 181 AQNTRAAVDYCLAHPRWRFSLQTHKTIGVR 210


>gi|153876026|ref|ZP_02003554.1| conserved hypothetical protein [Beggiatoa sp. PS]
 gi|152067510|gb|EDN66446.1| conserved hypothetical protein [Beggiatoa sp. PS]
          Length = 209

 Score =  257 bits (658), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 118/210 (56%), Positives = 149/210 (70%), Gaps = 3/210 (1%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIF +LQGEG   GR A+FCRF+GCNLWSGRE+DR  A C+FCDT+F+G  G  
Sbjct: 1   MSYSVKEIFYSLQGEGHQTGRAAIFCRFAGCNLWSGREEDRSIASCQFCDTNFIGTNGQN 60

Query: 62  GGRYN-VDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++     LA+ +    +         + TGGEPLLQ+D PLI+A +  GFEIA+ETNG
Sbjct: 61  GGKFTSAQALAEKVATIGMMKHFP--LIICTGGEPLLQLDEPLIKAFHHIGFEIAIETNG 118

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P  IDWICVSPK    LK++ G ELKLVFPQ N  PE +  FDF+ F LQPMDGP 
Sbjct: 119 TLPAPPNIDWICVSPKGNAPLKLQTGNELKLVFPQPNAPPELFEQFDFQYFFLQPMDGPE 178

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           L++NT LA+ YC ++P+WRLS+QTHK +GI
Sbjct: 179 LKKNTQLALRYCLEHPQWRLSLQTHKLLGI 208


>gi|217977590|ref|YP_002361737.1| radical SAM domain protein [Methylocella silvestris BL2]
 gi|217502966|gb|ACK50375.1| radical SAM domain protein [Methylocella silvestris BL2]
          Length = 211

 Score =  257 bits (658), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 121/210 (57%), Positives = 147/210 (70%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M  Y++KEIF TLQGEG  AGR AVFCRF+GCNLWSGRE+DR +A C FCDTDF+G  G 
Sbjct: 1   MGRYAVKEIFPTLQGEGAQAGRAAVFCRFAGCNLWSGREKDRAAAACPFCDTDFIGTDGP 60

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
            GG +   +      E    G   GRY V TGGEPLLQ+D  LI A++ RGFE AVETNG
Sbjct: 61  GGGVFGGAEELAGAIEAAWLGGPAGRYVVFTGGEPLLQLDDALIAAVHARGFEAAVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+EPP G+DW+CVSPKAG  + +  G ELKLV+PQ ++ P+   G  F  F LQPMDG  
Sbjct: 121 TLEPPAGVDWLCVSPKAGAPIVVTAGSELKLVYPQDDLLPDALSGLQFAHFWLQPMDGAN 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           ++ NT  A++YC  +P WRLS+QTHK IGI
Sbjct: 181 VDANTKAAVAYCLAHPDWRLSLQTHKLIGI 210


>gi|148554323|ref|YP_001261905.1| organic radical activating-like protein [Sphingomonas wittichii
           RW1]
 gi|148499513|gb|ABQ67767.1| Organic radical activating enzymes-like protein [Sphingomonas
           wittichii RW1]
          Length = 210

 Score =  257 bits (657), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 130/212 (61%), Positives = 151/212 (71%), Gaps = 3/212 (1%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M  Y++KE+FLTLQGEG   GR AVF RF+GCNLWSGRE+DR  AQCRFCDTDFVG+ G 
Sbjct: 1   MAGYAVKEMFLTLQGEGVQVGRRAVFLRFAGCNLWSGREEDRADAQCRFCDTDFVGLDGD 60

Query: 61  KGGRYN-VDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
            GGRY   D LAD     W  G+  G + V+TGGEPLLQVD  L+ AL  RGFE AVETN
Sbjct: 61  NGGRYPHADALADKAIALW--GDLAGAFIVMTGGEPLLQVDDALVAALKARGFETAVETN 118

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGP 179
           GT   P GIDWICVSPKAG D+ ++ G ELKLV+PQ  + P    G+DFE F LQPMDG 
Sbjct: 119 GTQPAPAGIDWICVSPKAGTDIVLRRGNELKLVWPQPGIDPAALEGWDFEHFLLQPMDGA 178

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            L+E    AI+Y   +P+WRLS QTHK +GIR
Sbjct: 179 QLDEARAAAIAYVMDHPRWRLSTQTHKVVGIR 210


>gi|41019307|gb|AAR98565.1| GntS [Micromonospora echinospora]
          Length = 212

 Score =  257 bits (656), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 117/211 (55%), Positives = 140/211 (66%), Gaps = 3/211 (1%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y IKEIF TLQGEG HAGR AVFCRF+ CNLW+GRE++R  A CRFCDTDFVG  G  G
Sbjct: 1   MYRIKEIFYTLQGEGTHAGRPAVFCRFTSCNLWTGREEERYRAICRFCDTDFVGTDGPGG 60

Query: 63  GRYNVDQLADLIEEQWITGEKEGR---YCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
           GR+               G+   R   Y V TGGEPLLQ+D   + AL+  GFE+AVETN
Sbjct: 61  GRFGTAAELAAAVAAAWQGQAHPRSRPYVVCTGGEPLLQLDEAAVSALHDAGFEVAVETN 120

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGP 179
           GT   P GIDW CVSPKAG ++ +  G +LKLV+PQ    P  +   DF  F LQPMDGP
Sbjct: 121 GTRPAPPGIDWTCVSPKAGAEVVLTRGDDLKLVYPQPGAEPARFEHLDFTHFMLQPMDGP 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               NT  A+ YC ++P+WRLS+QTHK+IGI
Sbjct: 181 DRVANTEAAVRYCLEHPQWRLSLQTHKYIGI 211


>gi|160897280|ref|YP_001562862.1| hypothetical protein Daci_1837 [Delftia acidovorans SPH-1]
 gi|160362864|gb|ABX34477.1| conserved hypothetical protein [Delftia acidovorans SPH-1]
          Length = 212

 Score =  256 bits (655), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 125/212 (58%), Positives = 150/212 (70%), Gaps = 2/212 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIF TLQGEGG AG  A+FCRF+GCNLW+GREQDR SA C+FCDTDFVG  GT 
Sbjct: 1   MTYSVKEIFYTLQGEGGQAGTPAIFCRFTGCNLWTGREQDRASAICQFCDTDFVGTDGTL 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++   D LA+ I  QW  G+ + R  VLTGGEPLLQVD PLI AL+ RGF I+VE+NG
Sbjct: 61  GGKFATADALAERILSQWPAGDSQHRMVVLTGGEPLLQVDEPLIAALHARGFRISVESNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVS-PENYIGFDFERFSLQPMDGP 179
           T+  P+GIDW+C+SPKAG +   + GQELKLV+PQ          G  F+R+ LQPMD  
Sbjct: 121 TVAAPEGIDWLCISPKAGAEWVQRSGQELKLVWPQPGFDLQAIEAGTRFDRYFLQPMDNV 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              +NT   I+ C Q P WRLS+QTHK  GIR
Sbjct: 181 LQADNTAACIAQCLQRPAWRLSLQTHKLTGIR 212


>gi|162148726|ref|YP_001603187.1| hypothetical protein GDI_2954 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209545507|ref|YP_002277736.1| hypothetical protein Gdia_3395 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161787303|emb|CAP56897.1| conserved protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533184|gb|ACI53121.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 211

 Score =  256 bits (654), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 131/210 (62%), Positives = 155/210 (73%), Gaps = 1/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y+IKE+F TLQGEG HAGR AVFCRF+GCNLWSGRE DR +A CRFCDTDFVG  GT 
Sbjct: 1   MSYAIKEMFATLQGEGAHAGRAAVFCRFAGCNLWSGREADRATAVCRFCDTDFVGTDGTG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GGR+ +   LAD I   W    +E  + V TGGEPLLQ+D  LI A+++RGFEIAVETNG
Sbjct: 61  GGRFADASSLADAIAATWEAPGREHAFVVFTGGEPLLQLDDALIGAVHERGFEIAVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P G+DWICVSPKAG DL  + G ELKLV+PQ ++ PE   G DF +F LQPMDGP 
Sbjct: 121 TLPVPPGVDWICVSPKAGADLVQRTGHELKLVYPQPDLLPERVAGLDFRQFWLQPMDGPA 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              NT  A++YC  +P+WRLS+QTHK IGI
Sbjct: 181 QAANTAAAVAYCRAHPRWRLSLQTHKLIGI 210


>gi|329889514|ref|ZP_08267857.1| radical SAM domain-containing protein [Brevundimonas diminuta ATCC
           11568]
 gi|328844815|gb|EGF94379.1| radical SAM domain-containing protein [Brevundimonas diminuta ATCC
           11568]
          Length = 211

 Score =  255 bits (653), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 121/211 (57%), Positives = 150/211 (71%), Gaps = 1/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS KE+FLT+QGEGG AGR AVF RF+GCNLWSG E+DR +A C FCDTDFVG+ G  
Sbjct: 1   MTYSAKEVFLTVQGEGGQAGRPAVFLRFAGCNLWSGLERDRATAICTFCDTDFVGVNGDG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++   D +AD +   W   E + +  V TGGEPL+Q+D  LI AL+ RGFEIA+E+NG
Sbjct: 61  GGKFKTADLMADHVAGMWRGREGDPKLVVCTGGEPLMQLDTLLIDALHARGFEIAIESNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P+GIDWIC+SPKA   +    GQELKLV+PQ    P+ +   DF+ F LQPMDGP 
Sbjct: 121 TLVAPEGIDWICISPKADAPVVQTSGQELKLVYPQPLAMPDRFESLDFQHFWLQPMDGPD 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              NT  AI YC  +P+WRLSVQTHK+IG+R
Sbjct: 181 QAANTAAAIEYCLTHPQWRLSVQTHKYIGVR 211


>gi|304320027|ref|YP_003853670.1| hypothetical protein PB2503_02257 [Parvularcula bermudensis
           HTCC2503]
 gi|303298930|gb|ADM08529.1| hypothetical protein PB2503_02257 [Parvularcula bermudensis
           HTCC2503]
          Length = 213

 Score =  255 bits (652), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 121/209 (57%), Positives = 140/209 (66%), Gaps = 2/209 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y+IKE + TLQGEG  AGR AVF RF+GCNLWSGRE DR  A CRFCDTDFVG  G  
Sbjct: 6   MSYAIKECYYTLQGEGAQAGRAAVFLRFAGCNLWSGREIDREEAICRFCDTDFVGTDGPG 65

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGR+  ++LA  +   W  G     Y V TGGEPLLQ+D PLI AL+  GFEI VETNGT
Sbjct: 66  GGRFVAEELAAHVASFWPGG--GSPYVVATGGEPLLQLDSPLIDALHDEGFEIGVETNGT 123

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           I  P G+DWICVSPK+  +L    G ELKLVFPQ +  P+ + G  F+ F LQPMDGP+ 
Sbjct: 124 IAAPAGLDWICVSPKSTAELVQTEGDELKLVFPQSDAPPDQFSGLAFDHFFLQPMDGPYQ 183

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                  + YC  NP WRLS+QTHK IGI
Sbjct: 184 SIAIATTVDYCRANPLWRLSLQTHKLIGI 212


>gi|85814032|emb|CAF31448.1| putative gentamicin production protein [Micromonospora echinospora]
          Length = 215

 Score =  255 bits (652), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 118/214 (55%), Positives = 141/214 (65%), Gaps = 4/214 (1%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M  +Y IKEIF TLQGEG HAGR AVFCRF+ CNLW+GRE++R  A CRFCDTDFVG  G
Sbjct: 1   MTGVYRIKEIFYTLQGEGTHAGRPAVFCRFTSCNLWTGREEERYRAICRFCDTDFVGTDG 60

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGR---YCVLTGGEPLLQVDVPLIQALNKRGFEIAV 116
             GGR+               G+   R   Y V TGGEPLLQ+D   + AL+  GFE+AV
Sbjct: 61  PGGGRFGTAAELAAAVAAAWQGQAHPRSRPYVVCTGGEPLLQLDEAAVSALHDAGFEVAV 120

Query: 117 ETNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPM 176
           ETNGT   P GIDW CVSPKAG ++ +  G +LKLV+PQ    P  +   DF  F LQPM
Sbjct: 121 ETNGTRPAPPGIDWTCVSPKAGAEVVLTRGDDLKLVYPQPGAEPARFEHLDFTHFMLQPM 180

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           DGP    NT  A+ YC ++P+WRLS+QTHK+IGI
Sbjct: 181 DGPDRVANTEAAVRYCLEHPQWRLSLQTHKYIGI 214


>gi|224038930|gb|ACN38359.1| putative sisomicin production protein [Micromonospora inyonensis]
          Length = 215

 Score =  255 bits (651), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 118/214 (55%), Positives = 142/214 (66%), Gaps = 4/214 (1%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M  +Y IKEIF TLQGEG HAGR AVFCRF+ CNLW+GRE+DR  A C+FCDTDFVG  G
Sbjct: 1   MTGVYRIKEIFYTLQGEGTHAGRPAVFCRFTSCNLWTGREEDRHRAICQFCDTDFVGTDG 60

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGR---YCVLTGGEPLLQVDVPLIQALNKRGFEIAV 116
             GGR+               G+   R   Y V TGGEPLLQ+D   + AL++ GFE+AV
Sbjct: 61  PGGGRFATAAELAAAVATAWRGQAHPRSRPYVVCTGGEPLLQLDEAAVAALHEAGFEVAV 120

Query: 117 ETNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPM 176
           ETNGT   P G+DW+CVSPKAG DL +  G +LKLV+PQ    P  +   DF  F LQPM
Sbjct: 121 ETNGTRPAPPGLDWVCVSPKAGADLVLTRGDDLKLVYPQPGAEPGRFEHLDFTHFMLQPM 180

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           DGP    NT  A+ YC ++P+WR S+QTHK+IGI
Sbjct: 181 DGPDRVANTEAAVRYCLEHPQWRFSLQTHKYIGI 214


>gi|323135766|ref|ZP_08070849.1| hypothetical protein Met49242DRAFT_0236 [Methylocystis sp. ATCC
           49242]
 gi|322398857|gb|EFY01376.1| hypothetical protein Met49242DRAFT_0236 [Methylocystis sp. ATCC
           49242]
          Length = 210

 Score =  254 bits (650), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 120/211 (56%), Positives = 147/211 (69%), Gaps = 2/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y +KE F T+QGEG +AGRVAVFCRF+GCNLWSGRE+DR  A C FCDT+F G+ G  
Sbjct: 1   MAYFVKEAFRTVQGEGVNAGRVAVFCRFAGCNLWSGREEDRAEAACNFCDTEFTGVDGEG 60

Query: 62  GGRYN-VDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++    +LAD +   W   + E R+ VLTGGEP+LQVD  L+ AL+  GFEIA+E+NG
Sbjct: 61  GGKFPGARELADHLVAIW-GADDEDRFIVLTGGEPMLQVDPALVDALHNEGFEIAIESNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TI    GIDWICVSPKAG  +    G ELKLV+PQ  V P  +   DF  F LQPMDGP 
Sbjct: 120 TIAAAPGIDWICVSPKAGAPIVQTSGSELKLVYPQPGVDPATFERLDFRHFLLQPMDGPE 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           +  NT  A+ YC  +P+WRLS+QTHK IG+R
Sbjct: 180 IVRNTKAAVDYCLAHPRWRLSLQTHKMIGVR 210


>gi|83749823|ref|ZP_00946794.1| Queuosine biosynthesis protein QueE [Ralstonia solanacearum UW551]
 gi|207723445|ref|YP_002253844.1| organic radical activating enzyme protein [Ralstonia solanacearum
           MolK2]
 gi|207743201|ref|YP_002259593.1| organic radical activating enzyme protein [Ralstonia solanacearum
           IPO1609]
 gi|83723503|gb|EAP70710.1| Queuosine biosynthesis protein QueE [Ralstonia solanacearum UW551]
 gi|206588646|emb|CAQ35609.1| organic radical activating enzyme protein [Ralstonia solanacearum
           MolK2]
 gi|206594598|emb|CAQ61525.1| organic radical activating enzyme protein [Ralstonia solanacearum
           IPO1609]
          Length = 224

 Score =  254 bits (649), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 125/212 (58%), Positives = 148/212 (69%), Gaps = 2/212 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG + GR AVFCRF+GCNLWSGRE DR +A C+FCDTDFVG  GT 
Sbjct: 13  MTYAVKEIFYTLQGEGANTGRAAVFCRFAGCNLWSGREADRAAAVCQFCDTDFVGTDGTL 72

Query: 62  GGRY-NVDQLADLIEEQWIT-GEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
           GG+Y   D LADL+  QW           V TGGEPLLQ+D PLI AL+ RGFEIAVETN
Sbjct: 73  GGKYATADALADLVAAQWPADATGGQPLVVCTGGEPLLQLDRPLIDALHARGFEIAVETN 132

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGP 179
           GT+  P+GIDW+CVSPK G +L +  G ELK+V PQ     + Y   DF  F LQPMDGP
Sbjct: 133 GTVAVPEGIDWVCVSPKMGAELVVTRGDELKVVIPQPGQDLDAYERLDFRHFFLQPMDGP 192

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              +NT LA+  C + P+W LS+QTHK +GIR
Sbjct: 193 LARQNTALAVELCQRRPRWHLSLQTHKMLGIR 224


>gi|319795394|ref|YP_004157034.1| radical SAM protein [Variovorax paradoxus EPS]
 gi|315597857|gb|ADU38923.1| Radical SAM domain protein [Variovorax paradoxus EPS]
          Length = 212

 Score =  253 bits (647), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 128/212 (60%), Positives = 147/212 (69%), Gaps = 2/212 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIF TLQGEGG AG  AVFCRF+GCNLW+GRE+DR SA CRFCDTDFVG  GT 
Sbjct: 1   MTYSVKEIFYTLQGEGGQAGMPAVFCRFAGCNLWTGREEDRASAVCRFCDTDFVGTDGTL 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++   DQLAD I  QW   + E R  VLTGGEPLLQVD  L+ AL+ R F IAVE+NG
Sbjct: 61  GGKFKTADQLADTIAAQWPANDAEHRLVVLTGGEPLLQVDAALVDALHARRFRIAVESNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGF-DFERFSLQPMDGP 179
           T+  P+GIDW+C+SPKAG     + GQELKLV+PQ     +      DF    LQPMDGP
Sbjct: 121 TVAAPEGIDWLCISPKAGAPWVQQRGQELKLVWPQTAFDLDAMARTGDFTHRFLQPMDGP 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
               NT L I+ C + P WRLSVQTHK  GIR
Sbjct: 181 DRVANTELCIAECMRQPAWRLSVQTHKITGIR 212


>gi|89093158|ref|ZP_01166108.1| hypothetical protein MED92_03737 [Oceanospirillum sp. MED92]
 gi|89082454|gb|EAR61676.1| hypothetical protein MED92_03737 [Oceanospirillum sp. MED92]
          Length = 210

 Score =  252 bits (645), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 112/209 (53%), Positives = 140/209 (66%), Gaps = 1/209 (0%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +YS+KEIF +LQGEG  +GR ++FCRF+GCNLWSGREQDR  A C FCDTDF+G  G  G
Sbjct: 1   MYSVKEIFFSLQGEGAQSGRASIFCRFAGCNLWSGREQDREKAVCDFCDTDFIGTDGQNG 60

Query: 63  GRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G++     L + ++E W        Y + TGGEP LQ+D  LI   ++ GFE+AVETNGT
Sbjct: 61  GKFETAQALCNFLQEFWPNNSSIPPYIIFTGGEPALQLDQDLIDCCHEYGFEVAVETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
              P GIDW+CVSPKA  +L I  G ELKLV+PQ    PE +   +F  F LQPMDGP  
Sbjct: 121 KPLPSGIDWVCVSPKADAELVITKGDELKLVYPQALAMPEKFASLNFRHFYLQPMDGPAR 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +  T   I YC Q+PKW+LS+Q HK +GI
Sbjct: 181 QLYTKEVIDYCLQHPKWKLSLQNHKVLGI 209


>gi|114328969|ref|YP_746126.1| queuosine biosynthesis protein QueE [Granulibacter bethesdensis
           CGDNIH1]
 gi|114317143|gb|ABI63203.1| queuosine biosynthesis protein QueE [Granulibacter bethesdensis
           CGDNIH1]
          Length = 220

 Score =  252 bits (644), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 122/207 (58%), Positives = 143/207 (69%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y++KEIFLTLQGEG HAGR AVFCRF+GCNLWSGRE+DR  A C FCDTDF+G+ G  GG
Sbjct: 13  YTVKEIFLTLQGEGIHAGRPAVFCRFAGCNLWSGREEDRQMAGCTFCDTDFIGMDGENGG 72

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIE 123
           RY               G  E R+ VLTGGEPLLQVD  LI AL++  F+IAVETNGT  
Sbjct: 73  RYPDAASLARAIAACWQGGAEHRFVVLTGGEPLLQVDAALIDALHEAHFQIAVETNGTQP 132

Query: 124 PPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLEE 183
            P G+DWICVSPKA   L + GG ELKLVFPQ +  PE +   +F  F LQP+D     +
Sbjct: 133 APAGLDWICVSPKADNPLVLTGGDELKLVFPQPDAPPERFEALNFRHFLLQPLDDSRRAD 192

Query: 184 NTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +T  AI YC  +P+WRLSVQTHK +GI
Sbjct: 193 HTRAAIEYCLHHPRWRLSVQTHKTLGI 219


>gi|312113885|ref|YP_004011481.1| hypothetical protein Rvan_1111 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219014|gb|ADP70382.1| hypothetical protein Rvan_1111 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 213

 Score =  252 bits (644), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 117/213 (54%), Positives = 145/213 (68%), Gaps = 4/213 (1%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y++KEIF TLQGEG   GR AVF RF+GCNLW+G+ +D+  A CRFCDTDFVG  G  G
Sbjct: 1   MYTVKEIFPTLQGEGAQVGRAAVFLRFAGCNLWTGQHKDKSKAFCRFCDTDFVGYDGPNG 60

Query: 63  GRY-NVDQLADLIEEQW---ITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVET 118
           G++   DQLAD++   W     G+    Y V TGGEP LQ+D P+I AL KRGF +A+E+
Sbjct: 61  GKFETADQLADIVLGMWNSLTKGKTASPYVVCTGGEPTLQLDTPMIDALKKRGFTVAIES 120

Query: 119 NGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDG 178
           NGT   P+G+DWIC+SPKAG  L  + G ELKLV+PQ    P+ +    FE F LQPMDG
Sbjct: 121 NGTRPAPRGLDWICISPKAGVPLAQREGNELKLVYPQTGALPQLFERLKFEHFFLQPMDG 180

Query: 179 PFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           P   +N   AI YC  NP WRLS+Q HK +GIR
Sbjct: 181 PQHRDNIEAAIRYCMANPPWRLSMQMHKLVGIR 213


>gi|226228044|ref|YP_002762150.1| hypothetical protein GAU_2638 [Gemmatimonas aurantiaca T-27]
 gi|226091235|dbj|BAH39680.1| hypothetical protein [Gemmatimonas aurantiaca T-27]
          Length = 212

 Score =  252 bits (643), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 117/212 (55%), Positives = 138/212 (65%), Gaps = 2/212 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KE F TLQGEG +AGR AVFCRFSGCNLW+GRE DR  A C FCDTDFVG+    
Sbjct: 1   MAYTVKECFYTLQGEGVNAGRAAVFCRFSGCNLWTGREADRHKATCTFCDTDFVGVGPDG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEG--RYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
           G       LA  ++ +W          + V TGGEPLLQ+D   I AL+  GFEIAVETN
Sbjct: 61  GKFATAAALAAFVKSRWPVDAPGSARPFVVCTGGEPLLQLDEAAIDALHAEGFEIAVETN 120

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGP 179
           GT   P G+DWICVSPKA   + +  G ELKLVFPQ    PE +   +F  F LQPMD P
Sbjct: 121 GTQPAPAGLDWICVSPKADAPVVLTRGDELKLVFPQEQARPERFASLEFAHFLLQPMDDP 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              ENT  A++YC  +P+WRLSVQTHK +GIR
Sbjct: 181 QAAENTRAALAYCLAHPQWRLSVQTHKVLGIR 212


>gi|296115261|ref|ZP_06833901.1| hypothetical protein GXY_05748 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978164|gb|EFG84902.1| hypothetical protein GXY_05748 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 211

 Score =  250 bits (640), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 121/210 (57%), Positives = 141/210 (67%), Gaps = 1/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG  AGR AVFCRF+GCNLWSGRE DR  A CRFCDTDF+G  G  
Sbjct: 1   MSYTVKEIFPTLQGEGSQAGRAAVFCRFAGCNLWSGREIDRDDATCRFCDTDFIGTDGMG 60

Query: 62  GGRYNVDQLADLIEEQWITG-EKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GGR+                  +   + V TGGEPLLQ+D  L+ A++ RGF IAVETNG
Sbjct: 61  GGRFADAASLADAIAAAWPAASRRDAFVVFTGGEPLLQLDAALVAAMHARGFFIAVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TI  P GIDWIC+SPKAG  L    G ELKLVFPQ ++ PE   G DF +F LQPMDGP 
Sbjct: 121 TIRAPDGIDWICMSPKAGAPLVQTSGHELKLVFPQPDLMPEQVAGLDFAQFWLQPMDGPE 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              NT+ A+ YC  +P+WRLS+QTHK IGI
Sbjct: 181 RVSNTSHAVEYCMAHPQWRLSLQTHKLIGI 210


>gi|163850651|ref|YP_001638694.1| hypothetical protein Mext_1221 [Methylobacterium extorquens PA1]
 gi|163662256|gb|ABY29623.1| conserved hypothetical protein [Methylobacterium extorquens PA1]
          Length = 212

 Score =  250 bits (639), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 122/211 (57%), Positives = 142/211 (67%), Gaps = 2/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KE+F TLQGEG  AGR AVFCRFSGCNLWSGRE+DR  A CRFCDTDFVG+ G  
Sbjct: 1   MSYAVKELFHTLQGEGAQAGRAAVFCRFSGCNLWSGREEDRAGAACRFCDTDFVGMDGEG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGR+   ++          G    RY V TGGEPLLQ+D  LI A++ RGFE+AVETNGT
Sbjct: 61  GGRFASAEILADAIAATWAGGTSNRYVVFTGGEPLLQLDEALIAAVHARGFEVAVETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQ--VNVSPENYIGFDFERFSLQPMDGP 179
           +  P GIDWICVSPKAG  L    G ELKLVFPQ     +PE +    F    LQPMDGP
Sbjct: 121 LPAPPGIDWICVSPKAGNPLVQTSGDELKLVFPQAEAEAAPERFSDLPFRHHFLQPMDGP 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               +T  A++YC  N +WRLS+QTHK IGI
Sbjct: 181 DAAAHTAAAVAYCRSNARWRLSLQTHKIIGI 211


>gi|90422441|ref|YP_530811.1| hypothetical protein RPC_0922 [Rhodopseudomonas palustris BisB18]
 gi|90104455|gb|ABD86492.1| Radical SAM [Rhodopseudomonas palustris BisB18]
          Length = 210

 Score =  250 bits (639), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 129/210 (61%), Positives = 153/210 (72%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIFLTLQGEG HAGR AVFCRF+GCNLWSGR+ DR +A+C+FCDTDFVG  GT 
Sbjct: 1   MSYAVKEIFLTLQGEGAHAGRAAVFCRFAGCNLWSGRDSDRETAKCQFCDTDFVGTDGTL 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G RY        +     TG+ + RY VLTGGEPLLQ+D  LI AL+ RGF + VETNGT
Sbjct: 61  GDRYASAAELAAVIASQWTGDDKFRYVVLTGGEPLLQLDAKLIAALHGRGFGVGVETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           + PP GIDW+CVSPKAG DL ++ G ELKLV+PQ    PE +    FERFSLQPMDG   
Sbjct: 121 LAPPDGIDWLCVSPKAGADLVLRRGNELKLVYPQRGALPELFADLGFERFSLQPMDGAEA 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             NT  AI+YC  +P+WRLS+QTHK +GIR
Sbjct: 181 AANTASAIAYCLAHPQWRLSLQTHKTLGIR 210


>gi|114319183|ref|YP_740866.1| radical SAM domain-containing protein [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114225577|gb|ABI55376.1| Radical SAM domain protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 209

 Score =  250 bits (639), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 119/210 (56%), Positives = 141/210 (67%), Gaps = 3/210 (1%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+ EI  TLQGEG   GR AVFCRF+GCNLWSGRE  R SA CRFCDT FVG  G+ 
Sbjct: 1   MTYSVHEIHYTLQGEGAQTGRPAVFCRFAGCNLWSGREAHRASAICRFCDTAFVGTGGSG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GGR+ + ++LA+ +   W  G +     V TGGEPLLQ+D  LI AL++RGFE+AVETNG
Sbjct: 61  GGRFRSANELAERLAGYWPGGGRP--LVVCTGGEPLLQLDSALIDALHRRGFEVAVETNG 118

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T   P G+DWICVSPKAG  L +  G ELKLV PQ    PE +    F  F LQPMDGP 
Sbjct: 119 TRPAPAGLDWICVSPKAGAPLVLTTGDELKLVHPQPGAEPERFQHLAFRHFFLQPMDGPE 178

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E NT   + YC  +P+W LS+QTHK +GI
Sbjct: 179 REANTQACVDYCLAHPQWSLSLQTHKLLGI 208


>gi|221065388|ref|ZP_03541493.1| conserved hypothetical protein [Comamonas testosteroni KF-1]
 gi|220710411|gb|EED65779.1| conserved hypothetical protein [Comamonas testosteroni KF-1]
          Length = 212

 Score =  250 bits (638), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 122/212 (57%), Positives = 143/212 (67%), Gaps = 2/212 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIF TLQGEGG AG  AVFCRF+GCNLW+GREQDR +A C+FCDTDFVG  GT 
Sbjct: 1   MTYSVKEIFYTLQGEGGQAGTPAVFCRFAGCNLWTGREQDRPNAICQFCDTDFVGTDGTL 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++   D LA+ I  QW   +   R  VLTGGEPLLQVD  LI AL+ RGF I+VE+NG
Sbjct: 61  GGKFATADALAERILSQWPADDSLHRMVVLTGGEPLLQVDEALIAALHARGFRISVESNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIG-FDFERFSLQPMDGP 179
           T+  P+GIDW+C+SPKAG D   + GQELKLV+PQ            DF+ + LQPMD  
Sbjct: 121 TVAAPEGIDWLCISPKAGADWIQRSGQELKLVWPQPTFDLAAIEASTDFQHYFLQPMDNA 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
               N    I  C Q P WRLS+QTHK  GIR
Sbjct: 181 QQSGNITACIEQCMQRPGWRLSLQTHKLTGIR 212


>gi|218529375|ref|YP_002420191.1| hypothetical protein Mchl_1382 [Methylobacterium chloromethanicum
           CM4]
 gi|240137705|ref|YP_002962176.1| hypothetical protein MexAM1_META1p1004 [Methylobacterium extorquens
           AM1]
 gi|218521678|gb|ACK82263.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
 gi|240007673|gb|ACS38899.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 212

 Score =  249 bits (637), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 122/211 (57%), Positives = 142/211 (67%), Gaps = 2/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KE+F TLQGEG  AGR AVFCRFSGCNLWSGRE+DR  A CRFCDTDFVG+ G  
Sbjct: 1   MSYAVKELFHTLQGEGAQAGRAAVFCRFSGCNLWSGREEDRAGAACRFCDTDFVGMDGEG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGR+   ++          G    RY V TGGEPLLQ+D  LI A++ RGFE+AVETNGT
Sbjct: 61  GGRFASAEILADAIAATWAGGTANRYVVFTGGEPLLQLDEALIAAVHARGFEVAVETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQ--VNVSPENYIGFDFERFSLQPMDGP 179
           +  P GIDWICVSPKAG  L    G ELKLVFPQ     +PE +    F    LQPMDGP
Sbjct: 121 LPAPPGIDWICVSPKAGNPLVQTSGDELKLVFPQAEAEAAPERFSDLPFRHHFLQPMDGP 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               +T  A++YC  N +WRLS+QTHK IGI
Sbjct: 181 DAAAHTAAAVAYCRSNARWRLSLQTHKIIGI 211


>gi|299531400|ref|ZP_07044808.1| hypothetical protein CTS44_11451 [Comamonas testosteroni S44]
 gi|298720563|gb|EFI61512.1| hypothetical protein CTS44_11451 [Comamonas testosteroni S44]
          Length = 212

 Score =  249 bits (637), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 121/212 (57%), Positives = 144/212 (67%), Gaps = 2/212 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIF TLQGEGG AG  AVFCRF+GCNLW+GREQDR  A C+FCDTDFVG  GT 
Sbjct: 1   MTYSVKEIFYTLQGEGGQAGMPAVFCRFAGCNLWTGREQDRPKAICQFCDTDFVGTDGTL 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++   D+LA+ I  QW   +   R  VLTGGEPLLQVD  LI AL+ RGF I+VE+NG
Sbjct: 61  GGKFTTADELAERILGQWPADDSRHRMVVLTGGEPLLQVDQALIAALHARGFRISVESNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIG-FDFERFSLQPMDGP 179
           T+  P+GIDW+C+SPKAG D   + GQELKLV+PQ            +F+ + LQPMD  
Sbjct: 121 TVTAPEGIDWLCISPKAGADWIQRSGQELKLVWPQPTFDLAAIEASTEFQHYFLQPMDNA 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
               N    I+ C Q P WRLS+QTHK  GIR
Sbjct: 181 QQSSNIAACIAQCMQRPGWRLSLQTHKLTGIR 212


>gi|239817064|ref|YP_002945974.1| hypothetical protein Vapar_4095 [Variovorax paradoxus S110]
 gi|239803641|gb|ACS20708.1| conserved hypothetical protein [Variovorax paradoxus S110]
          Length = 212

 Score =  249 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 124/212 (58%), Positives = 147/212 (69%), Gaps = 2/212 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIF TLQGEGG AG  AVFCRF+GCNLW+GRE+DR +A CRFCDTDFVG  GT 
Sbjct: 1   MTYSVKEIFYTLQGEGGQAGMPAVFCRFAGCNLWTGREEDRATAVCRFCDTDFVGTDGTL 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ N + LAD I  QW   + E R  VLTGGEPLLQVD  L+ AL+ R F IAVE+NG
Sbjct: 61  GGKFKNAELLADTIAAQWPAEDAEHRLVVLTGGEPLLQVDAALVDALHARRFRIAVESNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGF-DFERFSLQPMDGP 179
           T+  P+GIDW+C+SPKAG     + GQELKLV+ Q     +      +F    LQPMDGP
Sbjct: 121 TVAAPEGIDWLCISPKAGAPWVQQRGQELKLVWRQTEFDLDTMARTGEFTHRFLQPMDGP 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
               NT L I+ C ++P WRLSVQTHK  GIR
Sbjct: 181 DRVANTELCIAECMRHPAWRLSVQTHKITGIR 212


>gi|87308581|ref|ZP_01090721.1| hypothetical protein DSM3645_14515 [Blastopirellula marina DSM
           3645]
 gi|87288673|gb|EAQ80567.1| hypothetical protein DSM3645_14515 [Blastopirellula marina DSM
           3645]
          Length = 211

 Score =  249 bits (635), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 118/209 (56%), Positives = 143/209 (68%), Gaps = 1/209 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y +KEI+ TLQGEG  +GR AVFCRF+GCNLWSGREQDR SA C+FCDT FVG  G  
Sbjct: 1   MKYFVKEIYYTLQGEGAKSGRPAVFCRFTGCNLWSGREQDRASAICQFCDTQFVGTDGPG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG + +  +LA  +  +W       +  V TGGEPLLQ+D  +I+AL+  GFE+AVETNG
Sbjct: 61  GGVFRSALELAGAVAAKWPESWNANKMVVCTGGEPLLQLDEAVIEALHDEGFEVAVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T  PP GIDWI VSPKA  +  ++ G ELKLVFPQ    P  Y   DF+ F LQPMDG  
Sbjct: 121 TKIPPPGIDWISVSPKANAECILRAGDELKLVFPQPGGEPTKYENLDFDHFFLQPMDGLS 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIG 209
            E+NT LA  YC ++P+W LS+QTHK IG
Sbjct: 181 REQNTQLAAQYCLKHPQWELSIQTHKLIG 209


>gi|264679996|ref|YP_003279905.1| hypothetical protein CtCNB1_3863 [Comamonas testosteroni CNB-2]
 gi|262210511|gb|ACY34609.1| conserved hypothetical protein [Comamonas testosteroni CNB-2]
          Length = 212

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 121/212 (57%), Positives = 144/212 (67%), Gaps = 2/212 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIF TLQGEGG AG  AVFCRF+GCNLW+GREQDR  A C+FCDTDFVG  GT 
Sbjct: 1   MTYSVKEIFYTLQGEGGQAGMPAVFCRFAGCNLWTGREQDRPKAICQFCDTDFVGTDGTL 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++   D+LA+ I  QW   +   R  VLTGGEPLLQVD  LI AL+ RGF I+VE+NG
Sbjct: 61  GGKFATADELAERILGQWPADDSRHRMVVLTGGEPLLQVDQALIAALHVRGFRISVESNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIG-FDFERFSLQPMDGP 179
           T+  P+GIDW+C+SPKAG D   + GQELKLV+PQ            +F+ + LQPMD  
Sbjct: 121 TVAAPEGIDWLCISPKAGADWIQRSGQELKLVWPQPTFDLAAIEASTEFQHYFLQPMDNA 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
               N    I+ C Q P WRLS+QTHK  GIR
Sbjct: 181 QQSSNIAACIAQCMQRPGWRLSLQTHKLTGIR 212


>gi|114569269|ref|YP_755949.1| radical SAM domain-containing protein [Maricaulis maris MCS10]
 gi|114339731|gb|ABI65011.1| Radical SAM domain protein [Maricaulis maris MCS10]
          Length = 209

 Score =  248 bits (634), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 123/209 (58%), Positives = 143/209 (68%), Gaps = 3/209 (1%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KE FLT+QGEG  AGR AVF RFSGCNLWSGREQDR  A C FCDTDFVG+ G  
Sbjct: 1   MSYSVKERFLTVQGEGAQAGRPAVFLRFSGCNLWSGREQDRHKAVCNFCDTDFVGMDGPG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GGR+     L D + E W  G +     V TGGEPLLQ+D  LI AL+ RGFEIAVETNG
Sbjct: 61  GGRFKTAVSLVDAVAELWPGGGRP--LVVCTGGEPLLQLDTSLIDALHARGFEIAVETNG 118

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P GIDWI VSPK    +    G ELKLV+PQ  + P  +  +DF+RFSLQPMDGP 
Sbjct: 119 TVRAPDGIDWITVSPKGTAPVVQTSGHELKLVYPQPELDPTAFEDWDFKRFSLQPMDGPQ 178

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIG 209
           + EN   A  YC  +P+W LS+QTHK+IG
Sbjct: 179 MMENAQAAFDYCLAHPQWSLSLQTHKWIG 207


>gi|254560274|ref|YP_003067369.1| hypothetical protein METDI1804 [Methylobacterium extorquens DM4]
 gi|254267552|emb|CAX23394.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 212

 Score =  248 bits (634), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 122/211 (57%), Positives = 142/211 (67%), Gaps = 2/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KE+F TLQGEG  AGR AVFCRFSGCNLWSGRE+DR  A CRFCDTDFVG+ G  
Sbjct: 1   MSYAVKELFHTLQGEGAQAGRAAVFCRFSGCNLWSGREEDRAGAACRFCDTDFVGMDGEG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGR+   ++          G    RY V TGGEPLLQ+D  LI A++ RGFE+AVETNGT
Sbjct: 61  GGRFASAEILAGAIAATWAGGTANRYVVFTGGEPLLQLDEALIAAVHARGFEVAVETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQ--VNVSPENYIGFDFERFSLQPMDGP 179
           +  P GIDWICVSPKAG  L    G ELKLVFPQ     +PE +    F    LQPMDGP
Sbjct: 121 LPAPPGIDWICVSPKAGNPLVQTSGDELKLVFPQAEAEAAPERFSDLPFRHHFLQPMDGP 180

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               +T  A++YC  N +WRLS+QTHK IGI
Sbjct: 181 DAAAHTAAAVAYCRSNARWRLSLQTHKIIGI 211


>gi|83649266|ref|YP_437701.1| organic radical activating protein [Hahella chejuensis KCTC 2396]
 gi|83637309|gb|ABC33276.1| Organic radical activating enzyme [Hahella chejuensis KCTC 2396]
          Length = 217

 Score =  248 bits (633), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 117/217 (53%), Positives = 145/217 (66%), Gaps = 10/217 (4%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y +KE F TLQGEG H GR AVFCRFS CNLW+GRE+DR  A C FCDTDF+G+ G  G
Sbjct: 1   MYRVKEAFYTLQGEGAHQGRPAVFCRFSKCNLWTGREKDRAGAVCNFCDTDFIGVDGQNG 60

Query: 63  GRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G++   ++LAD I   W   E++ R+ V TGGEPLLQ+D PLI+A + RGFE+AVETNGT
Sbjct: 61  GKFATAEELADHILAFWPP-EQDNRFVVCTGGEPLLQLDEPLIEAFHARGFEVAVETNGT 119

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           +  P GIDW+CVSPK   ++ I    ELKLV+PQ    PE +      R  L PM  P +
Sbjct: 120 LPAPAGIDWLCVSPKGRAEVVITECDELKLVYPQPEAPPERFSDIRAGRHYLSPMANPLV 179

Query: 182 EE--------NTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E        NT LA+ YC ++PKWRLSVQ HK +GI
Sbjct: 180 REGNDEQKRRNTQLAMEYCMRHPKWRLSVQLHKILGI 216


>gi|258542252|ref|YP_003187685.1| hypothetical protein APA01_11580 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633330|dbj|BAH99305.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256636389|dbj|BAI02358.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256639442|dbj|BAI05404.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642498|dbj|BAI08453.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645553|dbj|BAI11501.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648606|dbj|BAI14547.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651659|dbj|BAI17593.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654650|dbj|BAI20577.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 216

 Score =  247 bits (631), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 124/215 (57%), Positives = 146/215 (67%), Gaps = 6/215 (2%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIFLTLQGEGG AGR AVFCRF+GCNLWSGRE DR  A C+FCDTDF+G  G  
Sbjct: 1   MTYSVKEIFLTLQGEGGQAGRAAVFCRFTGCNLWSGREADRDKAICQFCDTDFIGTDGIN 60

Query: 62  GGRY-NVDQLADLIEEQWI-----TGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIA 115
           GG++ N  +LA  I   W      T     +  V TGGEPLLQ+D  LI A++ +GF IA
Sbjct: 61  GGKFENAAELAATIASFWPQPTEDTKATGQKLVVFTGGEPLLQLDTALIDAMHAQGFSIA 120

Query: 116 VETNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQP 175
           VE+NGT+  P+GIDW+C+SPKAG +L  K G ELKLVFPQ  + P      DF+ F LQP
Sbjct: 121 VESNGTVMAPEGIDWLCISPKAGAELVQKAGTELKLVFPQPGIDPAALENLDFQHFWLQP 180

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           MDGP    NT  AI YC  +P W LS+QTHK IGI
Sbjct: 181 MDGPQQAVNTQAAIEYCLAHPLWGLSLQTHKLIGI 215


>gi|329113419|ref|ZP_08242200.1| 7-carboxy-7-deazaguanine synthase-like protein [Acetobacter pomorum
           DM001]
 gi|326697244|gb|EGE48904.1| 7-carboxy-7-deazaguanine synthase-like protein [Acetobacter pomorum
           DM001]
          Length = 216

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 124/215 (57%), Positives = 148/215 (68%), Gaps = 6/215 (2%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIFLTLQGEGG AGR AVFCRF+GCNLWSGRE+DR +A C+FCDTDF+G  G  
Sbjct: 1   MTYSVKEIFLTLQGEGGQAGRAAVFCRFTGCNLWSGREEDRATATCQFCDTDFIGTDGIN 60

Query: 62  GGRY-NVDQLADLIEEQWI-----TGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIA 115
           GG++ N   LA  I   W            +  V TGGEPLLQ+D  LI A++ +GF IA
Sbjct: 61  GGKFENAADLAATIASFWPQPTQDVKATGQKLVVFTGGEPLLQLDTALINAMHAQGFTIA 120

Query: 116 VETNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQP 175
           VE+NGTI  P+GIDW+C+SPKAG +L  K G ELKLVFPQ  + P +    DF+ F LQP
Sbjct: 121 VESNGTIAAPKGIDWLCISPKAGAELVQKAGTELKLVFPQPGIDPASVENLDFQHFWLQP 180

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           MDGP    NT  AI YC ++P W LS+QTHK IGI
Sbjct: 181 MDGPQQAANTQAAIEYCLEHPLWGLSLQTHKLIGI 215


>gi|103486840|ref|YP_616401.1| hypothetical protein Sala_1354 [Sphingopyxis alaskensis RB2256]
 gi|98976917|gb|ABF53068.1| conserved hypothetical protein [Sphingopyxis alaskensis RB2256]
          Length = 210

 Score =  245 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 120/211 (56%), Positives = 142/211 (67%), Gaps = 2/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIFLTLQGEG  AGR AVFCRF+GCNLW+GREQDR  A CRFCDTDFVG  GT 
Sbjct: 1   MAYSVKEIFLTLQGEGAQAGRRAVFCRFAGCNLWTGREQDRAKAICRFCDTDFVGTDGTL 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           G +Y +   LAD+I E W  G  + RY VLTGGEP+LQVD  LI AL+ RGF IA+E+NG
Sbjct: 61  GAKYRDAAALADVIAESWGPGS-DDRYVVLTGGEPMLQVDDALIDALHARGFTIAIESNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P+ IDWICVSPKAG +L    G ELKLV+PQ           DF    +QP+D   
Sbjct: 120 TLPIPRSIDWICVSPKAGSELVQSSGDELKLVWPQPGSDVAKLAALDFRHLLVQPLDDRN 179

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              N    I     +P+WRLS+QTHK +G+R
Sbjct: 180 AAANVQACIDLVMADPRWRLSLQTHKSLGLR 210


>gi|326795520|ref|YP_004313340.1| radical SAM protein [Marinomonas mediterranea MMB-1]
 gi|326546284|gb|ADZ91504.1| Radical SAM domain protein [Marinomonas mediterranea MMB-1]
          Length = 216

 Score =  245 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 112/216 (51%), Positives = 146/216 (67%), Gaps = 9/216 (4%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y++KE F +LQGEG HAGR A+FCRF+GCNLWSG+E+ RLSA C+FCDTDF G+ G  G
Sbjct: 1   MYNVKESFYSLQGEGAHAGRPAIFCRFTGCNLWSGKEKHRLSADCQFCDTDFNGVNGQNG 60

Query: 63  GRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GR+ + D+LA  I  QW  G    +Y V TGGEP LQ+D  LI A+   GF +A+ETNGT
Sbjct: 61  GRFKSADELAKHIANQWPQGH-GNKYVVFTGGEPALQLDQALISAVKSYGFMVAIETNGT 119

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           +  P  IDWICVSPK    L +  G ELK V+PQ N++P++Y G +FE F LQPMD   +
Sbjct: 120 LRLPDNIDWICVSPKTTDPLVVNAGNELKFVYPQTNLNPKDYEGLEFEHFYLQPMDLSAV 179

Query: 182 EE-------NTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +         +  + YC +NP WR+S+QTHK + I
Sbjct: 180 PKQNIIASDTQSATLKYCLENPLWRISLQTHKMLNI 215


>gi|126665591|ref|ZP_01736573.1| Organic radical activating enzyme [Marinobacter sp. ELB17]
 gi|126630219|gb|EBA00835.1| Organic radical activating enzyme [Marinobacter sp. ELB17]
          Length = 218

 Score =  245 bits (625), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 115/218 (52%), Positives = 138/218 (63%), Gaps = 11/218 (5%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y +KE F TLQGEG  AGR AVFCRFS CNLW+GRE+DR +A C FCDTDFVG  G  G
Sbjct: 1   MYRVKEAFYTLQGEGAQAGRAAVFCRFSKCNLWTGREKDRATAVCDFCDTDFVGTDGQNG 60

Query: 63  GRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G +   + LA  I   W        Y V TGGEPLLQ+D PLI AL++ GFEI VETNGT
Sbjct: 61  GVFATPEALAAHIAGLWPVA-PGKPYVVCTGGEPLLQLDSPLINALHQAGFEIGVETNGT 119

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           +  P GIDW+CVSPKA   + I+   ELKLV+PQ+   PE ++    + F L PM  P +
Sbjct: 120 LPAPAGIDWLCVSPKADAPVVIERCNELKLVYPQLKAMPERFLHIQADHFFLSPMASPSV 179

Query: 182 EE---------NTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E         NT  A  YC  NP+WRL++Q HK IGI
Sbjct: 180 PETSTDVIKQSNTRRATDYCLANPRWRLTLQMHKIIGI 217


>gi|46203559|ref|ZP_00209018.1| COG0602: Organic radical activating enzymes [Magnetospirillum
           magnetotacticum MS-1]
          Length = 229

 Score =  244 bits (623), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 120/209 (57%), Positives = 141/209 (67%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KE+F TLQGEG  AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG+ G  
Sbjct: 20  MSYAVKELFHTLQGEGAQAGRAAVFCRFAGCNLWSGREEDRAGAACRFCDTDFVGLDGEG 79

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGR+   +           G    RY V TGGEPLLQ+D  LI A++ RGFE+AVETNGT
Sbjct: 80  GGRFASAEALAGAIAATWAGGAAHRYVVFTGGEPLLQLDEALIAAVHARGFEVAVETNGT 139

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           +  P GIDWICVSPKAG  L    G ELKLV+PQ   +PE +    F    LQPMDGP  
Sbjct: 140 LAAPPGIDWICVSPKAGNALIQTSGDELKLVYPQAEAAPELFADLPFRHRFLQPMDGPEA 199

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             NT  A++YC  + +WRLS+QTHK IGI
Sbjct: 200 AANTAAAVAYCRADARWRLSLQTHKIIGI 228


>gi|120553050|ref|YP_957401.1| organic radical activating enzyme [Marinobacter aquaeolei VT8]
 gi|120322899|gb|ABM17214.1| organic radical activating enzyme [Marinobacter aquaeolei VT8]
          Length = 218

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 107/217 (49%), Positives = 135/217 (62%), Gaps = 9/217 (4%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y +KE F TLQGEG  AGR AVFCRFS CNLW+GRE+DR +A C FCDTDFVG  G  G
Sbjct: 1   MYRVKEAFYTLQGEGAQAGRAAVFCRFSKCNLWTGREKDRANAVCNFCDTDFVGTDGQNG 60

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
           GR++  +                 Y V TGGEPLLQ+D PLI+A ++ GFE+ VETNGT+
Sbjct: 61  GRFDTPEALAAHIRSLWPDAPGRPYVVCTGGEPLLQLDEPLIRAFHRAGFEVGVETNGTL 120

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P+GIDW+CVSPKA  ++ I    ELKLV+PQ    PE ++      + L PM  P + 
Sbjct: 121 PAPEGIDWLCVSPKADAEVVIAECDELKLVYPQPLAPPERFLHIRARHYFLSPMASPSVP 180

Query: 183 E---------NTNLAISYCFQNPKWRLSVQTHKFIGI 210
           E         NT  A  YC  +P+WRL++Q HK +GI
Sbjct: 181 EGGPDAIKQSNTRKATDYCLAHPQWRLTLQMHKILGI 217


>gi|307293826|ref|ZP_07573670.1| Radical SAM domain protein [Sphingobium chlorophenolicum L-1]
 gi|306879977|gb|EFN11194.1| Radical SAM domain protein [Sphingobium chlorophenolicum L-1]
          Length = 215

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 108/215 (50%), Positives = 141/215 (65%), Gaps = 5/215 (2%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KE+FLTLQGEG HAGR AVF RF+GCNLWSGREQDR +A C+FCDTDFVG  G  
Sbjct: 1   MSYAVKELFLTLQGEGVHAGRRAVFLRFAGCNLWSGREQDRATAICQFCDTDFVGTDGDG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GG++                  EGRY VLTGGEP+LQ+D  L+ AL+ RGF IAVE+NGT
Sbjct: 61  GGKFADADSLAEAALALWGEGAEGRYIVLTGGEPMLQIDDALVDALHARGFAIAVESNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVN-----VSPENYIGFDFERFSLQPM 176
           +    G+DW+C+SPKAG ++  + G ELKLV+PQ          E+  G+ F+   +QP+
Sbjct: 121 LPAHPGLDWVCISPKAGSEVVQRSGNELKLVWPQPGQGHGIADVEDMEGWAFDHLLVQPL 180

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           D P    N   A+      P+WRLS+Q+HK++G+R
Sbjct: 181 DDPDAARNAQAAVDLVLARPRWRLSLQSHKYLGLR 215


>gi|241761735|ref|ZP_04759822.1| organic radical activating enzymes-like protein [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241374043|gb|EER63576.1| organic radical activating enzymes-like protein [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 217

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 111/213 (52%), Positives = 143/213 (67%), Gaps = 5/213 (2%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y++KE FLTLQGEG  AGR AVF RF+GCNLW+GRE DR  A CRFCDTDFVGI G  GG
Sbjct: 5   YAVKESFLTLQGEGIQAGRRAVFIRFAGCNLWNGREDDREQATCRFCDTDFVGIDGENGG 64

Query: 64  RYNVDQLADLIEEQWITG-----EKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVET 118
           R+  ++LA+     W        +    + VLTGGEPLLQVD  L+ AL  + FEIA+ET
Sbjct: 65  RFTAEELAEQAIRLWKEALESRYQYVRPFVVLTGGEPLLQVDEALLLALKNQAFEIAIET 124

Query: 119 NGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDG 178
           NGT   P  IDW+C+SPKAG  + ++ G E+KLV+PQ  +  E     DF+ + +QPMD 
Sbjct: 125 NGTQPVPSAIDWVCMSPKAGSQIILEKGNEIKLVWPQKGIDIEALEKLDFDHYLIQPMDD 184

Query: 179 PFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            + +EN   AI++  Q P WRLS+Q+HK IG++
Sbjct: 185 EYQKENIQKAIAFVMQRPLWRLSIQSHKLIGVK 217


>gi|311696706|gb|ADP99579.1| organic radical activating enzyme [marine bacterium HP15]
          Length = 218

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 113/218 (51%), Positives = 141/218 (64%), Gaps = 11/218 (5%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y +KE F TLQGEG  AGR AVFCRFS CNLW+GRE+DR +A C FCDTDFVG  G  G
Sbjct: 1   MYRVKEAFYTLQGEGAQAGRAAVFCRFSKCNLWTGREKDRATAVCNFCDTDFVGTDGQNG 60

Query: 63  GRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GR+   ++LA  I   W        Y V TGGEPLLQ+D PLI+AL++ GFE+ VETNGT
Sbjct: 61  GRFETPEELARHIRNLWPEA-PGKPYVVCTGGEPLLQLDAPLIEALHREGFEVGVETNGT 119

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           +  P+GIDW+CVSPKA   + ++   ELKLV+PQ    PE ++G     + L PM  P +
Sbjct: 120 LPAPEGIDWLCVSPKADAPVVLEACDELKLVYPQPLAMPERFLGIRASHYFLSPMASPSI 179

Query: 182 EE---------NTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E         NT  A  YC  +P+WRL++Q HK IGI
Sbjct: 180 PETAVDEIKQSNTRRATDYCLAHPQWRLTLQMHKIIGI 217


>gi|188580423|ref|YP_001923868.1| radical SAM domain protein [Methylobacterium populi BJ001]
 gi|179343921|gb|ACB79333.1| Radical SAM domain protein [Methylobacterium populi BJ001]
          Length = 210

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 121/209 (57%), Positives = 142/209 (67%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KE+F TLQGEG  AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDF+G+ G  
Sbjct: 1   MSYAVKELFHTLQGEGAQAGRAAVFCRFAGCNLWSGREEDRAEAACRFCDTDFIGMDGEG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGR++  +           G K  RY V TGGEPLLQ+D  LI A++ RGFE+AVETNGT
Sbjct: 61  GGRFSDAEALAEAIAATWGGGKANRYVVFTGGEPLLQLDEALIAAVHARGFEVAVETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           +  P GIDWICVSPKAG  L    G ELKLVFPQ    PE +    F    LQPMDGP  
Sbjct: 121 LPAPPGIDWICVSPKAGNPLAQTSGDELKLVFPQAEALPERFADLPFRHHFLQPMDGPEA 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             NT  A++YC  + +WRLS+QTHK IGI
Sbjct: 181 AANTAAAVAYCRSDARWRLSLQTHKIIGI 209


>gi|114798300|ref|YP_759262.1| hypothetical protein HNE_0532 [Hyphomonas neptunium ATCC 15444]
 gi|114738474|gb|ABI76599.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 215

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 119/213 (55%), Positives = 136/213 (63%), Gaps = 5/213 (2%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KE F TLQGEG H GR AVF RF+GCNLWSG E+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYSVKEAFYTLQGEGAHTGRAAVFLRFAGCNLWSGLERDREKAVCRFCDTDFVGTNGEG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEG--RYCVLTGGEPLLQVDVPLIQALNKRGFEIAVET 118
           GG++     LA  IE  W      G   Y V TGGEPL+Q+D PLI AL++ GFEIA+ET
Sbjct: 61  GGKFREPGLLAAHIESIWQANASPGGRPYVVCTGGEPLMQLDEPLIGALHEAGFEIAIET 120

Query: 119 NGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQ--VNVSPENYIGFDFERFSLQPM 176
           NGT+  P  IDWICVSPKA   L  K G ELKLV+PQ      PE +   DFE F LQP 
Sbjct: 121 NGTLPAPASIDWICVSPKANAPLAQKSGNELKLVYPQTEPEAQPECFETLDFEHFFLQPR 180

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIG 209
           D      +     +YC +NPKWRLS+QTHK  G
Sbjct: 181 DDGPSVSHVAAVANYCLKNPKWRLSLQTHKLTG 213


>gi|260752296|ref|YP_003225189.1| hypothetical protein Za10_0051 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258551659|gb|ACV74605.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 217

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 111/213 (52%), Positives = 143/213 (67%), Gaps = 5/213 (2%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y++KE FLTLQGEG  AGR AVF RF+GCNLW+GRE DR  A CRFCDTDFVGI G  GG
Sbjct: 5   YAVKESFLTLQGEGIQAGRRAVFIRFAGCNLWNGREDDREQATCRFCDTDFVGIDGENGG 64

Query: 64  RYNVDQLADLIEEQWITG-----EKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVET 118
           R+  ++LA+     W        +    + VLTGGEPLLQVD  L+ AL  + FEIA+ET
Sbjct: 65  RFTAEELAEQAIRLWKEAIESRYQSVRPFVVLTGGEPLLQVDEALLLALKNQAFEIAIET 124

Query: 119 NGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDG 178
           NGT   P  IDW+C+SPKAG  + ++ G E+KLV+PQ  +  E     DF+ + +QPMD 
Sbjct: 125 NGTQPAPSAIDWVCMSPKAGSQIILEKGNEIKLVWPQKGIDIEALEKLDFDHYLIQPMDD 184

Query: 179 PFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            + +EN   AI++  Q P WRLS+Q+HK IG++
Sbjct: 185 EYQKENIQKAIAFVMQRPLWRLSIQSHKLIGVK 217


>gi|56552191|ref|YP_163030.1| organic radical activating-like protein [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|56543765|gb|AAV89919.1| organic radical activating-like protein [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 217

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 111/213 (52%), Positives = 143/213 (67%), Gaps = 5/213 (2%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y++KE FLTLQGEG  AGR AVF RF+GCNLW+GRE DR  A CRFCDTDFVGI G  GG
Sbjct: 5   YAVKESFLTLQGEGIQAGRRAVFIRFAGCNLWNGREDDREQATCRFCDTDFVGIDGENGG 64

Query: 64  RYNVDQLADLIEEQWITG-----EKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVET 118
           R+  ++LA+     W        +    + VLTGGEPLLQVD  L+ AL  + FEIA+ET
Sbjct: 65  RFTAEELAEQAIRLWKEAIESRYQSVRPFVVLTGGEPLLQVDEALLLALKNQAFEIAIET 124

Query: 119 NGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDG 178
           NGT   P  IDW+C+SPKAG  + ++ G E+KLV+PQ  +  E     DF+ + +QPMD 
Sbjct: 125 NGTQPVPSAIDWVCMSPKAGSQIILEKGNEIKLVWPQKGIDIEALEKLDFDHYLIQPMDD 184

Query: 179 PFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            + +EN   AI++  Q P WRLS+Q+HK IG++
Sbjct: 185 EYQKENIQKAIAFVMQRPLWRLSIQSHKLIGVK 217


>gi|152968324|ref|YP_001364108.1| hypothetical protein Krad_4381 [Kineococcus radiotolerans SRS30216]
 gi|151362841|gb|ABS05844.1| conserved hypothetical protein [Kineococcus radiotolerans SRS30216]
          Length = 237

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 118/236 (50%), Positives = 144/236 (61%), Gaps = 27/236 (11%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y +KEIF TLQGEG HAGR AVFCRFS CNLW+GRE+DR  A C FCDTDFVG  G  
Sbjct: 1   MTYLLKEIFYTLQGEGTHAGRPAVFCRFSRCNLWTGREKDRARAICTFCDTDFVGTDGVG 60

Query: 62  GGRY---------------------NVDQLADLIEEQWITGEKEGRY------CVLTGGE 94
           GGR+                     +    + +  E   +      +       V TGGE
Sbjct: 61  GGRFATADDLAAAVDASWPAAGLTDDFTDGSAITAESDSSAHSHAPHGAQRKFVVCTGGE 120

Query: 95  PLLQVDVPLIQALNKRGFEIAVETNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFP 154
           PLLQ+D   +QAL++RGFE+AVETNGT  PP GIDW+CVSPK G DL +  G ELKLV+P
Sbjct: 121 PLLQLDDAAVQALHQRGFEVAVETNGTRTPPPGIDWLCVSPKIGADLVVSRGDELKLVYP 180

Query: 155 QVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           Q    P  +   DF  F LQPMDGP ++ +T  AI YC  +P+W LS+QTHK++GI
Sbjct: 181 QAGGDPAQFAELDFTSFRLQPMDGPDVQAHTRAAIDYCLTHPQWSLSMQTHKYLGI 236


>gi|88800853|ref|ZP_01116408.1| Organic radical activating enzyme [Reinekea sp. MED297]
 gi|88776426|gb|EAR07646.1| Organic radical activating enzyme [Reinekea sp. MED297]
          Length = 217

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 104/217 (47%), Positives = 139/217 (64%), Gaps = 9/217 (4%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KE+F TLQGEG H GR AVFCRFSGCNLW+GRE+DR ++ CRFCDTDFVG  G  
Sbjct: 1   MTYSVKEMFYTLQGEGFHTGRPAVFCRFSGCNLWNGREKDRATSICRFCDTDFVGTDGQN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++    +LA  I + W   +   R+ V TGGEP LQ+D  LI AL+  GFE AVE+NG
Sbjct: 61  GGKFREARELAQRIADFWPADQA-HRFVVFTGGEPALQLDETLIAALHDVGFECAVESNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P  +DW+C+SPK   ++ I+   ELKLVFPQ +  PE +     +   L P++   
Sbjct: 120 TLPLPPSLDWVCISPKGSAEVVIEACDELKLVFPQADAQPERFSHIHAQHRFLSPLNDWT 179

Query: 181 LEE-------NTNLAISYCFQNPKWRLSVQTHKFIGI 210
             +       NT   + YC ++P+WRL++QTHK + I
Sbjct: 180 QAQLSPAQNNNTQACVQYCLEHPQWRLTLQTHKVLNI 216


>gi|145589599|ref|YP_001156196.1| radical SAM domain-containing protein [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|145048005|gb|ABP34632.1| Radical SAM domain protein [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 217

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 119/217 (54%), Positives = 154/217 (70%), Gaps = 8/217 (3%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y++KEIF TLQGEG HAGR AVFCRF+GCNLWSGRE+DR +A C+FCDTDFVG  G  G
Sbjct: 1   MYTVKEIFPTLQGEGAHAGRAAVFCRFAGCNLWSGREEDRATAICQFCDTDFVGSDGLGG 60

Query: 63  GRY-NVDQLADLIEEQWI--TGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
           G++   + LA+ IE  W   +   + RY V TGGEPLLQ+D  LI+ L+K+GFE+A+ETN
Sbjct: 61  GKFETANDLANAIELAWKSTSAGPQQRYVVFTGGEPLLQLDEVLIEVLHKKGFEVAIETN 120

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQ-----VNVSPENYIGFDFERFSLQ 174
           GT++ P+G+DW+CVSPKAG +L +    E+KLV PQ     +      +   D+    LQ
Sbjct: 121 GTLKVPKGVDWVCVSPKAGAELIVLQANEMKLVVPQNGHESLEQLMGRFEKMDYRNRFLQ 180

Query: 175 PMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           PMDGP L+ NT LA+  C + P WRLS+Q+HK IGIR
Sbjct: 181 PMDGPNLKSNTELAVGLCQKRPLWRLSIQSHKLIGIR 217


>gi|332188914|ref|ZP_08390617.1| hypothetical protein SUS17_4029 [Sphingomonas sp. S17]
 gi|332011054|gb|EGI53156.1| hypothetical protein SUS17_4029 [Sphingomonas sp. S17]
          Length = 210

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 112/210 (53%), Positives = 143/210 (68%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KE+FLTLQGEG  AGR AVF RF+GCNLWSGREQDR SA CRFCDTDFVG+ G  
Sbjct: 1   MSYAVKEMFLTLQGEGVQAGRRAVFVRFAGCNLWSGREQDRASAICRFCDTDFVGVDGLG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGR+          E +   E+  R+ VLTGGEP+LQVD  L+ AL+  GF IA+E+NGT
Sbjct: 61  GGRFADAGALVAAVEGFWGPERAERFVVLTGGEPMLQVDDALVDALHDAGFFIAIESNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           I     +DW+C+SPKAG ++  + GQELKLV+PQ  + P    G+DF    LQP+D P  
Sbjct: 121 IAAHPRLDWVCISPKAGSEVVQRSGQELKLVWPQAGIDPAEVEGWDFANHLLQPLDDPRA 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           E N    I+   + P+WRL++QTHK +G+R
Sbjct: 181 EANREACIAMVMERPRWRLTLQTHKMLGLR 210


>gi|326330124|ref|ZP_08196435.1| GntS [Nocardioidaceae bacterium Broad-1]
 gi|325951937|gb|EGD43966.1| GntS [Nocardioidaceae bacterium Broad-1]
          Length = 211

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 115/210 (54%), Positives = 139/210 (66%), Gaps = 1/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y +KEIF TLQGEG HAGR AVFCRF+ CNLW+GRE+DR  A C+FCDT FVG  G  
Sbjct: 1   MTYKVKEIFYTLQGEGTHAGRPAVFCRFTSCNLWTGREKDRDRAICKFCDTAFVGTDGEG 60

Query: 62  GGRYNVDQLADLIE-EQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++            +W  G       V TGGEPLLQ+D   + A+   GF +AVETNG
Sbjct: 61  GGKFADAAALAAAVASKWPMGTDGQPMVVCTGGEPLLQLDDAAVAAMKAAGFYVAVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TI PP GIDW+CVSPK G DL ++ GQELK V PQ +V P  +   DFE F +QPMDGP 
Sbjct: 121 TILPPAGIDWLCVSPKIGSDLVVESGQELKFVVPQADVDPTTFEALDFESFRVQPMDGPD 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           L  NT  A+ +C ++P+W LS QTHKF+GI
Sbjct: 181 LAANTEYAVKFCLEHPRWHLSTQTHKFLGI 210


>gi|83309346|ref|YP_419610.1| organic radical activating protein [Magnetospirillum magneticum
           AMB-1]
 gi|82944187|dbj|BAE49051.1| Organic radical activating enzyme [Magnetospirillum magneticum
           AMB-1]
          Length = 202

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 115/209 (55%), Positives = 143/209 (68%), Gaps = 8/209 (3%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y+++EIF +LQGEG  AGR AVF RF+GCNLWSGRE DR +A CRFCDTDFVG     
Sbjct: 1   MSYTVREIFHSLQGEGVQAGRPAVFLRFAGCNLWSGREADRETATCRFCDTDFVG----- 55

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G +Y   Q    + E         RY V+TGGEP LQ+D  L++AL+  GFE+A+ETNGT
Sbjct: 56  GEKYPDAQG---LAEAVKAVGGATRYVVVTGGEPGLQLDGALVEALHGLGFEVAIETNGT 112

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           +E P G+DW+CVSPKAG  LK+  G ELKLVFPQ    P ++   DF  F LQPMDGP  
Sbjct: 113 VELPSGLDWVCVSPKAGTTLKVTRGDELKLVFPQAGAMPGDFEHLDFAYFLLQPMDGPER 172

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           + +T  AI +C  +P+WRLS+QTHK +GI
Sbjct: 173 DAHTRAAIGHCLTHPRWRLSLQTHKIVGI 201


>gi|329851462|ref|ZP_08266219.1| hypothetical protein ABI_43030 [Asticcacaulis biprosthecum C19]
 gi|328840308|gb|EGF89880.1| hypothetical protein ABI_43030 [Asticcacaulis biprosthecum C19]
          Length = 210

 Score =  240 bits (614), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 120/210 (57%), Positives = 144/210 (68%), Gaps = 1/210 (0%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +YS KEIFLTLQGEGG AGRV VF RF+GCNLWSGREQDR +A C FCDTDFVG  G  G
Sbjct: 1   MYSFKEIFLTLQGEGGQAGRVNVFARFAGCNLWSGREQDRATAACDFCDTDFVGTDGENG 60

Query: 63  GRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GR+     +   ++  W  G   G+  V TGGEPLLQ+D  LI A+   G+ IAVETNGT
Sbjct: 61  GRFPTPADVVAALDAVWGEGRAAGKAVVFTGGEPLLQLDSDLIAAVKAAGYFIAVETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           ++ P GIDW+CVSPK    L    GQELKLV+PQ NV P +++   FERF LQP D P  
Sbjct: 121 LKAPAGIDWVCVSPKGQNRLHQTSGQELKLVWPQENVDPSDFLEMQFERFYLQPKDNPRQ 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             NT   I YC  +P+WR+SVQTHK +G++
Sbjct: 181 AANTQAVIDYCLLHPQWRMSVQTHKLVGLK 210


>gi|307545033|ref|YP_003897512.1| hypothetical protein HELO_2443 [Halomonas elongata DSM 2581]
 gi|307217057|emb|CBV42327.1| hypothetical protein HELO_2443 [Halomonas elongata DSM 2581]
          Length = 214

 Score =  240 bits (613), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 116/213 (54%), Positives = 140/213 (65%), Gaps = 5/213 (2%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +YS+KE F +LQGEGG AGR +VFCRF+GCNLWSGRE DR+SA CRFCDTDF G  G  G
Sbjct: 1   MYSVKEAFYSLQGEGGQAGRASVFCRFAGCNLWSGREADRVSAACRFCDTDFRGTDGQNG 60

Query: 63  GRY-NVDQLADLIEEQWITGEKEGR-YCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GR+ + + LA+ +   W       R   + TGGEPLLQ+D  LI A++ R F++AVETNG
Sbjct: 61  GRFADAETLAEHLVGLWEGAPDGSRPQVIFTGGEPLLQLDDALIAAMHDREFDVAVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P GIDW+CVSPK    L    G ELKLV PQ    PE + G DF  F LQPMD   
Sbjct: 121 TLAAPAGIDWLCVSPKGDVPLVQTRGDELKLVHPQPEAPPERFTGLDFRHFFLQPMDTSP 180

Query: 181 LEE---NTNLAISYCFQNPKWRLSVQTHKFIGI 210
           L E        ++YC  NP+WRLS+QTHK  GI
Sbjct: 181 LGETRDTMAATVAYCLANPRWRLSLQTHKIAGI 213


>gi|149377359|ref|ZP_01895104.1| Organic radical activating enzyme [Marinobacter algicola DG893]
 gi|149358371|gb|EDM46848.1| Organic radical activating enzyme [Marinobacter algicola DG893]
          Length = 218

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 108/218 (49%), Positives = 134/218 (61%), Gaps = 11/218 (5%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y +KE F TLQGEG  AGR AVFCRFS CNLW+GRE+DR +A C FCDTDFVG  G  G
Sbjct: 1   MYRVKEAFYTLQGEGAQAGRAAVFCRFSKCNLWTGREKDRANAVCSFCDTDFVGTDGQNG 60

Query: 63  GRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G++   D LA  I   W        Y V TGGEPLLQ+D  L+ A ++ GFE+ VETNGT
Sbjct: 61  GQFETADALAAHIRRLWPDA-PGRPYVVCTGGEPLLQLDDQLVDAFHRAGFEVGVETNGT 119

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           +  P GIDW+CVSPKA   + ++   ELK+V+PQ    PE +       + L PM  P +
Sbjct: 120 LPAPSGIDWLCVSPKADAPVVLRQCDELKVVYPQPLAMPERFTDIQASHYFLSPMASPTV 179

Query: 182 EE---------NTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E         NT  A  YC  +P+WRL++Q HK IGI
Sbjct: 180 SEGEPDPIKQSNTRKATDYCLTHPRWRLTLQMHKIIGI 217


>gi|294013047|ref|YP_003546507.1| putative organic radical activating enzyme [Sphingobium japonicum
           UT26S]
 gi|292676377|dbj|BAI97895.1| putative organic radical activating enzyme [Sphingobium japonicum
           UT26S]
          Length = 215

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 109/215 (50%), Positives = 145/215 (67%), Gaps = 5/215 (2%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KE+FLTLQGEG HAGR AVF RF+GCNLW+GREQDR SA CRFCDTDFVG  G  
Sbjct: 1   MSYAVKEMFLTLQGEGVHAGRRAVFLRFAGCNLWTGREQDRASAVCRFCDTDFVGTDGDG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGR+                 ++GRY VLTGGEP+LQVD  L+ AL+ RGF IA+E+NGT
Sbjct: 61  GGRFADADGLADAALALWGEGRDGRYIVLTGGEPMLQVDDALVDALHARGFAIAIESNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVN-----VSPENYIGFDFERFSLQPM 176
           +    G+DW+C+SPKAG ++  + G ELKLV+PQ          E+  G+ F+ + +QP+
Sbjct: 121 LPAHPGLDWVCISPKAGSEVVQRSGNELKLVWPQPGQGHSLADVEDMEGWAFDHWLVQPL 180

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           D P   +N   A+    + P+WRLS+Q+HK++G+R
Sbjct: 181 DDPKAADNARAAVELVMERPRWRLSLQSHKYLGLR 215


>gi|241766442|ref|ZP_04764315.1| conserved hypothetical protein [Acidovorax delafieldii 2AN]
 gi|241363364|gb|EER58879.1| conserved hypothetical protein [Acidovorax delafieldii 2AN]
          Length = 211

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 115/211 (54%), Positives = 134/211 (63%), Gaps = 1/211 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIF TLQGEGG AG  AVFCRF+GCNLW+GREQDR  A C+FCDTDFVG  GT 
Sbjct: 1   MTYSVKEIFYTLQGEGGQAGTPAVFCRFAGCNLWTGREQDRAQAICQFCDTDFVGTDGTL 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GG++                    R  VLTGGEPLLQVD  LI AL+ + F IAVE+NGT
Sbjct: 61  GGKFETAAALAQSIAAQWPAGAGHRLVVLTGGEPLLQVDSELIAALHAQQFRIAVESNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSP-ENYIGFDFERFSLQPMDGPF 180
           +  P+GIDW+C+SPKAG     + GQELKLV+PQ             F    LQPMDGP 
Sbjct: 121 VAAPEGIDWLCISPKAGAPFVQRSGQELKLVWPQPGFDLGALERETHFTHRFLQPMDGPL 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             +NT   I+ C  +P WRLS+QTHK  GIR
Sbjct: 181 QRQNTAACIAACLAHPAWRLSLQTHKLTGIR 211


>gi|317486302|ref|ZP_07945134.1| radical SAM domain-containing protein [Bilophila wadsworthia 3_1_6]
 gi|316922472|gb|EFV43726.1| radical SAM domain-containing protein [Bilophila wadsworthia 3_1_6]
          Length = 218

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 109/215 (50%), Positives = 135/215 (62%), Gaps = 7/215 (3%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y +KEIF TLQGEG  AGR AVFCRFSGCNLWSGR +DR +A+CRFCDTDFVG     
Sbjct: 6   MAYRVKEIFYTLQGEGAQAGRPAVFCRFSGCNLWSGRPEDRATAKCRFCDTDFVGADA-- 63

Query: 62  GGRYNVDQLADLIEEQWITGEKEG-----RYCVLTGGEPLLQVDVPLIQALNKRGFEIAV 116
           G     ++LA  I   +     +       Y V TGGEP LQ+   LI  L+  GFE+ V
Sbjct: 64  GVFATAEELAQTIAATFPVLAPQAYGGRKPYIVFTGGEPALQLTRELIDRLHALGFELGV 123

Query: 117 ETNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPM 176
           E+NGT+  P+G+DWI VSPK    L    G ELKLV+PQ   SPE++   DF  F LQP 
Sbjct: 124 ESNGTLPLPEGLDWITVSPKGSNPLATTSGHELKLVWPQQGCSPEDFEDLDFRHFLLQPC 183

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           D P  + NT   I+YC  +P+W L +QTHK++G+R
Sbjct: 184 DDPRNKANTRECIAYCLLHPRWSLGLQTHKWVGVR 218


>gi|87122356|ref|ZP_01078237.1| hypothetical protein MED121_00365 [Marinomonas sp. MED121]
 gi|86162331|gb|EAQ63615.1| hypothetical protein MED121_00365 [Marinomonas sp. MED121]
          Length = 216

 Score =  238 bits (608), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 105/215 (48%), Positives = 140/215 (65%), Gaps = 7/215 (3%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +YSIKE F +LQGEG  AGR ++FCRFSGCNLW+G+E  R  + C+FCDTDF+G+ G  G
Sbjct: 1   MYSIKEAFYSLQGEGAQAGRPSIFCRFSGCNLWNGKETHRFDSLCQFCDTDFIGVDGQNG 60

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
           G++   +   L  +     ++  +Y V TGGEP LQ+D  LI A+ + G+ I +ETNGT 
Sbjct: 61  GKFKQAKTLALHLDALWPNDQSDKYVVFTGGEPALQLDAALILAMKEMGYVIGIETNGTK 120

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P GIDWICVSPK   +L I+ G ELKLV+PQ +++P  Y   DF+ F LQPMD   L 
Sbjct: 121 PLPDGIDWICVSPKTADELVIQQGHELKLVYPQSHLNPNKYTHLDFDTFYLQPMDQSHLP 180

Query: 183 EN-------TNLAISYCFQNPKWRLSVQTHKFIGI 210
           ++           ++YC  NPKWRLS+QTHK + I
Sbjct: 181 KDRISPESTLKQTLNYCLANPKWRLSLQTHKILEI 215


>gi|92114161|ref|YP_574089.1| hypothetical protein Csal_2039 [Chromohalobacter salexigens DSM
           3043]
 gi|91797251|gb|ABE59390.1| conserved hypothetical protein [Chromohalobacter salexigens DSM
           3043]
          Length = 215

 Score =  238 bits (607), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 116/215 (53%), Positives = 143/215 (66%), Gaps = 8/215 (3%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +YS+KE F TLQGEG  AGR +VFCRF+GCNLWSGRE+DR  ++CRFCDTDFVG  G  G
Sbjct: 1   MYSVKEAFYTLQGEGARAGRASVFCRFTGCNLWSGRERDRAQSRCRFCDTDFVGTDGQNG 60

Query: 63  GRY-NVDQLADLIEEQWITGEKEG--RYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
           GR+ +   LA  +   W   +      Y V TGGEPLLQ+D  LI A+   GFE+AVETN
Sbjct: 61  GRFADAHALATHLHRLWPGTDDTAATPYVVFTGGEPLLQLDTALITAMRAHGFEVAVETN 120

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMD-- 177
           GT+ PP GIDW+CVSPK    L+I  G ELKLV+PQ +  P N+   DF  F LQPMD  
Sbjct: 121 GTLTPPDGIDWLCVSPKGDAPLRITQGDELKLVYPQDDAPPANFTHLDFAHFFLQPMDLA 180

Query: 178 --GPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             G      T+  ++YC  +P+WRL++QTHK  GI
Sbjct: 181 PRGGQGTTMTD-TVAYCLDHPQWRLALQTHKIAGI 214


>gi|78485139|ref|YP_391064.1| hypothetical protein Tcr_0794 [Thiomicrospira crunogena XCL-2]
 gi|78363425|gb|ABB41390.1| conserved hypothetical protein [Thiomicrospira crunogena XCL-2]
          Length = 218

 Score =  237 bits (605), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 109/215 (50%), Positives = 142/215 (66%), Gaps = 8/215 (3%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y IKE F +LQGEG H+GR A+FCRF+ CNLW+GRE DR +A C+FCDTDF+G  G  GG
Sbjct: 3   YRIKEAFYSLQGEGFHSGRPAIFCRFTNCNLWTGREADRSNAVCQFCDTDFLGTDGQNGG 62

Query: 64  RY-NVDQLADLIEEQWITGEK----EGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVET 118
            + + D LA  +   W T +        + VLTGGEPLLQVD  LI   ++ GFEIAVET
Sbjct: 63  SFKDADSLAKHLLALWPTDKNDQACPHPFVVLTGGEPLLQVDQTLIDVFHQHGFEIAVET 122

Query: 119 NGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDG 178
           NGT + P+ IDWICVSPKA   L +  G ELKLV+PQ  + P+     +F+ F LQ MD 
Sbjct: 123 NGTQKAPKNIDWICVSPKANAPLILDSGDELKLVYPQTELRPKQVETLNFKHFYLQAMDD 182

Query: 179 PF---LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                 E+N    ++YC ++P+W+LS+QTHK +G+
Sbjct: 183 ADPDIQEKNLKETLAYCLKHPQWKLSLQTHKILGV 217


>gi|152996126|ref|YP_001340961.1| hypothetical protein Mmwyl1_2104 [Marinomonas sp. MWYL1]
 gi|150837050|gb|ABR71026.1| conserved hypothetical protein [Marinomonas sp. MWYL1]
          Length = 216

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 108/216 (50%), Positives = 139/216 (64%), Gaps = 9/216 (4%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +YSIKE F +LQGEG HAGR A+FCRF+GCNLWSG E+ R +++C+FCDTDF+G  G  G
Sbjct: 1   MYSIKEAFYSLQGEGAHAGRPALFCRFTGCNLWSGSEKTRATSECQFCDTDFIGTNGQHG 60

Query: 63  GRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G++    QL   ++  W  G+   +Y V TGGEP LQ+D  +I  +   G+ IA+ETNGT
Sbjct: 61  GKFKTAGQLRTHLDALWPVGQ-GHKYVVFTGGEPALQLDNAIISEMKLYGYTIAIETNGT 119

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           I  P GIDWICVSPK    L +  G ELKLV+PQ ++SPE +   DF  F LQPMD   L
Sbjct: 120 IALPDGIDWICVSPKTNKPLVVNKGDELKLVYPQSHLSPELFEALDFTNFYLQPMDQSHL 179

Query: 182 EEN-------TNLAISYCFQNPKWRLSVQTHKFIGI 210
                         + YC  +P+WRLS+QTHK + I
Sbjct: 180 TAEQIPLLDTQQATLHYCLSHPRWRLSLQTHKMLNI 215


>gi|170744629|ref|YP_001773284.1| radical SAM domain-containing protein [Methylobacterium sp. 4-46]
 gi|168198903|gb|ACA20850.1| Radical SAM domain protein [Methylobacterium sp. 4-46]
          Length = 210

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 116/209 (55%), Positives = 141/209 (67%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG  AGR AVFCRF+GCNLWSGRE DR  A C FCDTDFVG  G  
Sbjct: 1   MSYAVKEIFHTLQGEGAQAGRAAVFCRFAGCNLWSGREADRAEAVCHFCDTDFVGTDGAG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGR+   +           G     + V TGGEPLLQ+D  L+ A+  RGF  AVETNGT
Sbjct: 61  GGRFPDAEALAAAIAAAWEGGPRNHFVVFTGGEPLLQLDAALLAAVRARGFAAAVETNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
            E P+G+DWICVSPKAG  L++  G ELKLV+PQ  ++PE+  G DF  F LQPMDGP  
Sbjct: 121 QEAPEGLDWICVSPKAGAPLRLTRGDELKLVYPQAGLAPEDVAGLDFRHFFLQPMDGPDR 180

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             +   A+++C ++ +WRLS+QTHK IGI
Sbjct: 181 AAHLAAAVAHCRRDARWRLSLQTHKLIGI 209


>gi|226940051|ref|YP_002795124.1| Organic radical activating enzyme [Laribacter hongkongensis HLHK9]
 gi|226714977|gb|ACO74115.1| Organic radical activating enzyme [Laribacter hongkongensis HLHK9]
          Length = 209

 Score =  235 bits (601), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 117/210 (55%), Positives = 137/210 (65%), Gaps = 1/210 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG H+GR AVFCRF+GCNLWSGRE DR  A C+FCDTDFVG     
Sbjct: 1   MTYTVKEIFHTLQGEGVHSGRAAVFCRFTGCNLWSGRETDRAQATCQFCDTDFVGTGPDG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G      +LA  I + W  G     Y V TGGEPLLQ+D  LI+A++ RGFE+ VETNGT
Sbjct: 61  GKFACARELAGRIADSW-AGTGGTPYVVFTGGEPLLQLDEELIEAMHARGFEVGVETNGT 119

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           I  P GIDW+CVSPKAG     K G ELKLV+PQ  + PE      F R+ LQPMDGP  
Sbjct: 120 IPAPPGIDWLCVSPKAGSGWVQKQGDELKLVYPQPGLLPETVELTGFSRYWLQPMDGPEQ 179

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             +   AI +C  +P W LS+Q HK  GIR
Sbjct: 180 TMHIKAAIGFCLLHPDWHLSLQNHKLAGIR 209


>gi|315499628|ref|YP_004088431.1| radical sam domain protein [Asticcacaulis excentricus CB 48]
 gi|315417640|gb|ADU14280.1| Radical SAM domain protein [Asticcacaulis excentricus CB 48]
          Length = 216

 Score =  235 bits (601), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 116/216 (53%), Positives = 141/216 (65%), Gaps = 6/216 (2%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
            +YS KEIFLTLQGEGG AGRVAVF RF+GCNLWSGREQDR +A C FCDTDFVG  G  
Sbjct: 1   MVYSFKEIFLTLQGEGGQAGRVAVFARFAGCNLWSGREQDRATAACTFCDTDFVGTDGEG 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++   +     ++  W   +   +  V TGGEPLLQ+D PLI A+   G+ IAVE+NG
Sbjct: 61  GGKFDTPEAAVAALDAHWGQIDPAHKSVVFTGGEPLLQLDAPLIAAVKSAGYFIAVESNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T+  P GIDW+C+SPK    L    GQELKLV+PQ  V P  +   DFERF LQP D   
Sbjct: 121 TLRAPIGIDWLCISPKGENRLHQTSGQELKLVWPQDRVDPAEFARMDFERFYLQPKDPLD 180

Query: 181 -----LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
                   +T   I YC  +P+WR+SVQTHK +G+R
Sbjct: 181 QNPAMRAAHTQAVIDYCLAHPQWRMSVQTHKVVGVR 216


>gi|149926775|ref|ZP_01915035.1| hypothetical protein LMED105_08825 [Limnobacter sp. MED105]
 gi|149824704|gb|EDM83920.1| hypothetical protein LMED105_08825 [Limnobacter sp. MED105]
          Length = 216

 Score =  235 bits (601), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 109/214 (50%), Positives = 139/214 (64%), Gaps = 5/214 (2%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M  Y++KE+F TLQGEG  AGR AVFCRF+GCNLW+GRE+DR +A C+FCDTDFVG  G 
Sbjct: 1   MATYTVKEMFYTLQGEGAQAGRAAVFCRFAGCNLWTGREEDRATAVCKFCDTDFVGTDGV 60

Query: 61  KGGRY-NVDQLADLIEEQWITGEKEGR-YCVLTGGEPLLQVDVPLIQALNKRGFEIAVET 118
            GG++ +   LA  I + +  G    + Y V TGGEP LQ+D  LI A++ +GFEIA+ET
Sbjct: 61  GGGKFKDAVALAQAIADTYQGGLGTAKPYVVFTGGEPTLQLDSALIDAVHAQGFEIAIET 120

Query: 119 NGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDG 178
           NGT+  P+G+DWICVSPK G +L    G ELK+V PQ+           F+ + +Q MD 
Sbjct: 121 NGTLPVPEGVDWICVSPKFGSELVQTRGHELKVVVPQLGQDLNALGQLQFDHYFVQAMDD 180

Query: 179 PF---LEENTNLAISYCFQNPKWRLSVQTHKFIG 209
                  +N   AI  C   P+WRLSVQTHK IG
Sbjct: 181 TDPAKKAKNMQAAIQTCLNKPQWRLSVQTHKVIG 214


>gi|218886225|ref|YP_002435546.1| radical SAM protein [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218757179|gb|ACL08078.1| radical SAM domain protein [Desulfovibrio vulgaris str. 'Miyazaki
           F']
          Length = 224

 Score =  233 bits (594), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 107/222 (48%), Positives = 133/222 (59%), Gaps = 14/222 (6%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y +KEIF +LQGEG HAGR AVFCRFSGCNLW+GREQDR  A CRFCDTDF G  G  GG
Sbjct: 3   YRVKEIFHSLQGEGVHAGRAAVFCRFSGCNLWTGREQDRPDAACRFCDTDFTGTDGPGGG 62

Query: 64  RYNVDQLADLIEEQW-------ITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAV 116
            +   Q                + G     Y V TGGEP LQ+   L+ AL+  G +  V
Sbjct: 63  VFEDAQALAAAILAAFPYPLAPLDGGGWRPYVVFTGGEPALQLTPELLDALHAHGCQCGV 122

Query: 117 ETNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPM 176
           ETNGT+  P G+DW+ VSPKAG  L +  G ELKLV+PQ  V P ++ G DF  F LQP 
Sbjct: 123 ETNGTLPLPAGLDWVTVSPKAGTRLAVTRGDELKLVWPQDGVDPADFAGLDFGHFILQPR 182

Query: 177 DG-------PFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           D            ++    + +C ++P+WRL +QTHK++GIR
Sbjct: 183 DDAARGAGAQAGADHIAACVRHCLEHPRWRLGLQTHKYLGIR 224


>gi|120601647|ref|YP_966047.1| hypothetical protein Dvul_0597 [Desulfovibrio vulgaris DP4]
 gi|120561876|gb|ABM27620.1| conserved hypothetical protein [Desulfovibrio vulgaris DP4]
          Length = 216

 Score =  229 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 109/215 (50%), Positives = 135/215 (62%), Gaps = 6/215 (2%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y +KEIF TLQGEG  AGR AVFCRFSGCNLW+GR QDR +A C FCDTDFVG  G  
Sbjct: 1   MTYRVKEIFHTLQGEGMRAGRAAVFCRFSGCNLWTGRAQDRPAAVCPFCDTDFVGTDGPG 60

Query: 62  GGRYNVDQLADLIEEQ---WITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVET 118
           GG +               + TGE    Y V TGGEP LQ+D PLI  L+  G E+A+ET
Sbjct: 61  GGVFEDAATLAAAILAAFPYKTGEGYRPYVVFTGGEPALQLDRPLIDILHAHGCEVAIET 120

Query: 119 NGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDG 178
           NGT+  P+GIDW+ VSPKAG  L +  G ELKLV+PQ  + PE+Y    F    +QP DG
Sbjct: 121 NGTVRLPEGIDWVTVSPKAGTRLAVTSGDELKLVWPQQGICPESYESLAFTYLLMQPRDG 180

Query: 179 PFLE---ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                  +  + A+ +C  +P+WRL +QTHK++GI
Sbjct: 181 LGDAGRGDAESEAVRWCLAHPRWRLCLQTHKYLGI 215


>gi|46581062|ref|YP_011870.1| hypothetical protein DVU2658 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46450483|gb|AAS97130.1| conserved hypothetical protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311234739|gb|ADP87593.1| Radical SAM domain protein [Desulfovibrio vulgaris RCH1]
          Length = 216

 Score =  227 bits (580), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 108/215 (50%), Positives = 134/215 (62%), Gaps = 6/215 (2%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y +KEIF TLQGEG  AGR AVFCRFSGCNLW+G  QDR +A C FCDTDFVG  G  
Sbjct: 1   MTYRVKEIFHTLQGEGMRAGRAAVFCRFSGCNLWTGWAQDRPAAVCPFCDTDFVGTDGPG 60

Query: 62  GGRYNVDQLADLIEEQ---WITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVET 118
           GG +               + TGE    Y V TGGEP LQ+D PLI  L+  G E+A+ET
Sbjct: 61  GGVFEDAATLAAAILAAFPYKTGEGYRPYVVFTGGEPALQLDRPLIDILHAHGCEVAIET 120

Query: 119 NGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDG 178
           NGT+  P+GIDW+ VSPKAG  L +  G ELKLV+PQ  + PE+Y    F    +QP DG
Sbjct: 121 NGTVRLPEGIDWVTVSPKAGTRLAVTSGDELKLVWPQQGICPESYESLAFTYLLMQPRDG 180

Query: 179 PFLE---ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                  +  + A+ +C  +P+WRL +QTHK++GI
Sbjct: 181 LGDAGRGDAESEAVRWCLAHPRWRLCLQTHKYLGI 215


>gi|46200887|ref|ZP_00056296.2| COG0602: Organic radical activating enzymes [Magnetospirillum
           magnetotacticum MS-1]
          Length = 202

 Score =  226 bits (577), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 116/209 (55%), Positives = 142/209 (67%), Gaps = 8/209 (3%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y+++EIF +LQGEG  AGR AVF RFSGCNLWSGR++DR  A CRFCDTDFVG     
Sbjct: 1   MSYTVREIFHSLQGEGVQAGRAAVFLRFSGCNLWSGRQEDRAKAVCRFCDTDFVG----- 55

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G +Y+  Q    + E         RY V+TGGEP LQ+D  LI AL+  GF +AVETNGT
Sbjct: 56  GVKYSDAQS---LAEAVKAVGGSTRYVVVTGGEPGLQLDETLIHALHGLGFSVAVETNGT 112

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           +  P G+DW+CVSPKAG +L +  G ELKLVFPQ   +PE +   DF  F LQPMDGP  
Sbjct: 113 LGLPSGLDWVCVSPKAGTELMVTRGDELKLVFPQDGAAPEAFEHLDFAHFLLQPMDGPDR 172

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             NT  AI++C  +P+WRLS+QTHK +GI
Sbjct: 173 AANTAAAIAHCLTHPRWRLSLQTHKIVGI 201


>gi|121608068|ref|YP_995875.1| hypothetical protein Veis_1081 [Verminephrobacter eiseniae EF01-2]
 gi|121552708|gb|ABM56857.1| conserved hypothetical protein [Verminephrobacter eiseniae EF01-2]
          Length = 222

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 120/212 (56%), Positives = 138/212 (65%), Gaps = 2/212 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             YS+KEIF TLQGEGG  G  AVFCRF+GCNLWSGRE DR  A CRFCDTDFVG  GT 
Sbjct: 11  MTYSVKEIFYTLQGEGGQTGMPAVFCRFAGCNLWSGREADRADALCRFCDTDFVGTDGTL 70

Query: 62  GGRYN-VDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++   D LA+ I  QW   +   R  VLTGGEPLLQVD  L+ AL+ + F IAVETNG
Sbjct: 71  GGKFAQADALAERIAAQWPAADSAHRLVVLTGGEPLLQVDAALLAALHAQQFRIAVETNG 130

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGF-DFERFSLQPMDGP 179
           ++  P GIDW+CVSPKAG       GQELKLV+PQ  +          F    LQPMDGP
Sbjct: 131 SLAAPPGIDWLCVSPKAGAPWVQTQGQELKLVWPQAGMDLAAIARTGQFTHRFLQPMDGP 190

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
               +  + I+ C Q P WRLS+QTHK  GIR
Sbjct: 191 DQAAHIAICIAACLQQPLWRLSLQTHKISGIR 222


>gi|94987241|ref|YP_595174.1| hypothetical protein LI0799 [Lawsonia intracellularis PHE/MN1-00]
 gi|94731490|emb|CAJ54853.1| conserved hypothetical protein [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 212

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 105/214 (49%), Positives = 135/214 (63%), Gaps = 6/214 (2%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             + IKE+F T+QGEG   GR AVFCRFSGCNLWSG+E+DR  A+C+FCDTDF+      
Sbjct: 1   MSFYIKELFYTIQGEGVQTGRPAVFCRFSGCNLWSGKEKDRAIAKCQFCDTDFLNAD--F 58

Query: 62  GGRYNVDQLADLIEEQWITGEKEGR----YCVLTGGEPLLQVDVPLIQALNKRGFEIAVE 117
           G   + +QL   I + +            Y V TGGEP LQ++  +I  L+K   EIA+E
Sbjct: 59  GILDSEEQLVANILQTFPQNNYTHPSYKPYVVFTGGEPSLQLNQVIINLLHKYHIEIAIE 118

Query: 118 TNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMD 177
           TNGTI  P+ IDWI VSPK G +L    G ELKLV+PQ N  PE Y+  +F+ F LQP D
Sbjct: 119 TNGTIPLPKHIDWITVSPKEGNELVTTVGNELKLVWPQQNCDPEKYLTLEFDNFILQPKD 178

Query: 178 GPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              L  N  + I YC ++P W+L +Q+HK+IGIR
Sbjct: 179 DKNLSNNIQICIEYCMKHPYWKLGLQSHKWIGIR 212


>gi|94495452|ref|ZP_01302032.1| hypothetical protein SKA58_05370 [Sphingomonas sp. SKA58]
 gi|94424840|gb|EAT09861.1| hypothetical protein SKA58_05370 [Sphingomonas sp. SKA58]
          Length = 215

 Score =  225 bits (573), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 111/215 (51%), Positives = 138/215 (64%), Gaps = 5/215 (2%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KE+FLTLQGEG  AGR AVF RF+GCNLWSGREQDR SA CRFCDTDFVG  G  
Sbjct: 1   MSYAVKEMFLTLQGEGVQAGRRAVFLRFAGCNLWSGREQDRASAVCRFCDTDFVGTDGLG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GG++   +              EGRY VLTGGEP+LQVD  L+ AL+ RGF IA+E+NGT
Sbjct: 61  GGKFADAEALADAALGLWGEGAEGRYIVLTGGEPMLQVDDALVDALHDRGFTIAIESNGT 120

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVN-----VSPENYIGFDFERFSLQPM 176
           +    GIDWICVSPKAG D+  + G ELKLV+PQ          +    + F    +QP+
Sbjct: 121 LAAHPGIDWICVSPKAGSDVVQRSGHELKLVWPQPGGGHSLADVDAMARWAFAHHLIQPL 180

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           D     +N   AI+     P+WRL+VQ HK++G+R
Sbjct: 181 DDAHAPDNARAAIALVMDRPQWRLTVQAHKYLGLR 215


>gi|144898951|emb|CAM75815.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 210

 Score =  224 bits (571), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 109/213 (51%), Positives = 132/213 (61%), Gaps = 8/213 (3%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y +KE+F TLQGEGG AGR A+F RF+GCNLWSGRE DR +AQC FCDTDFVG     
Sbjct: 1   MAYKVKELFYTLQGEGGQAGRAAIFLRFAGCNLWSGREADRATAQCPFCDTDFVGGDKYA 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
                   +A      W  G       V+TGGEP LQ+D  LIQAL+  G EIAVETNGT
Sbjct: 61  DADALAGAVAA----LWPKGGGGQPLVVITGGEPGLQLDEALIQALHFWGLEIAVETNGT 116

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGP-- 179
           I  P GIDW+CVSPKAG DL+   G E+KLV+PQ  + P  +    F  + LQP D P  
Sbjct: 117 IALPPGIDWVCVSPKAGQDLETIAGDEIKLVWPQDGIDPTRFEKMPFRHYFLQPKDVPGD 176

Query: 180 --FLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                 +    ++YC  +P+WRLS+QTHK +GI
Sbjct: 177 SAAQAAHLQACVAYCLTHPRWRLSLQTHKILGI 209


>gi|94500711|ref|ZP_01307241.1| Organic radical activating enzyme [Oceanobacter sp. RED65]
 gi|94427266|gb|EAT12246.1| Organic radical activating enzyme [Oceanobacter sp. RED65]
          Length = 223

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 100/217 (46%), Positives = 130/217 (59%), Gaps = 10/217 (4%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           +++KE F TLQGEG  AGR +VF RFS CNLW+G+E  R +A C+FCDTD VG  G  GG
Sbjct: 6   FNVKEAFYTLQGEGARAGRASVFIRFSKCNLWNGKESGRGAAVCQFCDTDIVGTDGQNGG 65

Query: 64  RYNVDQLADLIEEQWIT---GEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
            YN   L +L    W       K   Y V TGGEP LQ+   L+    + GFE AVE+NG
Sbjct: 66  TYNQQALVELALSLWPQLTDDTKSKPYVVFTGGEPALQLTESLVSDFQQAGFECAVESNG 125

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPM---- 176
           T+  P  +DW+C+SPK   ++ +K   ELKLV+PQV++SP+   G     F L PM    
Sbjct: 126 TLPLPTNLDWVCISPKGTSEIVVKQCDELKLVYPQVDLSPDAVSGISASYFYLSPMADYG 185

Query: 177 ---DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               G  + EN   A  YC  +P+WR+S+QTHK +GI
Sbjct: 186 EQNSGMIIRENMQAATQYCLDHPQWRMSLQTHKLLGI 222


>gi|121997906|ref|YP_001002693.1| radical SAM domain-containing protein [Halorhodospira halophila
           SL1]
 gi|121589311|gb|ABM61891.1| Radical SAM domain protein [Halorhodospira halophila SL1]
          Length = 209

 Score =  218 bits (557), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 109/209 (52%), Positives = 133/209 (63%), Gaps = 1/209 (0%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++  +F TLQGEG  +GR AVF RF+GCNLWSGRE DR +A C FCDTDFVG  G  
Sbjct: 1   MSYAVHSLFYTLQGEGARSGRPAVFLRFAGCNLWSGREADRATAVCTFCDTDFVGTGGPG 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           GGR+            W  G  E  Y V TGGEP LQ+D  L+ AL+ RGFE+AVETNGT
Sbjct: 61  GGRFADAPELAAAVAAWWPGGGE-PYVVCTGGEPALQLDAALVAALHARGFEVAVETNGT 119

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
           +  P G+DWICVSPKAG +L I  G ELKL++PQ    P+ +    F RF LQP+D    
Sbjct: 120 LPLPAGVDWICVSPKAGTELAITAGDELKLIYPQPGAEPQRFTHLAFRRFYLQPLDDNQR 179

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             +T   + YC  +P+W LSVQ HK +GI
Sbjct: 180 GAHTRAVLDYCRGHPQWWLSVQIHKDLGI 208


>gi|299148832|ref|ZP_07041894.1| GntS [Bacteroides sp. 3_1_23]
 gi|298513593|gb|EFI37480.1| GntS [Bacteroides sp. 3_1_23]
          Length = 183

 Score =  211 bits (537), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 81/211 (38%), Positives = 105/211 (49%), Gaps = 28/211 (13%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M +  I EIF +LQGEG H G  A+F RFSGCNL            C FCDT        
Sbjct: 1   MMMRKINEIFYSLQGEGYHTGTPAIFVRFSGCNLK-----------CDFCDTQH-----E 44

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           +G     D++   ++      +      VLTGGEP L VD  LI  L++ G  + +ETNG
Sbjct: 45  EGKMMTDDEIIAEVK------KYPAVTVVLTGGEPSLWVDDELIDRLHQAGKYVTIETNG 98

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T   P  IDW+  SPK G  L I    E+K+V+   ++S   +     E F LQP     
Sbjct: 99  TRPLPVAIDWVTCSPKQGVKLAIDRMDEVKVVYEGQDISI--FELLPAEHFFLQPCSC-- 154

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              NT   +    ++PKWRLS+QTHK I IR
Sbjct: 155 --NNTASTVDCVMRHPKWRLSLQTHKLIDIR 183


>gi|160887244|ref|ZP_02068247.1| hypothetical protein BACOVA_05261 [Bacteroides ovatus ATCC 8483]
 gi|315919753|ref|ZP_07915993.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|156107655|gb|EDO09400.1| hypothetical protein BACOVA_05261 [Bacteroides ovatus ATCC 8483]
 gi|313693628|gb|EFS30463.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 183

 Score =  210 bits (536), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 80/211 (37%), Positives = 106/211 (50%), Gaps = 28/211 (13%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M +  I EIF +LQGEG H G  A+F RFSGCNL            C FCDT        
Sbjct: 1   MTMRKINEIFYSLQGEGYHTGTPAIFVRFSGCNLK-----------CDFCDTQH-----E 44

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           +G     +++   ++      +      VLTGGEP L +D  LI  L++ G  + +ETNG
Sbjct: 45  EGTMMTDEEIITKVK------KYPAVTVVLTGGEPSLWIDDQLIDLLHQAGKYVTIETNG 98

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T   P  IDW+  SPK G  L I    E+K+V+   ++S   +     E F LQP     
Sbjct: 99  THPLPASIDWVTCSPKQGAKLAIDRMNEVKVVYEGQDISI--FELLPAEHFFLQPCSC-- 154

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              NT L +    ++PKWRLS+QTHK I IR
Sbjct: 155 --NNTALTVDCVMRHPKWRLSLQTHKLIDIR 183


>gi|298384120|ref|ZP_06993681.1| GntS [Bacteroides sp. 1_1_14]
 gi|298263724|gb|EFI06587.1| GntS [Bacteroides sp. 1_1_14]
          Length = 182

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 81/210 (38%), Positives = 103/210 (49%), Gaps = 28/210 (13%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
            +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT         
Sbjct: 1   MMRKINEIFYSLQGEGYHTGTPAVFIRFSGCNLK-----------CSFCDTQH-----EA 44

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G     D++   +       +      +LTGGEP L +D  LI  L+K G  + +ETNGT
Sbjct: 45  GTLMTDDEIIAEV------SKYPAVTVILTGGEPSLWIDDALIDRLHKAGKYVCIETNGT 98

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
              P+ IDW+  SPK G  L I    E+K+V+   ++S         E F LQP      
Sbjct: 99  RPLPESIDWVTCSPKQGVKLGITRMDEVKVVYEGQDISIYEL--LPAEHFFLQPCSC--- 153

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             NT L +    ++PKWRLS+QTHK I IR
Sbjct: 154 -NNTALTVDCVMRHPKWRLSLQTHKLIDIR 182


>gi|29349862|ref|NP_813365.1| hypothetical protein BT_4454 [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29341773|gb|AAO79559.1| conserved hypothetical protein [Bacteroides thetaiotaomicron
           VPI-5482]
          Length = 182

 Score =  209 bits (533), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 80/210 (38%), Positives = 103/210 (49%), Gaps = 28/210 (13%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
            +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT         
Sbjct: 1   MMRKINEIFYSLQGEGYHTGTPAVFIRFSGCNLK-----------CSFCDTQH-----EA 44

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G     D++   +       +      +LTGGEP L +D  LI  L++ G  + +ETNGT
Sbjct: 45  GTLMTDDEIIAEV------SKYPAVTVILTGGEPSLWIDDALIDRLHEAGKYVCIETNGT 98

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
              P+ IDW+  SPK G  L I    E+K+V+   ++S         E F LQP      
Sbjct: 99  RPLPESIDWVTCSPKQGVKLGITRMDEVKVVYEGQDISIYEL--LPAEHFFLQPCSC--- 153

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             NT L +    ++PKWRLS+QTHK I IR
Sbjct: 154 -NNTALTVDCVMRHPKWRLSLQTHKLIDIR 182


>gi|298376475|ref|ZP_06986430.1| hypothetical protein HMPREF0104_02657 [Bacteroides sp. 3_1_19]
 gi|298266353|gb|EFI08011.1| hypothetical protein HMPREF0104_02657 [Bacteroides sp. 3_1_19]
          Length = 181

 Score =  208 bits (531), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 76/209 (36%), Positives = 106/209 (50%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF ++QGEG   G  AVF RFSGCNL           +C FCDT+       +G
Sbjct: 1   MKKINEIFYSIQGEGYFTGTPAVFVRFSGCNL-----------RCPFCDTEH-----KEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              + D++   I            + VLTGGEP +QV   L+  +   G  + +ETNGT+
Sbjct: 45  KMLSDDEIIAEIRR------YPALHVVLTGGEPCMQVTYDLVDKIKATGRFVQIETNGTL 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
            PP  IDWI  SPK G    +    ELK+V+   ++S  +   +    + LQP  G    
Sbjct: 99  VPPVNIDWITCSPKEGGKTVVINPNELKVVYTGQDMSQYD--KYSAGVYYLQPCSG---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            NT   I+Y  + PKW+LS+QTHK + +R
Sbjct: 153 RNTKEVINYIKEYPKWKLSLQTHKILNVR 181


>gi|253569769|ref|ZP_04847178.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|251840150|gb|EES68232.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 181

 Score =  208 bits (530), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 80/209 (38%), Positives = 103/209 (49%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT         G
Sbjct: 1   MRKINEIFYSLQGEGYHTGTPAVFIRFSGCNLK-----------CSFCDTQH-----EAG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
                D++   +       +      +LTGGEP L +D  LI  L++ G  + +ETNGT 
Sbjct: 45  TLMTDDEIIAEV------SKYPAVTVILTGGEPSLWIDDALIDRLHEAGKYVCIETNGTR 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P+ IDW+  SPK G  L I    E+K+V+   ++S         E F LQP       
Sbjct: 99  PLPESIDWVTCSPKQGVKLGITRMDEVKVVYEGQDISIYEL--LPAEHFFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            NT L +    ++PKWRLS+QTHK I IR
Sbjct: 153 NNTALTVDCVMRHPKWRLSLQTHKLIDIR 181


>gi|262408739|ref|ZP_06085285.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|293369177|ref|ZP_06615771.1| radical SAM domain protein [Bacteroides ovatus SD CMC 3f]
 gi|294647054|ref|ZP_06724666.1| radical SAM domain protein [Bacteroides ovatus SD CC 2a]
 gi|294807238|ref|ZP_06766052.1| radical SAM domain protein [Bacteroides xylanisolvens SD CC 1b]
 gi|298481567|ref|ZP_06999759.1| GntS [Bacteroides sp. D22]
 gi|262353604|gb|EEZ02698.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|292635760|gb|EFF54258.1| radical SAM domain protein [Bacteroides ovatus SD CMC 3f]
 gi|292637600|gb|EFF56006.1| radical SAM domain protein [Bacteroides ovatus SD CC 2a]
 gi|294445536|gb|EFG14189.1| radical SAM domain protein [Bacteroides xylanisolvens SD CC 1b]
 gi|295087026|emb|CBK68549.1| Organic radical activating enzymes [Bacteroides xylanisolvens XB1A]
 gi|298272431|gb|EFI14000.1| GntS [Bacteroides sp. D22]
          Length = 182

 Score =  208 bits (529), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 79/210 (37%), Positives = 104/210 (49%), Gaps = 28/210 (13%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
            +  I EIF +LQGEG H G  A+F RFSGCNL            C FCDT        +
Sbjct: 1   MMRKINEIFYSLQGEGYHTGTPAIFVRFSGCNLK-----------CDFCDTQH-----EE 44

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G     D++   ++      +      VLTGGEP L +D  LI  L++ G  + +ETNGT
Sbjct: 45  GKMMTDDEIIAEVK------KYPAVTVVLTGGEPSLWIDDELIDRLHQAGKYVTIETNGT 98

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFL 181
              P  IDW+  SPK G  L I    E+K+V+   ++S   +     E F LQP      
Sbjct: 99  RPLPAAIDWVTCSPKQGVKLAIDRMDEVKVVYEGQDISI--FELLPAEHFFLQPCSC--- 153

Query: 182 EENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             NT   +    ++PKWRLS+QTHK I IR
Sbjct: 154 -NNTASTVDCVMRHPKWRLSLQTHKLIDIR 182


>gi|237721523|ref|ZP_04552004.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|229449319|gb|EEO55110.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
          Length = 181

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 79/209 (37%), Positives = 104/209 (49%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  A+F RFSGCNL            C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGYHTGTPAIFVRFSGCNLK-----------CDFCDTQH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
                D++   ++      +      VLTGGEP L +D  LI  L++ G  + +ETNGT 
Sbjct: 45  KMMTDDEIIAEVK------KYPAVTVVLTGGEPSLWIDDELIDRLHEAGKYVTIETNGTR 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P  IDW+  SPK G  L I    E+K+V+   ++S   +     E F LQP       
Sbjct: 99  PLPAAIDWVTCSPKQGGKLAIDRMDEVKVVYEGQDISI--FELLPAEHFFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            NT   +    ++PKWRLS+QTHK I IR
Sbjct: 153 NNTASTVDCVMRHPKWRLSLQTHKLIDIR 181


>gi|237715731|ref|ZP_04546212.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|229444440|gb|EEO50231.1| conserved hypothetical protein [Bacteroides sp. D1]
          Length = 181

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 79/209 (37%), Positives = 104/209 (49%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  A+F RFSGCNL            C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGYHTGTPAIFVRFSGCNLK-----------CDFCDTQH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
                D++   ++      +      VLTGGEP L +D  LI  L++ G  + +ETNGT 
Sbjct: 45  KMMTDDEIIAEVK------KYPAVTVVLTGGEPSLWIDDELIDRLHQAGKYVTIETNGTR 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P  IDW+  SPK G  L I    E+K+V+   ++S   +     E F LQP       
Sbjct: 99  PLPAAIDWVTCSPKQGVKLAIDRMDEVKVVYEGQDISI--FELLPAEHFFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            NT   +    ++PKWRLS+QTHK I IR
Sbjct: 153 NNTASTVDCVMRHPKWRLSLQTHKLIDIR 181


>gi|260171438|ref|ZP_05757850.1| hypothetical protein BacD2_06190 [Bacteroides sp. D2]
          Length = 181

 Score =  205 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 79/209 (37%), Positives = 105/209 (50%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  A+F RFSGCNL            C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGYHTGTPAIFVRFSGCNLK-----------CDFCDTQH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
                +++   ++      +      VLTGGEP L +D  LI  L++ G  + +ETNGT 
Sbjct: 45  TMMTDEEIITKVK------KYPAVTVVLTGGEPSLWIDDQLIDLLHQAGKYVTIETNGTH 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P  IDW+  SPK G  L I    E+K+V+   ++S   +     E F LQP       
Sbjct: 99  PLPASIDWVTCSPKQGAKLAIDRMNEVKVVYEGQDISI--FELLPAEHFFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            NT L +    ++PKWRLS+QTHK I IR
Sbjct: 153 NNTALTVDCVMRHPKWRLSLQTHKLIDIR 181


>gi|53714880|ref|YP_100872.1| hypothetical protein BF3595 [Bacteroides fragilis YCH46]
 gi|253565984|ref|ZP_04843438.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|52217745|dbj|BAD50338.1| conserved hypothetical protein [Bacteroides fragilis YCH46]
 gi|251945088|gb|EES85526.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
          Length = 181

 Score =  205 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 77/208 (37%), Positives = 101/208 (48%), Gaps = 28/208 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGYHTGTPAVFIRFSGCNLK-----------CDFCDTRH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
                + + + I      G+      +LTGGEP L +D   I  L++ G  + +ETNGT 
Sbjct: 45  EMMTDEDIVNEI------GKYPAVMVILTGGEPSLWIDDAFIDLLHRAGKYVCIETNGTK 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P  IDW+  SPK G +L +    E+K+V+   N+          E F LQP       
Sbjct: 99  PLPAAIDWVTCSPKQGVNLALNRMDEVKVVYEGQNIDVYEQ--LPAEHFFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            NT   +    ++PKWRLS+QTHK I I
Sbjct: 153 NNTAETVDCVMRHPKWRLSLQTHKLINI 180


>gi|189460362|ref|ZP_03009147.1| hypothetical protein BACCOP_00999 [Bacteroides coprocola DSM 17136]
 gi|189432914|gb|EDV01899.1| hypothetical protein BACCOP_00999 [Bacteroides coprocola DSM 17136]
          Length = 181

 Score =  205 bits (521), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 84/208 (40%), Positives = 111/208 (53%), Gaps = 28/208 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT          
Sbjct: 1   MRKINEIFYSLQGEGFHTGTPAVFVRFSGCNLK-----------CSFCDTQH-------- 41

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             + +    ++I E         +  +LTGGEP L +D  L +AL+  G  IA+ETNGT 
Sbjct: 42  EEFRMMTDDEIIAEVCT---YPCQMVILTGGEPGLSIDSQLTKALHAAGKYIAIETNGTC 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P+ IDW+  SPK G  LK+    E+K+V+   +VSP  Y+    +   LQP  G    
Sbjct: 99  VLPEDIDWVTCSPKEGTTLKLHHIDEVKVVYVGQDVSP--YLKLPAKHHFLQPCSG---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +NTN  I+Y  ++P+WRLS+QTHK I I
Sbjct: 153 QNTNDVIAYIKEHPQWRLSLQTHKLIDI 180


>gi|60682861|ref|YP_213005.1| hypothetical protein BF3399 [Bacteroides fragilis NCTC 9343]
 gi|60494295|emb|CAH09090.1| conserved hypothetical protein [Bacteroides fragilis NCTC 9343]
 gi|301164330|emb|CBW23888.1| conserved hypothetical protein [Bacteroides fragilis 638R]
          Length = 181

 Score =  205 bits (521), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 77/208 (37%), Positives = 101/208 (48%), Gaps = 28/208 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGYHTGTPAVFIRFSGCNLK-----------CDFCDTRH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
                + + + I      G+      +LTGGEP L +D   I  L++ G  + +ETNGT 
Sbjct: 45  EMMTDEDIVNEI------GKYPAVMVILTGGEPSLWIDDAFIDLLHRAGKYVCIETNGTK 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P  IDW+  SPK G +L +    E+K+V+   N+          E F LQP       
Sbjct: 99  PLPVAIDWVTCSPKQGVNLALNRMDEVKVVYEGQNIDVYEQ--LPAEHFFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            NT   +    ++PKWRLS+QTHK I I
Sbjct: 153 NNTAETVDCVMRHPKWRLSLQTHKLINI 180


>gi|265766736|ref|ZP_06094565.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
 gi|263253113|gb|EEZ24589.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
          Length = 181

 Score =  204 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 77/208 (37%), Positives = 100/208 (48%), Gaps = 28/208 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGYHTGTPAVFIRFSGCNLK-----------CDFCDTRH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
                + + + I      G+      +LTGGEP L +D   I  L+  G  + +ETNGT 
Sbjct: 45  EMMTDEDIVNEI------GKYPAVMVILTGGEPSLWIDDAFIDLLHHAGKYVCIETNGTK 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P  IDW+  SPK G +L +    E+K+V+   N+          E F LQP       
Sbjct: 99  PLPAAIDWVTCSPKQGVNLALNRMDEVKVVYEGQNIDVYEQ--LPAEHFFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            NT   +    ++PKWRLS+QTHK I I
Sbjct: 153 NNTAETVDCVMRHPKWRLSLQTHKLINI 180


>gi|153809323|ref|ZP_01961991.1| hypothetical protein BACCAC_03636 [Bacteroides caccae ATCC 43185]
 gi|149128093|gb|EDM19314.1| hypothetical protein BACCAC_03636 [Bacteroides caccae ATCC 43185]
          Length = 181

 Score =  204 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 79/209 (37%), Positives = 107/209 (51%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG + G  A+F RFSGCNL            C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGYYTGTPAIFIRFSGCNLK-----------CSFCDTQH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
                D++   ++      +      VLTGGEP L +D  LI  L++ G  + VETNGT 
Sbjct: 45  TMMTDDEIIAEVK------KYPAVTVVLTGGEPSLWIDATLIDRLHEAGKYVTVETNGTN 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P+ +DW+  SPK G +LKI    E+K+V+   ++S   +     E F LQP       
Sbjct: 99  PLPESVDWVTCSPKQGVELKINRIDEVKVVYEGQDISI--FELLPAEHFFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            NT   +    ++PKWRLS+QTHK I IR
Sbjct: 153 INTADTVDCVMRHPKWRLSLQTHKLIDIR 181


>gi|298376715|ref|ZP_06986670.1| hypothetical protein HMPREF0104_02900 [Bacteroides sp. 3_1_19]
 gi|301310018|ref|ZP_07215957.1| GntS [Bacteroides sp. 20_3]
 gi|298266593|gb|EFI08251.1| hypothetical protein HMPREF0104_02900 [Bacteroides sp. 3_1_19]
 gi|300831592|gb|EFK62223.1| GntS [Bacteroides sp. 20_3]
          Length = 181

 Score =  204 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 76/209 (36%), Positives = 106/209 (50%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL           +C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGFHTGTPAVFVRFSGCNL-----------RCSFCDTRH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
                +++ + +           R  +LTGGEP L +D  LI  L + G +I +ETNGT 
Sbjct: 45  VMMTDEEIVEKV------SSFPARMVILTGGEPSLWIDKALISRLREAGKQICIETNGTR 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P GIDW+  SPK    + ++   E+K+V+   ++S    I        LQP       
Sbjct: 99  PLPDGIDWVTCSPKENAPVVLERVDEIKVVYTGQDLSAYAEI--PARYHFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           +NT   + Y  ++P+WRLS+QTHK I I+
Sbjct: 153 QNTKEVVDYILRHPRWRLSLQTHKLIDIQ 181


>gi|255011037|ref|ZP_05283163.1| hypothetical protein Bfra3_17992 [Bacteroides fragilis 3_1_12]
 gi|313148842|ref|ZP_07811035.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313137609|gb|EFR54969.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 181

 Score =  204 bits (519), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 74/208 (35%), Positives = 99/208 (47%), Gaps = 28/208 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT         G
Sbjct: 1   MRKINEIFYSLQGEGYHTGTPAVFIRFSGCNLK-----------CDFCDTRH-----ETG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
                +++ + ++      +      +LTGGEP L +D   I  L+  G  + +ETNGT 
Sbjct: 45  EMMTDEEIVNEVK------KYPAVMVILTGGEPSLWIDDAFIDLLHGAGKYVCIETNGTK 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P  IDW+  SPK G  L +    E+K+V+   N+          E F LQP       
Sbjct: 99  PLPAAIDWVTCSPKQGVKLALNRMDEVKVVYEGQNIDVYEQ--LPAEHFFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            NT   +    ++P+WRLS+QTHK I I
Sbjct: 153 NNTAETVDCVMRHPRWRLSLQTHKLINI 180


>gi|255013373|ref|ZP_05285499.1| hypothetical protein B2_05655 [Bacteroides sp. 2_1_7]
 gi|262381499|ref|ZP_06074637.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|262296676|gb|EEY84606.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
          Length = 181

 Score =  203 bits (518), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 76/209 (36%), Positives = 106/209 (50%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL           +C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGFHTGTPAVFVRFSGCNL-----------RCSFCDTRH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
                +++ + +           R  +LTGGEP L +D  LI  L + G +I +ETNGT 
Sbjct: 45  VMMTDEEIVEKV------SSFPARIVILTGGEPSLWIDKALISRLREAGKQICIETNGTR 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P GIDW+  SPK    + ++   E+K+V+   ++S   Y         LQP       
Sbjct: 99  PLPDGIDWVTCSPKENAPVVLERIDEIKVVYTGQDLSA--YAEIPARYHFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           +NT   + Y  ++P+WRLS+QTHK I I+
Sbjct: 153 QNTKEVVDYILRHPRWRLSLQTHKLIDIQ 181


>gi|171463302|ref|YP_001797415.1| Radical SAM domain protein [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|171192840|gb|ACB43801.1| Radical SAM domain protein [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 198

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 110/198 (55%), Positives = 138/198 (69%), Gaps = 8/198 (4%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y++KE F  LQGEG HAGR AVFCRF+GCNLWSGRE+DR +A C+FCDTDFVG  G  G
Sbjct: 1   MYTVKEPFPILQGEGAHAGRAAVFCRFAGCNLWSGREEDRGAAICQFCDTDFVGSDGLGG 60

Query: 63  GRY-NVDQLADLIEEQW--ITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
           G++   + LAD IE  W   +   + RY V TGGEPLLQ+D  LI AL+++GF +A+ETN
Sbjct: 61  GKFETANALADAIESSWRSTSAGPQQRYVVFTGGEPLLQLDDELIAALHQKGFAVAIETN 120

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSP-----ENYIGFDFERFSLQ 174
           GTI+ P+GIDW+CVSPKAG +L +    ELKLV PQ + S        +   D+    LQ
Sbjct: 121 GTIKIPKGIDWVCVSPKAGSELIVLQADELKLVVPQQDHSELEKIVARFEKMDYRNRFLQ 180

Query: 175 PMDGPFLEENTNLAISYC 192
           PMDGP L+ NT LA+S C
Sbjct: 181 PMDGPGLKSNTELAVSLC 198


>gi|189467678|ref|ZP_03016463.1| hypothetical protein BACINT_04069 [Bacteroides intestinalis DSM
           17393]
 gi|189435942|gb|EDV04927.1| hypothetical protein BACINT_04069 [Bacteroides intestinalis DSM
           17393]
          Length = 181

 Score =  202 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 80/209 (38%), Positives = 103/209 (49%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGYHTGTPAVFIRFSGCNLK-----------CSFCDTRH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              + D++   +      G+      +LTGGEP L VD   I  L++ G  + +ETNGT 
Sbjct: 45  VLMSDDEIIAEV------GKYPAVTVILTGGEPSLWVDEAFIDRLHQAGKYVCIETNGTN 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P  IDW+  SPK G  L I    E+K+V+   ++          E F LQP       
Sbjct: 99  PLPPNIDWVTCSPKQGVKLGITRMDEVKVVYEGQDIGVYEL--LPAEYFFLQPCSCS--- 153

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            NT   ++   Q+PKWRLS+QTHK I IR
Sbjct: 154 -NTAETVACVMQHPKWRLSLQTHKLIDIR 181


>gi|224538811|ref|ZP_03679350.1| hypothetical protein BACCELL_03706 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224519568|gb|EEF88673.1| hypothetical protein BACCELL_03706 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 181

 Score =  202 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 82/209 (39%), Positives = 106/209 (50%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGYHTGTPAVFIRFSGCNLK-----------CSFCDTRH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              + D++   +      G+      +LTGGEP L +D   I  L++ G  + +ETNGT 
Sbjct: 45  VLMSDDEIIAEV------GKYPAVTVILTGGEPSLWIDEVFIDRLHQAGKYVCIETNGTN 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             PQ IDW+  SPK G  L I    E+K+V+   ++  E Y     E F LQP       
Sbjct: 99  PLPQNIDWVTCSPKQGVKLGITRMDEVKVVYEGQDI--EVYELLPAEYFFLQPCSCS--- 153

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            NT   ++   Q+PKWRLS+QTHK I IR
Sbjct: 154 -NTAETVACVMQHPKWRLSLQTHKLIDIR 181


>gi|256840895|ref|ZP_05546403.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|256738167|gb|EEU51493.1| conserved hypothetical protein [Parabacteroides sp. D13]
          Length = 181

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 76/209 (36%), Positives = 106/209 (50%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL           +C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGFHTGTPAVFVRFSGCNL-----------RCGFCDTRH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
                +++ + +           R  +LTGGEP L +D  LI  L + G +I +ETNGT 
Sbjct: 45  VMMTDEEIVEKV------SSFPARMVILTGGEPSLWIDKALISRLREAGKQICIETNGTR 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P GIDW+  SPK    + ++   E+K+V+   ++S    I        LQP       
Sbjct: 99  PLPDGIDWVTCSPKENAPVVLERVDEIKVVYTGQDLSAYAEI--PARYHFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           +NT   + Y  ++P+WRLS+QTHK I I+
Sbjct: 153 QNTKEVVDYILRHPRWRLSLQTHKLIDIQ 181


>gi|150007939|ref|YP_001302682.1| hypothetical protein BDI_1300 [Parabacteroides distasonis ATCC
           8503]
 gi|149936363|gb|ABR43060.1| conserved hypothetical protein [Parabacteroides distasonis ATCC
           8503]
          Length = 181

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 75/209 (35%), Positives = 106/209 (50%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL           +C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGFHTGTPAVFVRFSGCNL-----------RCGFCDTRH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
                +++ + +           R  +LTGGEP L +D  LI  L + G ++ +ETNGT 
Sbjct: 45  VMMTDEEIVEKV------SSFPARMVILTGGEPSLWIDKSLISRLREAGKQVCIETNGTR 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P GIDW+  SPK    + ++   E+K+V+   ++S    I        LQP       
Sbjct: 99  PLPDGIDWVTCSPKENAPVVLERVDEIKVVYTGQDLSAYAEI--PARYHFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           +NT   + Y  ++P+WRLS+QTHK I I+
Sbjct: 153 QNTKEVVDYILRHPRWRLSLQTHKLIDIQ 181


>gi|218129819|ref|ZP_03458623.1| hypothetical protein BACEGG_01399 [Bacteroides eggerthii DSM 20697]
 gi|317475833|ref|ZP_07935090.1| radical SAM superfamily protein [Bacteroides eggerthii 1_2_48FAA]
 gi|217987929|gb|EEC54254.1| hypothetical protein BACEGG_01399 [Bacteroides eggerthii DSM 20697]
 gi|316907993|gb|EFV29690.1| radical SAM superfamily protein [Bacteroides eggerthii 1_2_48FAA]
          Length = 181

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 76/209 (36%), Positives = 102/209 (48%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGFHTGTPAVFIRFSGCNLK-----------CSFCDTQH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              + +++ D +      GE      +LTGGEP L +D   +  L++ G  + +ETNGT 
Sbjct: 45  VLMSDEEILDAV------GEYPATTVILTGGEPSLWIDREFVDRLHRIGKYVCIETNGTR 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P  IDW+  SPK G    I    E+K+V+   +++           F LQP       
Sbjct: 99  ALPDNIDWVTCSPKQGAKPVISRMDEVKVVYEGQDITVYEL--LPAGHFFLQPCSCS--- 153

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            N    ++   Q+PKWRLS+QTHK I IR
Sbjct: 154 -NVAETVACVMQHPKWRLSLQTHKLIDIR 181


>gi|307132359|ref|YP_003884375.1| hypothetical protein Dda3937_00204 [Dickeya dadantii 3937]
 gi|306529888|gb|ADM99818.1| conserved protein [Dickeya dadantii 3937]
          Length = 223

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 69/237 (29%), Positives = 99/237 (41%), Gaps = 43/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
            LY I E+F TLQGEG   G  AVF R  GC +            C +CDT         
Sbjct: 1   MLYPINEMFQTLQGEGFFTGVPAVFIRLQGCPV-----------GCSWCDTKHTWEKRPE 49

Query: 57  ---------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
                    ++  +   ++     DLI++    G    R+ V+TGGEP +    PL QAL
Sbjct: 50  RQISLAEVLVKSGESDAWSGSSAGDLIQQIARQG-YTARHVVITGGEPCIHDLTPLTQAL 108

Query: 108 NKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQ---- 155
            ++GF   +ET+GT E       W+ VSPK          D  ++   E+K    +    
Sbjct: 109 EQQGFSTQIETSGTHEVRCSPNCWVTVSPKVNMRGGLAVLDQALQRANEIKHPVARERDI 168

Query: 156 --VNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             ++              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 169 EALDALLARLDDDKARVVALQPISQKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|270293623|ref|ZP_06199825.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270275090|gb|EFA20950.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 181

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 74/209 (35%), Positives = 100/209 (47%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT         G
Sbjct: 1   MRKINEIFYSLQGEGYHTGTPAVFIRFSGCNLK-----------CPFCDTQH-----EDG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              + + +   +       +      +LTGGEP L +D   +  L++ G  + +ETNGT 
Sbjct: 45  ILMSDEDIVTEV------SKYPAATVILTGGEPSLWIDREFVDCLHQAGKYVCIETNGTR 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P  IDW+  SPK G  L+I    E+K+V+   +++           F LQP       
Sbjct: 99  PLPDNIDWVTCSPKQGVKLEITRMNEVKVVYEGQDITVYEQ--LPAGHFFLQPCSCS--- 153

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            NT   +    ++PKWRLS+QTHK I IR
Sbjct: 154 -NTAETVDCVMKHPKWRLSLQTHKLIDIR 181


>gi|294775146|ref|ZP_06740672.1| conserved hypothetical protein [Bacteroides vulgatus PC510]
 gi|294450958|gb|EFG19432.1| conserved hypothetical protein [Bacteroides vulgatus PC510]
          Length = 193

 Score =  201 bits (512), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 76/210 (36%), Positives = 108/210 (51%), Gaps = 28/210 (13%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           + +  I EIF +LQGEG H G  AVF RFSGCNL           +C FCDT        
Sbjct: 11  LSMRRINEIFYSLQGEGYHTGIPAVFVRFSGCNL-----------RCPFCDTQH-----E 54

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           +G   + + +   +       +   +  +LTGGEP L +D  L+ AL+  G  + +ETNG
Sbjct: 55  EGTLMSDEDIVMEV------AKYSTQVVILTGGEPGLWIDEKLVDALHHEGKYVCIETNG 108

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           T   P+ IDW+  SPK G  + +    E+K+V+   +VS   Y+      + LQP     
Sbjct: 109 TCLLPENIDWVTCSPKEGAKINLDRIDEVKVVYVGQDVSA--YLDLSASHYFLQPCSC-- 164

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              NT   I+Y  Q+P+WRLS+QTHK + I
Sbjct: 165 --ANTEEVIAYILQHPEWRLSLQTHKLLQI 192


>gi|160888847|ref|ZP_02069850.1| hypothetical protein BACUNI_01266 [Bacteroides uniformis ATCC 8492]
 gi|156861746|gb|EDO55177.1| hypothetical protein BACUNI_01266 [Bacteroides uniformis ATCC 8492]
          Length = 181

 Score =  201 bits (511), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 74/209 (35%), Positives = 99/209 (47%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT         G
Sbjct: 1   MRKINEIFYSLQGEGYHTGTPAVFIRFSGCNLK-----------CPFCDTQH-----EDG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              + + +   +              +LTGGEP L +D   +  L++ G  + +ETNGT 
Sbjct: 45  ILMSDEDIVTEVSR------YPAATVILTGGEPSLWIDREFVDCLHQAGKYVCIETNGTH 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P  IDW+  SPK G  L+I    E+K+V+   +++           F LQP       
Sbjct: 99  PLPDNIDWVTCSPKQGVKLEITRMNEVKVVYEGQDITVYEQ--LPAGHFFLQPCSCS--- 153

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            NT   +    ++PKWRLS+QTHK I IR
Sbjct: 154 -NTAETVDCVMKHPKWRLSLQTHKLIDIR 181


>gi|212693923|ref|ZP_03302051.1| hypothetical protein BACDOR_03445 [Bacteroides dorei DSM 17855]
 gi|237724017|ref|ZP_04554498.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|212663455|gb|EEB24029.1| hypothetical protein BACDOR_03445 [Bacteroides dorei DSM 17855]
 gi|229437681|gb|EEO47758.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
          Length = 181

 Score =  201 bits (511), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 77/208 (37%), Positives = 108/208 (51%), Gaps = 28/208 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL           +C FCDT        +G
Sbjct: 1   MRRINEIFYSLQGEGYHTGIPAVFVRFSGCNL-----------RCPFCDTQH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              + + +A  +       +   +  +LTGGEP L +D  L+ AL+  G  + +ETNGT 
Sbjct: 45  TLMSDEDIAMEV------AKYSTQVVILTGGEPGLWIDEKLVDALHHEGKYVCIETNGTC 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P+ IDW+  SPK G  + +    E+K+V+   +VS   Y+      + LQP       
Sbjct: 99  LLPENIDWVTCSPKEGAKINLDRIDEVKVVYVGQDVSA--YLDLSASHYFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            NT   I+Y  Q+P+WRLS+QTHK + I
Sbjct: 153 ANTEEVIAYILQHPEWRLSLQTHKLLQI 180


>gi|242238307|ref|YP_002986488.1| hypothetical protein Dd703_0856 [Dickeya dadantii Ech703]
 gi|242130364|gb|ACS84666.1| conserved hypothetical protein [Dickeya dadantii Ech703]
          Length = 224

 Score =  201 bits (511), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 68/241 (28%), Positives = 98/241 (40%), Gaps = 49/241 (20%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI--- 57
           M  Y I E+F TLQGEG   G  AVF R  GC +            C +CDT        
Sbjct: 1   MPQYPINEMFQTLQGEGYFTGVPAVFIRLQGCPV-----------GCSWCDTKHTWEKLA 49

Query: 58  --------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL 103
                         +    G  +  ++   + E         R+ V+TGGEP +    PL
Sbjct: 50  ERQSSLAEVLAKTAESDVWGAADATEILSSMRELG----YTARHVVITGGEPCIHDLTPL 105

Query: 104 IQALNKRGFEIAVETNGTIEPPQGI-DWICVSPKAGCD-------LKIKGGQELKLVFPQ 155
             AL ++GF   +ET+GT +       W+ VSPK             ++   E+K    +
Sbjct: 106 TLALEQQGFSTQIETSGTHDVRCSPATWVTVSPKVNMRGGMAVLLSALQRADEIKHPVAR 165

Query: 156 ---VNVSPENYIGFDFER---FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIG 209
              V+         D ++    +LQP+     EE T L I+ C     WRLS+QTHK++ 
Sbjct: 166 ERDVDALDALLARLDDDKSRVVALQPVSQK--EEATRLCIATCIAR-NWRLSMQTHKYLN 222

Query: 210 I 210
           I
Sbjct: 223 I 223


>gi|282600228|ref|ZP_05973516.2| radical SAM domain protein [Providencia rustigianii DSM 4541]
 gi|282566364|gb|EFB71899.1| radical SAM domain protein [Providencia rustigianii DSM 4541]
          Length = 230

 Score =  201 bits (511), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 64/237 (27%), Positives = 92/237 (38%), Gaps = 41/237 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y I EIF TLQGEG   G  AVF R  GC +            C +CDT     +   
Sbjct: 8   MKYPINEIFQTLQGEGVFTGVPAVFIRLQGCPV-----------GCSWCDTKQTWDKEPA 56

Query: 62  GGR-------------YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                                 A+ + +         ++ V+TGGEP +    PL + L 
Sbjct: 57  KESTLGDIALKTQDNDLWAMADAEALIQLMQQSGYTAKHIVITGGEPCIYDLNPLTETLE 116

Query: 109 KRGFEIAVETNGTIEP-PQGIDWICVSPKAGCD-------LKIKGGQELKL-VFPQVNVS 159
             GF+  +ET+GT         W+ VSPK G           +    E+K  V  + ++ 
Sbjct: 117 TNGFQCQIETSGTYPILCTEKTWVTVSPKVGMKGGLKVLNQAVDRANEIKHPVAREKDIE 176

Query: 160 PENYIGFDFER-----FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             + +            +LQP+        T L I  C Q   WRLS+QTHK++ I+
Sbjct: 177 ALDQLLARRTNNAPLIVALQPISQKVS--ATKLCIDTCIQR-NWRLSIQTHKYLNIQ 230


>gi|239996401|ref|ZP_04716925.1| radical activating enzyme [Alteromonas macleodii ATCC 27126]
          Length = 224

 Score =  201 bits (511), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 65/238 (27%), Positives = 100/238 (42%), Gaps = 43/238 (18%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG---- 56
           M   +I E+F T+QGEG H G  ++F R  GC +            C +CDT        
Sbjct: 1   MSTLNINEMFETIQGEGAHTGIPSIFVRLQGCPV-----------GCPWCDTKHTWEIKP 49

Query: 57  ----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
                      +G +   Y +     L+ E    G    ++ V+TGGEP +    PL   
Sbjct: 50  DLSVSPQAVITKGEESETYFISSEEALLAEFGKQG-YVAKHVVITGGEPCMYDLRPLTSL 108

Query: 107 LNKRGFEIAVETNGTIEPPQG-IDWICVSPKAGCD-------LKIKGGQELKL------V 152
           L+  G+   +ET+GT E       ++ VSPK             ++   E+K        
Sbjct: 109 LHDNGYTTQIETSGTFEVLCDTRTYVTVSPKINMKGGYDVLVSALERANEIKHPIAMQKH 168

Query: 153 FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             +++    N    D ++  LQP+     +  T LA+  C +   WRLS+QTHK+IGI
Sbjct: 169 IDELDALLANVSSLDGKQVCLQPISQ--QKRATELAVRTCIER-NWRLSLQTHKYIGI 223


>gi|150004624|ref|YP_001299368.1| hypothetical protein BVU_2083 [Bacteroides vulgatus ATCC 8482]
 gi|254883105|ref|ZP_05255815.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|319643625|ref|ZP_07998245.1| hypothetical protein HMPREF9011_03847 [Bacteroides sp. 3_1_40A]
 gi|149933048|gb|ABR39746.1| conserved hypothetical protein [Bacteroides vulgatus ATCC 8482]
 gi|254835898|gb|EET16207.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|317384794|gb|EFV65753.1| hypothetical protein HMPREF9011_03847 [Bacteroides sp. 3_1_40A]
          Length = 181

 Score =  200 bits (510), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 76/208 (36%), Positives = 107/208 (51%), Gaps = 28/208 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL           +C FCDT        +G
Sbjct: 1   MRRINEIFYSLQGEGYHTGIPAVFVRFSGCNL-----------RCPFCDTQH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              + + +   +       +   +  +LTGGEP L +D  L+ AL+  G  + +ETNGT 
Sbjct: 45  TLMSDEDIVMEV------AKYSTQVVILTGGEPGLWIDEKLVDALHHEGKYVCIETNGTC 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P+ IDW+  SPK G  + +    E+K+V+   +VS   Y+      + LQP       
Sbjct: 99  LLPENIDWVTCSPKEGAKINLDRIDEVKVVYVGQDVSA--YLDLSASHYFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            NT   I+Y  Q+P+WRLS+QTHK + I
Sbjct: 153 ANTEEVIAYILQHPEWRLSLQTHKLLQI 180


>gi|322831395|ref|YP_004211422.1| Radical SAM domain protein [Rahnella sp. Y9602]
 gi|321166596|gb|ADW72295.1| Radical SAM domain protein [Rahnella sp. Y9602]
          Length = 223

 Score =  200 bits (510), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 69/240 (28%), Positives = 94/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFETLQGEGYFTGVPAIFVRLQGCPV-----------GCSWCDTKHTWDKIAD 49

Query: 57  ------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +    G    +QL ++I +Q        R+ V+TGGEP +     L 
Sbjct: 50  REVDMQRILVKTEESDAWGNATSEQLLEVIAQQG----YTARHVVITGGEPCIYDLTELT 105

Query: 105 QALNKRGFEIAVETNGTIEPPQG-IDWICVSPKAGC-------DLKIKGGQELKLVFPQV 156
             L K GF   +ET+GT E       W+ VSPK             +K   E+K    + 
Sbjct: 106 SLLEKSGFSCQIETSGTHEVRCSVNTWVTVSPKVNMRGGYDILPQALKRADEVKHPVARQ 165

Query: 157 ------NVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                 +   E          +LQP+     EE T L I+ C     WRLS+QTHK++ I
Sbjct: 166 RDIDALDALLETLTDSKARIIALQPISQK--EEATRLCIATCIAR-NWRLSMQTHKYLNI 222


>gi|251788459|ref|YP_003003180.1| hypothetical protein Dd1591_0822 [Dickeya zeae Ech1591]
 gi|247537080|gb|ACT05701.1| conserved hypothetical protein [Dickeya zeae Ech1591]
          Length = 223

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 65/237 (27%), Positives = 99/237 (41%), Gaps = 43/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I E+F TLQGEG   G  AVF R  GC +            C +CDT         
Sbjct: 1   MRYPINEMFQTLQGEGFFTGVPAVFIRLQGCPV-----------GCSWCDTKHTWERLPD 49

Query: 57  ---------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
                    ++  +   ++     +L+++  + G    ++ V+TGGEP +    PL QAL
Sbjct: 50  RQIPLADILVKSGESDAWSHSSSEELLQQMRLQG-YSAKHIVITGGEPCIHDLTPLTQAL 108

Query: 108 NKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQ---- 155
            ++GF   +ET+GT E       W+ VSPK          D  ++   E+K    +    
Sbjct: 109 EQQGFSTQIETSGTHEVRCSSACWVTVSPKVNMRGGLAVLDQALRRADEIKHPVARERDI 168

Query: 156 --VNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             ++              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 169 EALDALLARLDDDKPRVVALQPISQKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|329955365|ref|ZP_08296273.1| radical SAM domain protein [Bacteroides clarus YIT 12056]
 gi|328525768|gb|EGF52792.1| radical SAM domain protein [Bacteroides clarus YIT 12056]
          Length = 181

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 75/208 (36%), Positives = 101/208 (48%), Gaps = 28/208 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF R SGCNL            C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGFHTGTPAVFIRLSGCNLK-----------CPFCDTQH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
                +++   +      G+      +LTGGEP L +D   +  L++ G  + +ETNGT 
Sbjct: 45  VLMTDEEIMAEV------GKYPAMMVILTGGEPSLWIDREFVDRLHQLGKYVCIETNGTH 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
           E P  IDW+  SPK G  L I    E+K+V+   +++         + F LQP       
Sbjct: 99  ELPDNIDWVTCSPKRGAKLSISRMDEVKVVYESQDITVYEQ--LPAKHFFLQPCSCS--- 153

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            NT   +    Q+PKWRLS+QTHK I I
Sbjct: 154 -NTVETVVRVMQHPKWRLSLQTHKLINI 180


>gi|325299596|ref|YP_004259513.1| Radical SAM domain-containing protein [Bacteroides salanitronis DSM
           18170]
 gi|324319149|gb|ADY37040.1| Radical SAM domain protein [Bacteroides salanitronis DSM 18170]
          Length = 181

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 82/208 (39%), Positives = 111/208 (53%), Gaps = 28/208 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG HAG  AVF RFSGCNL            C FCDT          
Sbjct: 1   MRKINEIFYSLQGEGAHAGTPAVFVRFSGCNLK-----------CIFCDTSHESG----- 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
                    ++IEE     +   R  ++TGGEP L +D  L+  L+K G  +AVETNGT 
Sbjct: 45  ---TEMGDEEIIEEVC---KYPCRMVIMTGGEPGLWIDDALVDLLHKAGKYVAVETNGTQ 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P+ +DW+  SPK G  L+++   E+K+V+   +VSP  Y+  + +   LQP       
Sbjct: 99  VLPEAVDWVTCSPKEGTVLRVRHIDEVKVVYIGQDVSP--YLLIEAKEHFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +NT   I Y  ++P+WRLS+QTHK I I
Sbjct: 153 QNTEEVIEYIKKHPQWRLSLQTHKLINI 180


>gi|212711380|ref|ZP_03319508.1| hypothetical protein PROVALCAL_02452 [Providencia alcalifaciens DSM
           30120]
 gi|212686109|gb|EEB45637.1| hypothetical protein PROVALCAL_02452 [Providencia alcalifaciens DSM
           30120]
          Length = 223

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 64/237 (27%), Positives = 89/237 (37%), Gaps = 41/237 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y I EIF TLQGEG   G  AVF R  GC +            C +CDT     +   
Sbjct: 1   MKYPINEIFQTLQGEGVFTGVPAVFIRLQGCPV-----------GCSWCDTKQTWDKEPA 49

Query: 62  GGR-------------YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                           +     A+ + +  +      ++ V+TGGEP +     L Q L 
Sbjct: 50  KESTLGDIALKTQDSDFWAMSDAESLIQLMLQNGYTAKHIVITGGEPCIYDLTALTQTLE 109

Query: 109 KRGFEIAVETNGTIEP-PQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQVNVSP 160
             GF+  +ET+GT         W+ VSPK G        +  I    E+K    +     
Sbjct: 110 ANGFQCQIETSGTYPILCTENTWVTVSPKVGMKGGLQVLEQAINRANEIKHPVAREKDIE 169

Query: 161 ENYIGFDFER------FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
                            +LQP+        T L I  C Q   WRLS+QTHK++ I+
Sbjct: 170 ALDQLLSLRTQGQLPIVALQPISQKTS--ATKLCIDTCIQR-NWRLSIQTHKYLNIQ 223


>gi|319901441|ref|YP_004161169.1| Radical SAM domain protein [Bacteroides helcogenes P 36-108]
 gi|319416472|gb|ADV43583.1| Radical SAM domain protein [Bacteroides helcogenes P 36-108]
          Length = 181

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 75/209 (35%), Positives = 103/209 (49%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGYHTGIPAVFIRFSGCNLK-----------CSFCDTHH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              + D++ + +       +      +LTGGEP L +D   +  L++ G  + +ETNGT 
Sbjct: 45  RLMSDDEIMEEV------RKYPAATVILTGGEPSLWIDSEFVDRLHRAGKYVCIETNGTH 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P  IDW+  SPK G +L+I G  E+K+V+   +++           F LQP       
Sbjct: 99  PLPDNIDWVTCSPKLGGNLRITGMDEVKVVYEGQDITVYEQ--LPAGHFFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            N    +     +PKWRLS+QTHK I IR
Sbjct: 153 NNIGETVDCVMHHPKWRLSLQTHKLIDIR 181


>gi|294141101|ref|YP_003557079.1| radical activating enzyme [Shewanella violacea DSS12]
 gi|293327570|dbj|BAJ02301.1| radical activating enzyme [Shewanella violacea DSS12]
          Length = 222

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 65/237 (27%), Positives = 95/237 (40%), Gaps = 44/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y + E+F T+QGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MKYPVNEVFETIQGEGFFTGVPAIFVRLQGCPV-----------GCSWCDTKHTWDVLEK 49

Query: 57  ----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
                     + G  G R++      LI      G     + V+TGGEP +     L   
Sbjct: 50  NRVAPELVIQVDGEIG-RWSELTAEALINSFIRKG-FSANHVVITGGEPCIHDLTELTSQ 107

Query: 107 LNKRGFEIAVETNGTIEPPQ-GIDWICVSPKAGCD-------LKIKGGQELKL-VFPQVN 157
           LN +G+   +ET+GT E       W+ VSPK             ++   E+K  V    +
Sbjct: 108 LNSQGYATQIETSGTFEVICSDKTWVTVSPKVNMKAGMAVLTQALERADEIKHPVATSKH 167

Query: 158 VSPENY----IGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +   +     I  D +   LQP+        T LA+  C +   WRLS+QTHK++ I
Sbjct: 168 IDDLDELLEGIELDGKTICLQPISQK--PRATELAMKTCIER-NWRLSIQTHKYLNI 221


>gi|198274527|ref|ZP_03207059.1| hypothetical protein BACPLE_00675 [Bacteroides plebeius DSM 17135]
 gi|198272581|gb|EDY96850.1| hypothetical protein BACPLE_00675 [Bacteroides plebeius DSM 17135]
          Length = 181

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 69/209 (33%), Positives = 103/209 (49%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + EIF ++QGEG H G  AVF RFSGCNL            C FCDT         G
Sbjct: 1   MKKVNEIFYSIQGEGYHTGTPAVFVRFSGCNLK-----------CPFCDTQH-----EDG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              + +++   +      G+      +LTGGEP L +D   +  L++ G  + +ETNGT 
Sbjct: 45  ILMSDEEILSEV------GKYPAVMVILTGGEPSLWIDREFVDRLHRIGKYVCIETNGTR 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P  IDW+  SPK G +  +    E+K+V+   ++S    +      + LQP       
Sbjct: 99  SLPNNIDWVTCSPKEGSNAIVVNPHEIKVVYTGQDLSTYEEMT--AAVYYLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           +NT   I Y  ++PKW+LS+QT K + +R
Sbjct: 153 QNTEEVIDYIKKHPKWKLSLQTQKILNVR 181


>gi|237708545|ref|ZP_04539026.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|265751292|ref|ZP_06087355.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|229457474|gb|EEO63195.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|263238188|gb|EEZ23638.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
          Length = 181

 Score =  198 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 76/208 (36%), Positives = 107/208 (51%), Gaps = 28/208 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL           +C FCDT        +G
Sbjct: 1   MRRINEIFYSLQGEGYHTGIPAVFVRFSGCNL-----------RCPFCDTQH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              + + +A  +       +   +  +LTGGEP L +D  L+ AL+     + +ETNGT 
Sbjct: 45  TLMSDEDIAMEV------AKYSTQVVILTGGEPGLWIDEKLVDALHHERKYVCIETNGTC 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P+ IDW+  SPK G  + +    E+K+V+   +VS   Y+      + LQP       
Sbjct: 99  RLPENIDWVTCSPKEGAKINLDRIDEVKVVYVGQDVSA--YLDLSASHYFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            NT   I+Y  Q+P+WRLS+QTHK + I
Sbjct: 153 ANTEEVIAYILQHPEWRLSLQTHKLLQI 180


>gi|271501834|ref|YP_003334860.1| Radical SAM domain-containing protein [Dickeya dadantii Ech586]
 gi|270345389|gb|ACZ78154.1| Radical SAM domain protein [Dickeya dadantii Ech586]
          Length = 223

 Score =  198 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 66/237 (27%), Positives = 95/237 (40%), Gaps = 43/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y I E+F TLQGEG   G  AVF R  GC +            C +CDT         
Sbjct: 1   MRYPINEMFQTLQGEGFFTGVPAVFIRLQGCPV-----------GCSWCDTKHTW-DTLP 48

Query: 62  GGRYNVDQLA--------------DLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
             + ++ ++               + + +Q        R+ V+TGGEP +    PL QAL
Sbjct: 49  ERQISLAEVLVKRGESDAWSSSSVEALLQQITQQGYSARHVVITGGEPCIHDLTPLTQAL 108

Query: 108 NKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQVNVS 159
            ++GF   +ET+GT E       W+ VSPK          D  ++   E+K    +    
Sbjct: 109 EQQGFSTQIETSGTHEVRCSSGCWVTVSPKVNMRGGLAVLDQALQRADEIKHPVARERDI 168

Query: 160 P------ENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                             +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 169 EALEGLLARLDDDKVRVVALQPVSQK--EDATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|317479410|ref|ZP_07938544.1| radical SAM superfamily protein [Bacteroides sp. 4_1_36]
 gi|316904484|gb|EFV26304.1| radical SAM superfamily protein [Bacteroides sp. 4_1_36]
          Length = 181

 Score =  198 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 74/209 (35%), Positives = 99/209 (47%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT         G
Sbjct: 1   MRKINEIFYSLQGEGYHTGTPAVFIRFSGCNLK-----------CLFCDTQH-----EDG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              + + +   +              +LTGGEP L +D   +  L++ G  + +ETNGT 
Sbjct: 45  ILMSDEDIVTEVSR------YPAATVILTGGEPSLWIDREFVDCLHQAGKYVCIETNGTR 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P  IDW+  SPK G  L+I    E+K+V+   +++           F LQP       
Sbjct: 99  PLPDNIDWVTCSPKQGVKLEITRMNEVKVVYEGQDITVYEQ--LPAGHFFLQPCSCS--- 153

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            NT   +    ++PKWRLS+QTHK I IR
Sbjct: 154 -NTAETVDCVMKHPKWRLSLQTHKLIDIR 181


>gi|329961992|ref|ZP_08300003.1| radical SAM domain protein [Bacteroides fluxus YIT 12057]
 gi|328530640|gb|EGF57498.1| radical SAM domain protein [Bacteroides fluxus YIT 12057]
          Length = 181

 Score =  198 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 76/209 (36%), Positives = 103/209 (49%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGFHTGTPAVFIRFSGCNLK-----------CSFCDTQH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              + D++ + +      G+      +LTGGEP L +D   +  L++ G  + +ETNGT 
Sbjct: 45  CLMSDDEIMEEV------GKYPAATVILTGGEPSLWIDGEFVDRLHRAGKYVCIETNGTR 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P  IDW+  SPK G  L I    E+K+V+   +++   Y       F LQP       
Sbjct: 99  LLPGNIDWVTCSPKQGTRLGIARMDEVKVVYEGQDIT--GYEQLPAAHFFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            N    +    ++PKWRLS+QTHK I IR
Sbjct: 153 NNIGETVDCVMRHPKWRLSLQTHKLIDIR 181


>gi|258647408|ref|ZP_05734877.1| NrdG protein [Prevotella tannerae ATCC 51259]
 gi|260852776|gb|EEX72645.1| NrdG protein [Prevotella tannerae ATCC 51259]
          Length = 189

 Score =  198 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 80/213 (37%), Positives = 108/213 (50%), Gaps = 28/213 (13%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M  + I EIF +LQGEG ++G  ++F RFSGCNL            C FCDT        
Sbjct: 1   MTRFKINEIFYSLQGEGFYSGIASIFIRFSGCNLS-----------CSFCDTQH-----E 44

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
            G     +Q+ D +           ++ VLTGGEP L V   LI  L+  G  + +ETNG
Sbjct: 45  TGELMTQEQILDQVTR------FPAKHVVLTGGEPSLFVTKELIDGLHAAGKYVCIETNG 98

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
               P+GIDW+ +SPK      +K   ELK+VF     +P + I      + +QP D   
Sbjct: 99  LHALPEGIDWVTLSPKT-AQTILKTCNELKVVFTDDTFNPHDEIK--AAHYFIQPCDMGN 155

Query: 181 LEENTNL---AISYCFQNPKWRLSVQTHKFIGI 210
             +N  +    ISY  +NP+WRLS+QTHK IGI
Sbjct: 156 SIKNNRILASCISYVKENPRWRLSLQTHKMIGI 188


>gi|224026000|ref|ZP_03644366.1| hypothetical protein BACCOPRO_02751 [Bacteroides coprophilus DSM
           18228]
 gi|224019236|gb|EEF77234.1| hypothetical protein BACCOPRO_02751 [Bacteroides coprophilus DSM
           18228]
          Length = 181

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 81/208 (38%), Positives = 107/208 (51%), Gaps = 28/208 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG HAG  AVF RFSGCNL            C FCDT        +G
Sbjct: 1   MKKINEIFYSLQGEGYHAGTPAVFVRFSGCNLK-----------CDFCDTRH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
                  +   +E+         R  +LTGGEP L +D  L+ AL+  G  + +ETNGT 
Sbjct: 45  TEMENGDIVKAVEQ------YPCRMVILTGGEPGLWIDSALVDALHASGRYVCIETNGTC 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P+ IDW+  SPK G  LK+    E+K+V+   +VS    +      + LQP       
Sbjct: 99  LLPENIDWVTCSPKQGTSLKVAHVDEVKVVYLGQDVSA--CLDIPARHYFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +NT+  I+Y  Q+P WRLS+QTHK I I
Sbjct: 153 QNTDEVIAYIKQHPVWRLSLQTHKLINI 180


>gi|283479535|emb|CAY75451.1| Uncharacterized protein ygcF [Erwinia pyrifoliae DSM 12163]
          Length = 277

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 66/237 (27%), Positives = 94/237 (39%), Gaps = 41/237 (17%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           +  Y I E+F TLQGEG + G  A+F R  GC +            C +CDT     +  
Sbjct: 54  LMQYPINEMFQTLQGEGFYTGVPAIFIRLQGCPV-----------GCSWCDTKHTWDKLA 102

Query: 61  KGGRYNVDQLADLIE-------------EQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
                  D L   +E             E         ++ V+TGGEP +    PL  AL
Sbjct: 103 DRETSLGDILLKTVETDAWGAADAPALLETIRRHGWTAKHIVITGGEPCIYDLTPLTAAL 162

Query: 108 NKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKL-VFPQVNV 158
              GF   +ET+GT +       W+ VSPK          +  +    E+K  V  Q +V
Sbjct: 163 QDSGFSCQIETSGTHQVRCTAQTWVTVSPKVNMRGGYDVLNQALVRADEVKHPVARQRDV 222

Query: 159 SPENYI-----GFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              + +            +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 223 DALDELLATLNDNKARIIALQPISQK--ADATQLCIDTCIAR-NWRLSMQTHKYLNI 276


>gi|188026339|ref|ZP_02961731.2| hypothetical protein PROSTU_03780 [Providencia stuartii ATCC 25827]
 gi|188022533|gb|EDU60573.1| hypothetical protein PROSTU_03780 [Providencia stuartii ATCC 25827]
          Length = 230

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 67/244 (27%), Positives = 92/244 (37%), Gaps = 49/244 (20%)

Query: 1   MKL------YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDF 54
           M +      Y I EIF TLQGEG   G  AVF R  GC +            C +CDT  
Sbjct: 1   MTMPESAMNYPINEIFQTLQGEGVFTGVPAVFIRLQGCPV-----------GCSWCDTKH 49

Query: 55  VGIQGTKG---------GRYNVDQLA----DLIEEQWITGEKEGRYCVLTGGEPLLQVDV 101
              +                + D  A      +           ++ V+TGGEP +   +
Sbjct: 50  TWEKEESKATTLGDIALKTVDTDTWALADSHELINLMKKQGYTAKHIVITGGEPCIYDLL 109

Query: 102 PLIQALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGCD-------LKIKGGQELKLVF 153
           PL   L  +G++  +ET+GT         W+ VSPK G           I    E+K   
Sbjct: 110 PLTCELENQGYQCQIETSGTYPIQCSDKTWVTVSPKVGMKGGLQVLTESINRANEIKHPV 169

Query: 154 PQVNVSPENYIGFDFER-------FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHK 206
            +     E       +R        +LQP+    L   T L I  C     WRLS+QTHK
Sbjct: 170 AREK-DIEELDKLLAKRTEKHAPVVALQPISQKSL--ATKLCIDTCIAR-NWRLSIQTHK 225

Query: 207 FIGI 210
           ++ I
Sbjct: 226 YLNI 229


>gi|152971643|ref|YP_001336752.1| coenzyme PQQ synthesis protein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|262041519|ref|ZP_06014716.1| radical SAM domain protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330012239|ref|ZP_08307334.1| radical SAM domain protein [Klebsiella sp. MS 92-3]
 gi|150956492|gb|ABR78522.1| putative coenzyme PQQ synthesis protein, nitrogenase
           iron-molybdenum domain [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|259041080|gb|EEW42154.1| radical SAM domain protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328533879|gb|EGF60548.1| radical SAM domain protein [Klebsiella sp. MS 92-3]
          Length = 225

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 69/242 (28%), Positives = 96/242 (39%), Gaps = 50/242 (20%)

Query: 1   MKL-YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI-- 57
           M + Y I E+F TLQGEG   G  A+F R  GC +            C +CDT       
Sbjct: 1   MTMQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDKL 49

Query: 58  ---------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP 102
                          +  K G  + + L  +I  Q  T     R+ V+TGGEP +    P
Sbjct: 50  ADREVSLFSILAKTKESDKWGPASSEDLLAIIGRQGWT----ARHVVITGGEPCIHDLTP 105

Query: 103 LIQALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV-- 152
           L   L + GF   +ET+GT E       W+ VSPK             ++   E+K    
Sbjct: 106 LTSLLEQNGFSCQIETSGTHEVRCSPNTWVTVSPKVNMRGGYDVLSQALQRADEIKHPVG 165

Query: 153 ----FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                  ++   E          +LQP+     E+ T L I  C     WRLS+QTHK++
Sbjct: 166 RVRDIEALDELLETLSDDKPRIIALQPISQK--EDATRLCIDTCIAR-NWRLSMQTHKYL 222

Query: 209 GI 210
            I
Sbjct: 223 NI 224


>gi|167763255|ref|ZP_02435382.1| hypothetical protein BACSTE_01627 [Bacteroides stercoris ATCC
           43183]
 gi|167698549|gb|EDS15128.1| hypothetical protein BACSTE_01627 [Bacteroides stercoris ATCC
           43183]
          Length = 181

 Score =  197 bits (502), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 75/209 (35%), Positives = 103/209 (49%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGFHTGTPAVFVRFSGCNLK-----------CSFCDTQH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              + +++   +      G+      +LTGGEP L +D   +  L++ G  + +ETNGT 
Sbjct: 45  VWMSDEEILAEV------GKYPAMTVILTGGEPSLWIDREFVDCLHRMGKYVCIETNGTH 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P  IDW+  SPK G  L I    E+K+V+   +++           F LQP       
Sbjct: 99  SLPDNIDWVTCSPKQGAKLCISRMDEVKVVYEGQDIAVYE--SLPAGHFFLQPCSCS--- 153

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            NT   ++   Q+PKWRLS+QTHK I I+
Sbjct: 154 -NTAETVACVMQHPKWRLSLQTHKLIEIK 181


>gi|146292953|ref|YP_001183377.1| radical activating enzyme [Shewanella putrefaciens CN-32]
 gi|145564643|gb|ABP75578.1| radical activating enzyme [Shewanella putrefaciens CN-32]
          Length = 222

 Score =  197 bits (502), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 65/237 (27%), Positives = 91/237 (38%), Gaps = 44/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y + E+F T+QGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MNYPVNEVFETIQGEGVFTGVPAIFVRLQGCPV-----------GCAWCDTKQTWDVLEA 49

Query: 57  ----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
                     + GT G     +  AD +   +       R+ V+TGGEP +     L + 
Sbjct: 50  NKVSPEQVITVDGTIGRW--AEHTADSLIAAFNAKGFTARHIVITGGEPCMYDLRELTET 107

Query: 107 LNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKLVFPQVNV 158
           L+ +GF   +ET+GT E       W+ VSPK                  E+K      N 
Sbjct: 108 LHSQGFATQIETSGTFEVNCADNTWVTVSPKVNMKGGYPVLAQALNRANEIKHPIATENH 167

Query: 159 SPE-----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             E       I    +   LQP+        T LA+  C     WRLS+QTHK++ I
Sbjct: 168 IDELDELLQDIDISAKTICLQPISQK--PRATELAMKVCIAR-NWRLSIQTHKYLDI 221


>gi|114047413|ref|YP_737963.1| radical activating enzyme [Shewanella sp. MR-7]
 gi|113888855|gb|ABI42906.1| radical activating enzyme [Shewanella sp. MR-7]
          Length = 222

 Score =  197 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 64/236 (27%), Positives = 92/236 (38%), Gaps = 42/236 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y + E+F T+QGEG   G  A+F R  GC +            C +CDT        +
Sbjct: 1   MNYPVNEVFETIQGEGVFTGVPAIFVRLQGCPV-----------GCAWCDTKQTW-DLLE 48

Query: 62  GGRYNVDQL--------------ADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
             + + +Q+              A  + E +       R+ V+TGGEP +     L  AL
Sbjct: 49  ENKVSPEQVITVDGSVGRWANHTAQSLIEAFNAKGYTARHVVITGGEPCMYDLNELTHAL 108

Query: 108 NKRGFEIAVETNGTIEPPQG-IDWICVSPKAGCDLKIK-------GGQELKLVFPQVNVS 159
           +  GF   +ET+GT E       W+ VSPK       +          E+K      N  
Sbjct: 109 HAAGFATQIETSGTFEVKCDADTWVTVSPKINMKGGYQVLAQALIRANEIKHPIATENHI 168

Query: 160 PE-----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E       I    +   LQP+        T LA+  C     WRLS+QTHK++ I
Sbjct: 169 DELDELLKGIDVSAKTICLQPISQK--PRATELAMKVCIAR-NWRLSIQTHKYLNI 221


>gi|167623866|ref|YP_001674160.1| radical SAM domain-containing protein [Shewanella halifaxensis
           HAW-EB4]
 gi|167353888|gb|ABZ76501.1| Radical SAM domain protein [Shewanella halifaxensis HAW-EB4]
          Length = 222

 Score =  197 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 68/237 (28%), Positives = 96/237 (40%), Gaps = 44/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y + E+F T+QGEG   G  AVF R  GC +            C +CDT         
Sbjct: 1   MKYPVNEVFETIQGEGTFTGVPAVFVRLQGCPV-----------GCSWCDTKQTWELLEA 49

Query: 57  ----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
                     + GT G R++     +L+      G    ++ V+TGGEP L     L Q 
Sbjct: 50  NHVAKELVIQVDGTIG-RWSELSAEELVNAFKDKG-FNAKHIVITGGEPCLYDLTELTQY 107

Query: 107 LNKRGFEIAVETNGTIEPPQG-IDWICVSPKAGCDLKIK-------GGQELKLVFPQVNV 158
           L+ +G++  +ET+GT +       W+ VSPK       K          E+K      N 
Sbjct: 108 LHSQGYQTQIETSGTFDVLCHADTWVTVSPKVNMKGGYKVLAQALNRANEIKHPIATQNH 167

Query: 159 SPE-----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             E       I    +   LQP+        T LA+S C     WRLS+QTHK++ I
Sbjct: 168 IDELDELLEGIDLTDKTVCLQPISQK--ARATELAMSTCIAR-NWRLSIQTHKYLDI 221


>gi|310766631|gb|ADP11581.1| Uncharacterized protein ygcF [Erwinia sp. Ejp617]
          Length = 223

 Score =  197 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 66/236 (27%), Positives = 91/236 (38%), Gaps = 41/236 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y I E+F TLQGEG + G  A+F R  GC +            C +CDT     +   
Sbjct: 1   MQYPINEMFQTLQGEGFYTGVPAIFIRLQGCPV-----------GCSWCDTKHTWDKLAN 49

Query: 62  GGRYNVDQLADLIE-------------EQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                 D L   +E             E         ++ V+TGGEP +    PL  AL 
Sbjct: 50  RETSLGDILLKTVETDAWGAADAPALLETIRRHGWTAKHIVITGGEPCIYDLTPLTAALQ 109

Query: 109 KRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVS 159
             GF   +ET+GT +       W+ VSPK                  E+K  V  Q +V 
Sbjct: 110 DSGFSCQIETSGTHQVRCTAQTWVTVSPKVNMRGGYDVLNQALARADEVKHPVARQRDVD 169

Query: 160 PENYI-----GFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             + +            +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 170 ALDELLATLNDNKARIIALQPISQK--ADATQLCIDTCIAR-NWRLSMQTHKYLNI 222


>gi|304408669|ref|ZP_07390290.1| Radical SAM domain protein [Shewanella baltica OS183]
 gi|307305498|ref|ZP_07585246.1| Radical SAM domain protein [Shewanella baltica BA175]
 gi|304352490|gb|EFM16887.1| Radical SAM domain protein [Shewanella baltica OS183]
 gi|306911801|gb|EFN42226.1| Radical SAM domain protein [Shewanella baltica BA175]
          Length = 222

 Score =  197 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 65/237 (27%), Positives = 91/237 (38%), Gaps = 44/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y + E+F T+QGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MNYPVNEVFETIQGEGVFTGVPAIFVRLQGCPV-----------GCAWCDTKQTWDVLEV 49

Query: 57  ----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
                     + GT G     D  A  +   +       R+ V+TGGEP +     L + 
Sbjct: 50  NKVTPEQVISVDGTIGRW--ADHTAQSLIAAFHAKGFTARHIVITGGEPCMYDLRELTET 107

Query: 107 LNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKLVFPQVNV 158
           L+ +GF   +ET+GT +       W+ VSPK       K          E+K      N 
Sbjct: 108 LHNQGFATQIETSGTFDINCADDTWVTVSPKVNMKGGYKVLTQALNRANEIKHPIATENH 167

Query: 159 SPE-----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             E       I    +   LQP+        T LA+  C     WRLS+QTHK++ I
Sbjct: 168 IAELDELLQDIDISAKTICLQPISQK--PRATELAMKVCIAR-NWRLSIQTHKYLNI 221


>gi|260599124|ref|YP_003211695.1| hypothetical protein CTU_33320 [Cronobacter turicensis z3032]
 gi|260218301|emb|CBA33277.1| Uncharacterized protein ygcF [Cronobacter turicensis z3032]
          Length = 223

 Score =  197 bits (501), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 93/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWETLAD 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + ++L   IE Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSIIAKTKESDKWGSASPEELLAAIERQ----AYTARHVVITGGEPCIHDLLPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
           + L   G+   +ET+GT E       W+ VSPK          D  +    E+K      
Sbjct: 106 ELLEAHGYSCQIETSGTHEVRCTTGTWVTVSPKVNMRGGYEVLDQALMRADEIKHPVGRM 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLARLHDERQRVIALQPISQKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|268315892|ref|YP_003289611.1| queuosine biosynthesis protein QueE [Rhodothermus marinus DSM 4252]
 gi|262333426|gb|ACY47223.1| queuosine biosynthesis protein QueE [Rhodothermus marinus DSM 4252]
          Length = 233

 Score =  197 bits (501), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 98/239 (41%), Positives = 123/239 (51%), Gaps = 36/239 (15%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRL------SAQCR-FCDTD 53
           M+ Y +KEI+ TLQGEG  AGR AVF RF GCNLWSGR++DR        A C  +CDTD
Sbjct: 1   MRSYRVKEIWKTLQGEGFFAGRPAVFVRFVGCNLWSGRDEDRARDARRTGADCPRWCDTD 60

Query: 54  FVGIQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFE 113
           F          Y  D+L   ++E         ++CVLTGGEPLLQ+D  L++AL   G+ 
Sbjct: 61  FR---KEGSRAYTADELVAAMQEVG----GPIQFCVLTGGEPLLQLDAALMRALKAAGYF 113

Query: 114 IAVETNGTIEPPQGI-----------DWICVSPKAGCD-LKIKGGQELKLVFPQ------ 155
           +A+ETNGTI   +             DWI  SPK   D L ++   ELKLV P       
Sbjct: 114 VAIETNGTISLREACTDPETGQVVAPDWIVCSPKLPEDRLALEYFDELKLVVPDYRPEQY 173

Query: 156 ----VNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                   P    G       LQP DGP L E    A+     +P WR+SVQTHK +G+
Sbjct: 174 ARFARRARPHRVGGRRIPLLWLQPEDGPRLAEAQRCAVELALAHPDWRVSVQTHKILGV 232


>gi|156932742|ref|YP_001436658.1| hypothetical protein ESA_00531 [Cronobacter sakazakii ATCC BAA-894]
 gi|156530996|gb|ABU75822.1| hypothetical protein ESA_00531 [Cronobacter sakazakii ATCC BAA-894]
          Length = 223

 Score =  197 bits (501), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 93/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWETLAD 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L   IE Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSIIAKTKESDKWGAASPEDLLAAIERQ----AYTARHVVITGGEPCIHDLLPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
           + L   G+   +ET+GT E       W+ VSPK          D  +    E+K      
Sbjct: 106 ELLEAHGYSCQIETSGTHEVRCTTGTWVTVSPKVNMRGGYEVLDQALMRADEIKHPVGRM 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLARLHDERQRVIALQPISQK--EDATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|317492851|ref|ZP_07951275.1| radical SAM domain-containing protein [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316918973|gb|EFV40308.1| radical SAM domain-containing protein [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 223

 Score =  197 bits (501), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 69/240 (28%), Positives = 96/240 (40%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG + G  A+F R  GC +            C +CDT         
Sbjct: 1   MSYPINELFQTLQGEGFYTGVPAIFIRLQGCPV-----------GCSWCDTKHTWEQLPE 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +    G    DQL  ++ E         R+ V+TGGEP +    PL 
Sbjct: 50  REIGMNEILIKTAESDAWGSATPDQLLAILHE----RGYTARHVVITGGEPCIHDLRPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKL-VFPQ 155
           + LN+ GF   +ET+GT E       W+ VSPK      +K          E+K  V  +
Sbjct: 106 ELLNQHGFSCQIETSGTHEIRCSDATWVTVSPKVNMKGGMKVLESALIRADEVKHPVARE 165

Query: 156 VNVSPEN-----YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            ++   +              +LQP+     E  T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEDLDTLLAVLHDDKQRIIALQPISQK--ESATKLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|198276623|ref|ZP_03209154.1| hypothetical protein BACPLE_02819 [Bacteroides plebeius DSM 17135]
 gi|198270148|gb|EDY94418.1| hypothetical protein BACPLE_02819 [Bacteroides plebeius DSM 17135]
          Length = 181

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 82/208 (39%), Positives = 109/208 (52%), Gaps = 28/208 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT        +G
Sbjct: 1   MKKINEIFYSLQGEGFHVGTPAVFVRFSGCNLK-----------CEFCDTHH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              + +++ + + +         +  +LTGGEP L VD  LI AL+K G  I +ETNGT 
Sbjct: 45  VMMSDEEIVEKVCQ------YPCKTVILTGGEPGLWVDEDLIAALHKAGKYICIETNGTC 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P+ IDW+  SPK G  L++    E+K+VF   +VSP   +   F  + LQP       
Sbjct: 99  VLPESIDWVTCSPKLGAPLRVNRIDEVKVVFLGQDVSPYLELKASF--YFLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            NT   + Y   +P+WRLS+QTHK I I
Sbjct: 153 RNTAEVVEYIKSHPQWRLSLQTHKLIDI 180


>gi|292487226|ref|YP_003530098.1| hypothetical protein EAMY_0740 [Erwinia amylovora CFBP1430]
 gi|291552645|emb|CBA19690.1| Uncharacterized protein ygcF [Erwinia amylovora CFBP1430]
          Length = 255

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 67/241 (27%), Positives = 96/241 (39%), Gaps = 49/241 (20%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG---- 56
           +  Y I E+F TLQGEG + G  A+F R  GC +            C +CDT        
Sbjct: 32  LMQYPINEMFQTLQGEGVYTGVPAIFIRLQGCPV-----------GCSWCDTKHTWDKLA 80

Query: 57  -------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL 103
                        ++    G  +   L + I     T     ++ V+TGGEP +    PL
Sbjct: 81  NRETSLGDILLKTVESDAWGAADAPALLETIRRHGWT----AKHIVITGGEPCIHDLTPL 136

Query: 104 IQALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKL-VFP 154
             AL   GF   +ET+GT E       W+ VSPK          +  +    E+K  V  
Sbjct: 137 TAALQGSGFSCQIETSGTHEVHCTAETWVTVSPKVNMRGGYDVLNQALVRADEVKHPVAR 196

Query: 155 QVNVSPENYI-----GFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIG 209
           Q +V   + +            +LQP+      + T L I  C     WRLS+QTHK++ 
Sbjct: 197 QRDVDALDDLLATLSDNKARIIALQPVSQK--ADATQLCIDTCIAR-NWRLSMQTHKYLN 253

Query: 210 I 210
           I
Sbjct: 254 I 254


>gi|157369053|ref|YP_001477042.1| radical SAM domain-containing protein [Serratia proteamaculans 568]
 gi|157320817|gb|ABV39914.1| Radical SAM domain protein [Serratia proteamaculans 568]
          Length = 223

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 94/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGFFTGVPAIFIRLQGCPV-----------GCSWCDTKHTWEKEAN 49

Query: 57  ------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +    G  + +QL  +I +Q        R+ V+TGGEP +    PL 
Sbjct: 50  REVDMQRILVKTEESDAWGSASAEQLLAVIRQQG----YTARHVVITGGEPCIYDLTPLT 105

Query: 105 QALNKRGFEIAVETNGTIEPPQG-IDWICVSPKAGCDLKIK-------GGQELKLV---- 152
           + L + G+   +ET+GT E       W+ VSPK      +K          E+K      
Sbjct: 106 ELLEEHGYGCQIETSGTHEIQCSAKTWVTVSPKVNMRGGMKVLSQALQRADEVKHPVGRE 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+     EE T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDALLATLHDEKPRIIALQPISQK--EEATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|259909462|ref|YP_002649818.1| hypothetical protein EpC_28370 [Erwinia pyrifoliae Ep1/96]
 gi|224965084|emb|CAX56616.1| conserved uncharacterized protein [Erwinia pyrifoliae Ep1/96]
          Length = 223

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 66/236 (27%), Positives = 93/236 (39%), Gaps = 41/236 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y I E+F TLQGEG + G  A+F R  GC +            C +CDT     +   
Sbjct: 1   MQYPINEMFQTLQGEGFYTGVPAIFIRLQGCPV-----------GCSWCDTKHTWDKLAD 49

Query: 62  GGRYNVDQLADLIE-------------EQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                 D L   +E             E         ++ V+TGGEP +    PL  AL 
Sbjct: 50  RETSLGDILLKTVETDAWGAADAPALLETIRRHGWTAKHIVITGGEPCIYDLTPLTAALQ 109

Query: 109 KRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKL-VFPQVNVS 159
             GF   +ET+GT +       W+ VSPK          +  +    E+K  V  Q +V 
Sbjct: 110 DSGFSCQIETSGTHQVRCTAQTWVTVSPKVNMRGGYDVLNQALVRADEVKHPVARQRDVD 169

Query: 160 PENYI-----GFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             + +            +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 170 ALDELLATLNDNKARIIALQPISQK--ADATQLCIDTCIAR-NWRLSMQTHKYLNI 222


>gi|188534838|ref|YP_001908635.1| hypothetical protein ETA_27180 [Erwinia tasmaniensis Et1/99]
 gi|188029880|emb|CAO97764.1| Conserved hypothetical protein [Erwinia tasmaniensis Et1/99]
          Length = 223

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 68/236 (28%), Positives = 94/236 (39%), Gaps = 41/236 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y I E+F TLQGEG + G  A+F R  GC +            C +CDT     +   
Sbjct: 1   MQYPINEMFQTLQGEGVYTGVPAIFIRLQGCPV-----------GCSWCDTKHTWDKLAN 49

Query: 62  GGRYNVDQLADLIE-------------EQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                 D L   +E             E         ++ V+TGGEP +   VPL  AL 
Sbjct: 50  RETSLGDILLKTVETDAWGAADAPALLETIRRHGWTAKHIVVTGGEPCIHDLVPLTAALQ 109

Query: 109 KRGFEIAVETNGTIEPPQG-IDWICVSPKAGC-------DLKIKGGQELKL-VFPQVNVS 159
             GF   +ET+GT E       W+ VSPK          +  +    E+K  V  Q +V 
Sbjct: 110 DAGFSCQIETSGTHEVSCTAQTWVTVSPKVNMRGGYDVLNQALVRADEVKHPVARQRDVE 169

Query: 160 PENYI-----GFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             + +            +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 170 ALDELLGTLNDNKARIIALQPISQK--ADATQLCIDTCIAR-NWRLSMQTHKYLNI 222


>gi|119469471|ref|ZP_01612375.1| queC protein [Alteromonadales bacterium TW-7]
 gi|119447006|gb|EAW28276.1| queC protein [Alteromonadales bacterium TW-7]
          Length = 221

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 61/234 (26%), Positives = 93/234 (39%), Gaps = 40/234 (17%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------ 56
           +Y I E+F T+QGE    G  ++F R  GC +            C +CDT          
Sbjct: 1   MYKINEVFETIQGEASFTGTPSIFLRLQGCPV-----------GCSWCDTKQTWDVDNVY 49

Query: 57  -------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNK 109
                  ++      +  D  A+ + E + +     ++ V+TGGEP +     + + L+ 
Sbjct: 50  KVSLDETVEKKADSDHWADASAEQVLELFKSRGYTAKHVVITGGEPCMYDLNQVCKLLHD 109

Query: 110 RGFEIAVETNGTIEP-PQGIDWICVSPKAGCD-------LKIKGGQELKLVFPQVNVSPE 161
            GF   +ET+GT E       W+ VSPK             +K   E+K          E
Sbjct: 110 NGFTTQIETSGTFEILAPEQTWVTVSPKINMRGGYEVLTSAMKRANEIKHPVAMQKHVEE 169

Query: 162 NYIGF-----DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               F     + +   LQP+        T LAI  C     WRLS+Q HK++GI
Sbjct: 170 LEELFAKTGVNPKLVYLQPISQKVS--ATKLAIDTCIAK-NWRLSIQVHKYLGI 220


>gi|332140739|ref|YP_004426477.1| radical activating enzyme [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327550761|gb|AEA97479.1| radical activating enzyme [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 224

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 64/238 (26%), Positives = 102/238 (42%), Gaps = 43/238 (18%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG---- 56
           M   +I E+F T+QGEG H G  ++F R  GC +            C +CDT        
Sbjct: 1   MSTLNINEMFETIQGEGAHTGVPSIFVRLQGCPV-----------GCPWCDTKHTWEIKP 49

Query: 57  ----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
                      +G +   Y +   +DL+ +    G    ++ V+TGGEP +    PL   
Sbjct: 50  DLSVTPEAVITKGQESETYFISNESDLLTQFGHEG-YVAKHVVITGGEPCMYDLRPLTTL 108

Query: 107 LNKRGFEIAVETNGTIEPPQG-IDWICVSPKAGCD-------LKIKGGQELKL------V 152
           L+ +G+   +ET+GT E       ++ VSPK             ++   E+K        
Sbjct: 109 LHDKGYTTQIETSGTFEILCDERTYVTVSPKINMKGGYDVLISALERANEIKHPIAMQKH 168

Query: 153 FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             +++    N      ++  LQP+     +  T LA+  C +   WRLS+QTHK+IGI
Sbjct: 169 IDELDALLANVSSLKGKQVCLQPISQ--QKRATELAVRTCIER-NWRLSLQTHKYIGI 223


>gi|168235995|ref|ZP_02661053.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194736116|ref|YP_002115902.1| radical SAM domain-containing protein [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|204928010|ref|ZP_03219210.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|194711618|gb|ACF90839.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197290769|gb|EDY30123.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|204322332|gb|EDZ07529.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 223

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 94/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDKLSD 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q    +   R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAASSEDLLAVINRQ----DYTARHVVITGGEPCIHDLMPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKSGFSCQIETSGTHEVRCTPNTWVTVSPKVNMRGGYDVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLSDDKPRVIALQPISQK--EDATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|260061953|ref|YP_003195033.1| hypothetical protein RB2501_10187 [Robiginitalea biformata
           HTCC2501]
 gi|88783515|gb|EAR14686.1| hypothetical protein RB2501_10187 [Robiginitalea biformata
           HTCC2501]
          Length = 210

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 60/215 (27%), Positives = 91/215 (42%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + E F T+QGEG H G  A F R  GC++            C +CD      +    
Sbjct: 15  MLPLMEAFYTIQGEGFHKGTAAYFIRVGGCDV-----------GCHWCDVK----ESWNA 59

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             +    +  ++ +     +      V+TGGEPL+    PL   L  RG +I +ET+G  
Sbjct: 60  DLHPPTAVDTIVRDAAAASD----TIVVTGGEPLMWDMAPLTSRLKSRGMKIHIETSGAY 115

Query: 123 EPPQGIDWICVSPKAGCDL---KIKGGQELKLVFPQVNVSPENYIGFDF----ERFSLQP 175
                 DWIC+SPK          +   ELK++    +         +         LQP
Sbjct: 116 PLTGTWDWICLSPKKNKAPVGDIHQRAHELKVIVYNRHDLKFAEEHAELTSPDCLLYLQP 175

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +    E  T L + Y   NP+WR+S+QTHK++ I
Sbjct: 176 -EWSVRERVTPLIVEYVMANPRWRVSLQTHKYLNI 209


>gi|312171327|emb|CBX79586.1| Uncharacterized protein ygcF [Erwinia amylovora ATCC BAA-2158]
          Length = 223

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 95/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I E+F TLQGEG + G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGVYTGVPAIFIRLQGCPV-----------GCSWCDTKHTWDKLAN 49

Query: 57  ------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                       ++    G  +   L + I     T     ++ V+TGGEP +    PL 
Sbjct: 50  RETSLGDILLKTVESDAWGAADAPALLETIRRHGWT----AKHIVITGGEPCIYDLTPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKL-VFPQ 155
            AL   GF   +ET+GT E       W+ VSPK          +  +    E+K  V  Q
Sbjct: 106 AALQGSGFSCQIETSGTHEVHCTAETWVTVSPKVNMRGGYDVLNQALVRADEVKHPVARQ 165

Query: 156 VNVSPENYI-----GFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +V   + +            +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDVDALDDLLATLSDNKARIIALQPVSQK--ADATQLCIDTCIAR-NWRLSMQTHKYLNI 222


>gi|16761723|ref|NP_457340.1| hypothetical protein STY3080 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16766257|ref|NP_461872.1| hypothetical protein STM2951 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29143207|ref|NP_806549.1| hypothetical protein t2852 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|161615872|ref|YP_001589837.1| hypothetical protein SPAB_03664 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167550190|ref|ZP_02343947.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|167993197|ref|ZP_02574292.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168231033|ref|ZP_02656091.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168242700|ref|ZP_02667632.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168261911|ref|ZP_02683884.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168463900|ref|ZP_02697817.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168820338|ref|ZP_02832338.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194443979|ref|YP_002042196.1| hypothetical protein SNSL254_A3167 [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194448254|ref|YP_002046911.1| radical SAM domain-containing protein [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194472830|ref|ZP_03078814.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197250818|ref|YP_002147853.1| radical SAM domain-containing protein [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197261663|ref|ZP_03161737.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|198243481|ref|YP_002216919.1| radical SAM domain-containing protein [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200387574|ref|ZP_03214186.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205353891|ref|YP_002227692.1| hypothetical protein SG2855 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207858211|ref|YP_002244862.1| hypothetical protein SEN2790 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213022667|ref|ZP_03337114.1| hypothetical protein Salmonelentericaenterica_08538 [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
 gi|213163461|ref|ZP_03349171.1| hypothetical protein Salmoneentericaenterica_26915 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213424925|ref|ZP_03357675.1| hypothetical protein SentesTyphi_03996 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213648292|ref|ZP_03378345.1| hypothetical protein SentesTy_13994 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213852988|ref|ZP_03382520.1| hypothetical protein SentesT_09066 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|224584735|ref|YP_002638533.1| hypothetical protein SPC_3001 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238909725|ref|ZP_04653562.1| hypothetical protein SentesTe_01135 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|289811290|ref|ZP_06541919.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|289829811|ref|ZP_06547326.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25511883|pir||AB0859 conserved hypothetical protein STY3080 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16421502|gb|AAL21831.1| putative organic radical activating enzymes [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|16504024|emb|CAD06057.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29138840|gb|AAO70409.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|161365236|gb|ABX69004.1| hypothetical protein SPAB_03664 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402642|gb|ACF62864.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194406558|gb|ACF66777.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194459194|gb|EDX48033.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|195633215|gb|EDX51629.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197214521|gb|ACH51918.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197239918|gb|EDY22538.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197937997|gb|ACH75330.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199604672|gb|EDZ03217.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205273672|emb|CAR38662.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205324832|gb|EDZ12671.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205328757|gb|EDZ15521.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205334576|gb|EDZ21340.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205338143|gb|EDZ24907.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205342895|gb|EDZ29659.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205349084|gb|EDZ35715.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206710014|emb|CAR34369.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224469262|gb|ACN47092.1| hypothetical protein SPC_3001 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261248086|emb|CBG25921.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995084|gb|ACY89969.1| hypothetical protein STM14_3556 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301159510|emb|CBW19029.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312913972|dbj|BAJ37946.1| hypothetical protein STMDT12_C30030 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320087368|emb|CBY97133.1| probable molybdenum cofactor biosynthesis protein A [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
 gi|321225630|gb|EFX50684.1| Queuosine Biosynthesis QueE Radical SAM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|323131307|gb|ADX18737.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|326624683|gb|EGE31028.1| Radical SAM domain containing protein [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326629003|gb|EGE35346.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 223

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 93/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDKLSD 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAASSEDLLAVINRQG----YTARHVVITGGEPCIHDLMPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKSGFSCQIETSGTHEVRCTPNTWVTVSPKVNMRGGYDVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLSDDKPRVIALQPISQK--EDATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|191166820|ref|ZP_03028646.1| conserved hypothetical protein [Escherichia coli B7A]
 gi|190903191|gb|EDV62914.1| conserved hypothetical protein [Escherichia coli B7A]
          Length = 223

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 92/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWEKLED 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGSASSEDLLAVIGRQG----YTARHVVITGGEPCIHDLLPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLKKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYDVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLTDDKPRVIALQPISQKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|237729740|ref|ZP_04560221.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226908346|gb|EEH94264.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 223

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 93/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDKLED 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLYSILAKTKESDKWGAASSEDLLAVISRQG----YTARHVVITGGEPCIHDLMPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKVNMRGGYDVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLSDDKPRIIALQPISQK--EDATRLCIDTCIAR-NWRLSMQTHKYLNI 222


>gi|37524702|ref|NP_928046.1| hypothetical protein plu0701 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36784127|emb|CAE12996.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 223

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 64/237 (27%), Positives = 97/237 (40%), Gaps = 43/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y I EIF TLQGEG   G  A+F R  GC +            C +CDT     +  +
Sbjct: 1   MFYPINEIFQTLQGEGFFTGVPAIFIRLQGCPV-----------GCSWCDTKHTWEKEVE 49

Query: 62  GGRYNVDQLA--------------DLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
             R  ++ +                 I   ++  +   R+ V+TGGEP L   +PL + L
Sbjct: 50  KQR-TLETILLKTSESNEWSKASPKQITALFVQQKYTARHVVITGGEPCLYDLIPLTEEL 108

Query: 108 NKRGFEIAVETNGTIEPPQG-IDWICVSPKAGC-------DLKIKGGQELKL-VFPQVNV 158
              G++  +ET+GT         W+ VSPK             ++   E+K  V  + ++
Sbjct: 109 ESLGYQCQIETSGTYHVKCSAATWVTVSPKVNMRGGYRILQQALQRANEIKYPVARERDI 168

Query: 159 SPENYIGFDFE-----RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              + +            +LQP+     EE T L I  C     WR S+QTHK++ I
Sbjct: 169 EALDELLATLNDNSSRIIALQPISQK--EEATRLCIETCIAR-NWRFSMQTHKYLNI 222


>gi|304399225|ref|ZP_07381092.1| Radical SAM domain protein [Pantoea sp. aB]
 gi|304353279|gb|EFM17659.1| Radical SAM domain protein [Pantoea sp. aB]
          Length = 223

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 96/240 (40%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I E+F TLQGEG + G  A+F R  GC +            C +CDT         
Sbjct: 1   MFYPINEMFQTLQGEGYYTGVPAIFIRLQGCPV-----------GCSWCDTKHTWEKRTD 49

Query: 57  ------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                       ++    G  +   L + I +Q  T     R+ V+TGGEP +    PL 
Sbjct: 50  RETSLGDILIKTVESDAWGDADAATLVNAIAQQGWT----ARHVVITGGEPAIYDLRPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQ- 155
            AL + GF+  +ET+GT E       W+ VSPK             +    E+K    + 
Sbjct: 106 TALEQHGFQCQIETSGTHEIHCSEQTWVTVSPKVNMRGGYDVLPQALSRADEIKHPVARE 165

Query: 156 -----VNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                +++             +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDVDALDLLLAGIDDTKARIIALQPISRKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|261822768|ref|YP_003260874.1| hypothetical protein Pecwa_3531 [Pectobacterium wasabiae WPP163]
 gi|261606781|gb|ACX89267.1| conserved hypothetical protein [Pectobacterium wasabiae WPP163]
          Length = 223

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 96/240 (40%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I E+F TLQGEG   G  AVF R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAVFVRLQGCPV-----------GCSWCDTKHTWDKLAE 49

Query: 57  ------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +    G  + D +  L+ +Q        R+ V+TGGEP +    PL 
Sbjct: 50  RETSLDLVLVKTEESDAWGAASADDILALMVQQG----YTARHIVITGGEPCIHDLAPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQ- 155
             L K+GF   +ET+GT +       W+ VSPK          D  ++   E+K    + 
Sbjct: 106 LQLEKQGFSCQIETSGTHDVRCSPKTWVTVSPKVNMRGGMKVLDQALQRADEIKHPVARE 165

Query: 156 -----VNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+     E+ T L I+ C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDALLARLDDDKPRIVALQPISQK--EDATKLCIATCIAR-NWRLSMQTHKYLNI 222


>gi|56414895|ref|YP_151970.1| hypothetical protein SPA2807 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197363823|ref|YP_002143460.1| hypothetical protein SSPA2615 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|56129152|gb|AAV78658.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197095300|emb|CAR60857.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 223

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 93/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDKLSD 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLYSILAKIKESDKWGAASSEDLLAVINRQG----YTARHVVITGGEPCIHDLMPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKSGFSCQIETSGTHEVRCTPNTWVTVSPKVNMRGGYDVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLSDDKPRVIALQPISQK--EDATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|86141192|ref|ZP_01059738.1| hypothetical protein MED217_04222 [Leeuwenhoekiella blandensis
           MED217]
 gi|85831751|gb|EAQ50206.1| hypothetical protein MED217_04222 [Leeuwenhoekiella blandensis
           MED217]
          Length = 213

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 60/215 (27%), Positives = 95/215 (44%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           L  + E F T+QGEG H G  A F R  GC++            C +CD      +    
Sbjct: 18  LLPLMEEFYTIQGEGYHTGTPAYFIRVGGCDV-----------GCHWCDVK----ESWDA 62

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             +   + A ++       +K  +  V+TGGEPL+     L   L   G ++ +ET+G  
Sbjct: 63  AIHPPTEAAAIVA----NAKKYSKTIVITGGEPLMWDMNHLTSMLKAEGLQVHIETSGAY 118

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKL----VFPQVNVSPENYIGFDF---ERFSLQP 175
           E     DWIC+SPK     K +  +E       ++ + + +             +  LQP
Sbjct: 119 ELSGHWDWICLSPKKRMLPKPRIYEEAHELKVIIYNKSDFAFAEEHAAKVNGNCQLFLQP 178

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +    E+ T L + Y   NPKW++S+QTHK++ I
Sbjct: 179 -EWSVREKMTPLIVDYVMANPKWKVSLQTHKYLNI 212


>gi|292900399|ref|YP_003539768.1| hypothetical protein EAM_2701 [Erwinia amylovora ATCC 49946]
 gi|291200247|emb|CBJ47375.1| conserved hypothetical protein [Erwinia amylovora ATCC 49946]
          Length = 223

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 95/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I E+F TLQGEG + G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGVYTGVPAIFIRLQGCPV-----------GCSWCDTKHTWDKLAN 49

Query: 57  ------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                       ++    G  +   L + I     T     ++ V+TGGEP +    PL 
Sbjct: 50  RETSLGDILLKTVESDAWGAADAPALLETIRRHGWT----AKHIVITGGEPCIHDLTPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKL-VFPQ 155
            AL   GF   +ET+GT E       W+ VSPK          +  +    E+K  V  Q
Sbjct: 106 AALQGSGFSCQIETSGTHEVHCTAETWVTVSPKVNMRGGYDVLNQALVRADEVKHPVARQ 165

Query: 156 VNVSPENYI-----GFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +V   + +            +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDVDALDDLLATLSDNKARIIALQPVSQK--ADATQLCIDTCIAR-NWRLSMQTHKYLNI 222


>gi|113970395|ref|YP_734188.1| radical activating enzyme [Shewanella sp. MR-4]
 gi|113885079|gb|ABI39131.1| radical activating enzyme [Shewanella sp. MR-4]
          Length = 222

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 64/237 (27%), Positives = 90/237 (37%), Gaps = 44/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y + E+F T+QGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MNYPVNEVFETIQGEGVFTGVPAIFVRLQGCPV-----------GCAWCDTKQTWGLLEE 49

Query: 57  ----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
                     + G+ G     +  A  + E +       R+ V+TGGEP +     L   
Sbjct: 50  NKVSPQQVITVDGSVGRW--ANHTAQSLIEAFNAKGYTARHVVITGGEPCMYDLNELTHT 107

Query: 107 LNKRGFEIAVETNGTIEPPQG-IDWICVSPKAGCD-------LKIKGGQELKLVFPQVNV 158
           L+  GF   +ET+GT E       W+ VSPK             +    E+K      N 
Sbjct: 108 LHAAGFATQIETSGTFEVKCDADTWVTVSPKVNMKGGYQVLAQALTRANEIKHPIATENH 167

Query: 159 SPE-----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             E       I    +   LQP+        T LA+  C     WRLS+QTHK++ I
Sbjct: 168 IDELDELLKGIDVSVKTICLQPISQK--PRATELAMKVCIAR-NWRLSIQTHKYLNI 221


>gi|322614241|gb|EFY11173.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322620945|gb|EFY17803.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322624008|gb|EFY20842.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322628253|gb|EFY25042.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322633372|gb|EFY30114.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322636051|gb|EFY32759.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322639387|gb|EFY36075.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322643751|gb|EFY40302.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322648214|gb|EFY44680.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322656959|gb|EFY53244.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322658025|gb|EFY54293.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322664126|gb|EFY60325.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322673792|gb|EFY69891.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322677866|gb|EFY73929.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681040|gb|EFY77073.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322685637|gb|EFY81631.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323194776|gb|EFZ79963.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323200478|gb|EFZ85557.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323205060|gb|EFZ90043.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323207739|gb|EFZ92685.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323214808|gb|EFZ99556.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323222537|gb|EGA06902.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323226417|gb|EGA10625.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323230704|gb|EGA14822.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323234945|gb|EGA19031.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323238984|gb|EGA23034.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323244658|gb|EGA28664.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323247274|gb|EGA31240.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323251806|gb|EGA35671.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323257493|gb|EGA41183.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323263278|gb|EGA46815.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323267530|gb|EGA51014.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323272719|gb|EGA56125.1| radical SAM domain protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 223

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 93/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDKLSD 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAASSEDLLAVINRQG----YTARHVVITGGEPCIHDLMPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKSGFSCQIETSGTHEVCCTPNTWVTVSPKVNMRGGYDVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLSDDKPRVIALQPISQK--EDATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|117920607|ref|YP_869799.1| radical activating enzyme [Shewanella sp. ANA-3]
 gi|117612939|gb|ABK48393.1| radical activating enzyme [Shewanella sp. ANA-3]
          Length = 222

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 65/236 (27%), Positives = 88/236 (37%), Gaps = 42/236 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y + E+F T+QGEG   G  A+F R  GC +            C +CDT        +
Sbjct: 1   MNYPVNEVFETIQGEGVFTGVPAIFVRLQGCPV-----------GCAWCDTKQTWDLLEE 49

Query: 62  G--------------GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
                          GR+       LI+          R+ V+TGGEP +     L   L
Sbjct: 50  KKVSPEQVITVDGSVGRWANHTAQSLIDAFN-AKGYTARHVVITGGEPCMYDLNELTHTL 108

Query: 108 NKRGFEIAVETNGTIEPPQG-IDWICVSPKAGCDLKIK-------GGQELKLVFPQVNVS 159
           +  GF   +ET+GT E       W+ VSPK       K          E+K      N  
Sbjct: 109 HAAGFATQIETSGTFEVKCDADTWVTVSPKINMKGGYKVLAQALIRANEIKHPIATENHI 168

Query: 160 PE-----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E       I    +   LQP+        T LA+  C     WRLS+QTHK++ I
Sbjct: 169 DELDELLKGIDVSAKTICLQPISQK--PRATELAMKVCIAR-NWRLSIQTHKYLNI 221


>gi|120598962|ref|YP_963536.1| radical activating enzyme [Shewanella sp. W3-18-1]
 gi|120559055|gb|ABM24982.1| radical activating enzyme [Shewanella sp. W3-18-1]
 gi|319426518|gb|ADV54592.1| Radical SAM domain protein [Shewanella putrefaciens 200]
          Length = 222

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 65/237 (27%), Positives = 91/237 (38%), Gaps = 44/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y + E+F T+QGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MNYPVNEVFETIQGEGVFTGVPAIFVRLQGCPV-----------GCAWCDTKQTWDVLEA 49

Query: 57  ----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
                     + GT G     +  AD +   +       R+ V+TGGEP +     L + 
Sbjct: 50  NKVSPEQVITVDGTIGRW--AEHTADSLIAAFNAEGFTARHIVITGGEPCMYDLRELTET 107

Query: 107 LNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKLVFPQVNV 158
           L+ +GF   +ET+GT E       W+ VSPK                  E+K      N 
Sbjct: 108 LHSQGFATQIETSGTFEVNCADNTWVTVSPKVNMKGGYPVLAQALNRANEIKHPIATENH 167

Query: 159 SPE-----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             E       I    +   LQP+        T LA+  C     WRLS+QTHK++ I
Sbjct: 168 IDELDELLQDIDISAKTICLQPISQK--PRATELAMKVCIAR-NWRLSIQTHKYLDI 221


>gi|24374045|ref|NP_718088.1| radical activating enzyme [Shewanella oneidensis MR-1]
 gi|24348519|gb|AAN55532.1|AE015692_2 radical activating enzyme [Shewanella oneidensis MR-1]
          Length = 222

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 66/237 (27%), Positives = 92/237 (38%), Gaps = 44/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y + E+F T+QGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MNYPVNEVFETIQGEGVFTGVPAIFVRLQGCPV-----------GCAWCDTKQTWDLLET 49

Query: 57  ----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
                     + GT G     +  A  + E +       R+ V+TGGEP +     L   
Sbjct: 50  NKVSPEQVITVDGTVGRW--ANHTAQSLIEAFHAKGYTARHVVITGGEPCMYDLHELTHM 107

Query: 107 LNKRGFEIAVETNGTIEPPQGID-WICVSPKAGCDLKIK-------GGQELKLVFPQVNV 158
           L++ GF   +ET+GT E     D W+ VSPK                  E+K      N 
Sbjct: 108 LHRAGFATQIETSGTFEVKCDKDTWVTVSPKVNMKGGYPVLAQALNRANEIKHPIATQNH 167

Query: 159 SPE-----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             E     + I    +   LQP+        T LA+  C     WRLS+QTHK++ I
Sbjct: 168 IDELDELLSDIDVSAKTICLQPISQK--PRATELAMKVCIAR-NWRLSIQTHKYLNI 221


>gi|270264011|ref|ZP_06192279.1| hypothetical protein SOD_f02250 [Serratia odorifera 4Rx13]
 gi|270042204|gb|EFA15300.1| hypothetical protein SOD_f02250 [Serratia odorifera 4Rx13]
          Length = 223

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 95/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGFFTGVPAIFIRLQGCPV-----------GCSWCDTKHTWEKEAN 49

Query: 57  ------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +    G  + +QL  ++ +Q        R+ V+TGGEP +    PL 
Sbjct: 50  REVDMQRILVKTEESDAWGSASAEQLLAVMRQQG----YTARHVVITGGEPCIYDLTPLT 105

Query: 105 QALNKRGFEIAVETNGTIEPPQG-IDWICVSPKAGC-------DLKIKGGQELKLV---- 152
           Q L + G+   +ET+GT E       W+ VSPK          D  ++   E+K      
Sbjct: 106 QLLEENGYGCQIETSGTHEIQCSATTWVTVSPKVNMRGGMKVLDQALQRADEVKHPVGRE 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+     EE T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDALLATLHDEKPRIIALQPISQK--EEATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|212635182|ref|YP_002311707.1| Radical activating enzyme [Shewanella piezotolerans WP3]
 gi|212556666|gb|ACJ29120.1| Radical activating enzyme [Shewanella piezotolerans WP3]
          Length = 222

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 62/237 (26%), Positives = 95/237 (40%), Gaps = 44/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y + E+F T+QGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MNYPVNEVFETIQGEGYFTGVPAIFVRLQGCPV-----------GCAWCDTKHTWDVIEE 49

Query: 57  ----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
                     + GT G R++      L+     +     ++ V+TGGEP +         
Sbjct: 50  NRVAPELVIQVDGTIG-RWSELSSEQLVAAFK-SKGFTAKHIVITGGEPCMYDLTEFTHY 107

Query: 107 LNKRGFEIAVETNGTIEPPQGI-DWICVSPKAGCD-------LKIKGGQELKLVFPQVNV 158
           L++ G++  +ET+GT E       W+ VSPK             ++   E+K      N 
Sbjct: 108 LHQMGYQTQIETSGTFEVACDSGTWVTVSPKINMKGGYKVLAQALERANEIKHPIATRNH 167

Query: 159 SPE-----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             E       I  + +   LQP+        T LA+  C +   WRLS+QTHK++ I
Sbjct: 168 IDELDELLADIDINDKTVCLQPISQK--ARATELAMKTCIER-NWRLSIQTHKYLDI 221


>gi|283786677|ref|YP_003366542.1| hypothetical protein ROD_30371 [Citrobacter rodentium ICC168]
 gi|282950131|emb|CBG89767.1| conserved hypothetical protein [Citrobacter rodentium ICC168]
          Length = 223

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 93/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDKLED 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAASSEDLLAVINRQG----YTARHVVITGGEPCIHDLMPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 ALLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKVNMRGGYDILSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLSDDKPRVIALQPISQK--EDATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|300937751|ref|ZP_07152551.1| radical SAM domain protein [Escherichia coli MS 21-1]
 gi|300457230|gb|EFK20723.1| radical SAM domain protein [Escherichia coli MS 21-1]
          Length = 223

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 92/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I EIF TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEIFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWEKLED 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAASSEDLLAVIGRQG----YTARHVVITGGEPCIHDLLPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLTDDKPRVIALQPISQKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|319642227|ref|ZP_07996886.1| hypothetical protein HMPREF9011_02486 [Bacteroides sp. 3_1_40A]
 gi|317386083|gb|EFV67003.1| hypothetical protein HMPREF9011_02486 [Bacteroides sp. 3_1_40A]
          Length = 181

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 69/209 (33%), Positives = 103/209 (49%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + EIF ++QGEG H G  AVF RFSGCNL            C FCDT         G
Sbjct: 1   MKKVNEIFYSIQGEGYHTGTPAVFVRFSGCNLK-----------CPFCDTQH-----EDG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              + +++   +      G+      +LTGGEP L +D   +  L++ G  + +ETNGT 
Sbjct: 45  ILMSDEEILSEV------GKYPAVMVILTGGEPSLWIDREFVDRLHRIGKYVCIETNGTR 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P  IDW+  SPK G +  +    E+K+V+   ++S    +      + LQP       
Sbjct: 99  SLPNNIDWVTCSPKEGSNAIVVNPHEIKVVYTGQDLSTYEEMT--AAVYYLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           +NT   I Y  ++PKW+LS+QT K + +R
Sbjct: 153 QNTEEVIGYIKKHPKWKLSLQTQKILNVR 181


>gi|227329734|ref|ZP_03833758.1| hypothetical protein PcarcW_21303 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 223

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 65/240 (27%), Positives = 94/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I E+F TLQGEG   G  AVF R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAVFVRLQGCPV-----------GCSWCDTKHTWDKLAE 49

Query: 57  ------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +    G  + D +  L+ ++        R+ V+TGGEP +    PL 
Sbjct: 50  RETSLDQVLVKTEESDAWGAASADDILALMAQEG----YTARHIVITGGEPCIHDLAPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQ- 155
             L K+GF   +ET+GT +       W+ VSPK          D  ++   E+K    + 
Sbjct: 106 LQLEKQGFSCQIETSGTHDVRCSPKTWVTVSPKVNMRGGMKVLDQALQRADEIKHPVARE 165

Query: 156 -----VNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDALLARLDDDKPRIVALQPISQKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|26249173|ref|NP_755213.1| hypothetical protein c3335 [Escherichia coli CFT073]
 gi|91212137|ref|YP_542123.1| hypothetical protein UTI89_C3140 [Escherichia coli UTI89]
 gi|110642915|ref|YP_670645.1| hypothetical protein ECP_2755 [Escherichia coli 536]
 gi|117625003|ref|YP_853991.1| hypothetical protein APECO1_3756 [Escherichia coli APEC O1]
 gi|191171179|ref|ZP_03032729.1| conserved hypothetical protein [Escherichia coli F11]
 gi|215488094|ref|YP_002330525.1| hypothetical protein E2348C_3044 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218559762|ref|YP_002392675.1| hypothetical protein ECS88_3041 [Escherichia coli S88]
 gi|218690896|ref|YP_002399108.1| hypothetical protein ECED1_3225 [Escherichia coli ED1a]
 gi|218701268|ref|YP_002408897.1| hypothetical protein ECIAI39_2968 [Escherichia coli IAI39]
 gi|227888313|ref|ZP_04006118.1| radical SAM domain protein [Escherichia coli 83972]
 gi|237706601|ref|ZP_04537082.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|300976266|ref|ZP_07173363.1| radical SAM domain protein [Escherichia coli MS 200-1]
 gi|300976766|ref|ZP_07173583.1| radical SAM domain protein [Escherichia coli MS 45-1]
 gi|301027570|ref|ZP_07190901.1| radical SAM domain protein [Escherichia coli MS 69-1]
 gi|301049468|ref|ZP_07196426.1| radical SAM domain protein [Escherichia coli MS 185-1]
 gi|306812345|ref|ZP_07446543.1| hypothetical protein ECNC101_10539 [Escherichia coli NC101]
 gi|312964958|ref|ZP_07779198.1| uncharacterized protein ygcF [Escherichia coli 2362-75]
 gi|331658886|ref|ZP_08359828.1| putative Organic radical activating enzyme [Escherichia coli TA206]
 gi|26109580|gb|AAN81783.1|AE016765_185 Hypothetical protein ygcF [Escherichia coli CFT073]
 gi|50250397|emb|CAG25841.1| hypothetical protein ygcF [Escherichia coli]
 gi|91073711|gb|ABE08592.1| hypothetical protein YgcF [Escherichia coli UTI89]
 gi|110344507|gb|ABG70744.1| hypothetical protein YgcF [Escherichia coli 536]
 gi|115514127|gb|ABJ02202.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|190908479|gb|EDV68068.1| conserved hypothetical protein [Escherichia coli F11]
 gi|215266166|emb|CAS10592.1| predicted protein [Escherichia coli O127:H6 str. E2348/69]
 gi|218366531|emb|CAR04284.1| conserved hypothetical protein [Escherichia coli S88]
 gi|218371254|emb|CAR19087.1| conserved hypothetical protein [Escherichia coli IAI39]
 gi|218428460|emb|CAR09385.2| conserved hypothetical protein [Escherichia coli ED1a]
 gi|222034465|emb|CAP77207.1| Uncharacterized protein ygcF [Escherichia coli LF82]
 gi|226899641|gb|EEH85900.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|227834582|gb|EEJ45048.1| radical SAM domain protein [Escherichia coli 83972]
 gi|281179780|dbj|BAI56110.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|294493229|gb|ADE91985.1| conserved hypothetical protein [Escherichia coli IHE3034]
 gi|300298699|gb|EFJ55084.1| radical SAM domain protein [Escherichia coli MS 185-1]
 gi|300308611|gb|EFJ63131.1| radical SAM domain protein [Escherichia coli MS 200-1]
 gi|300394899|gb|EFJ78437.1| radical SAM domain protein [Escherichia coli MS 69-1]
 gi|300409952|gb|EFJ93490.1| radical SAM domain protein [Escherichia coli MS 45-1]
 gi|305854383|gb|EFM54821.1| hypothetical protein ECNC101_10539 [Escherichia coli NC101]
 gi|307554747|gb|ADN47522.1| conserved hypothetical protein [Escherichia coli ABU 83972]
 gi|307625657|gb|ADN69961.1| hypothetical protein UM146_02700 [Escherichia coli UM146]
 gi|312290514|gb|EFR18394.1| uncharacterized protein ygcF [Escherichia coli 2362-75]
 gi|312947301|gb|ADR28128.1| hypothetical protein NRG857_13575 [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315289297|gb|EFU48692.1| radical SAM domain protein [Escherichia coli MS 110-3]
 gi|315293738|gb|EFU53090.1| radical SAM domain protein [Escherichia coli MS 153-1]
 gi|315298732|gb|EFU57986.1| radical SAM domain protein [Escherichia coli MS 16-3]
 gi|320194912|gb|EFW69541.1| Queuosine Biosynthesis QueE Radical SAM [Escherichia coli
           WV_060327]
 gi|323188807|gb|EFZ74092.1| hypothetical protein ECRN5871_3230 [Escherichia coli RN587/1]
 gi|323951009|gb|EGB46885.1| queuosine biosynthesis protein QueE [Escherichia coli H252]
 gi|323957215|gb|EGB52939.1| queuosine biosynthesis protein QueE [Escherichia coli H263]
 gi|324005736|gb|EGB74955.1| radical SAM domain protein [Escherichia coli MS 57-2]
 gi|324015485|gb|EGB84704.1| radical SAM domain protein [Escherichia coli MS 60-1]
 gi|330908805|gb|EGH37319.1| queuosine Biosynthesis QueE Radical SAM [Escherichia coli AA86]
 gi|331053468|gb|EGI25497.1| putative Organic radical activating enzyme [Escherichia coli TA206]
          Length = 223

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 93/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWEKLED 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAASSEDLLAVIGRQG----YTARHVVITGGEPCIHDLLPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLTDDKPRVIALQPISQK--EDATRLCIDTCIAR-NWRLSMQTHKYLNI 222


>gi|268591373|ref|ZP_06125594.1| radical SAM domain protein [Providencia rettgeri DSM 1131]
 gi|291313351|gb|EFE53804.1| radical SAM domain protein [Providencia rettgeri DSM 1131]
          Length = 223

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 60/237 (25%), Positives = 86/237 (36%), Gaps = 41/237 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y I EIF T+QGEG   G  AVF R  GC +            C +CDT     +   
Sbjct: 1   MKYPINEIFQTIQGEGVFTGVPAVFIRLQGCPV-----------GCSWCDTKQTWEKEQD 49

Query: 62  GGR-------------YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                                  + + +         ++ V+TGGEP +    PL   L 
Sbjct: 50  KESTLGDIALKTIDSDAWAMADGEALVQLMKEKHFSAQHIVITGGEPCIYDLQPLTGILE 109

Query: 109 KRGFEIAVETNGTIE-PPQGIDWICVSPKAGCD-------LKIKGGQELKLVFPQVNVSP 160
           + G++  +ET+GT         W+ VSPK G           +    E+K    +     
Sbjct: 110 QHGYQCQIETSGTYPIQCTDNTWVTVSPKVGMKGGLQVISQAVNRANEIKHPVAREKDIE 169

Query: 161 ENYIGFDFER------FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
                            +LQP+        T L I  C Q   WRLS+QTHK++ I+
Sbjct: 170 ALEKILALRTVETPPVVALQPISQK--AAATKLCIETCIQR-NWRLSIQTHKYLDIQ 223


>gi|126090177|ref|YP_001041658.1| hypothetical protein Sbal_4540 [Shewanella baltica OS155]
 gi|126174470|ref|YP_001050619.1| radical activating enzyme [Shewanella baltica OS155]
 gi|125997675|gb|ABN61750.1| radical activating enzyme [Shewanella baltica OS155]
 gi|125999833|gb|ABN63903.1| hypothetical protein Sbal_4540 [Shewanella baltica OS155]
          Length = 222

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 65/237 (27%), Positives = 91/237 (38%), Gaps = 44/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y + E+F T+QGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MNYPVNEVFETIQGEGVFTGVPAIFVRLQGCPV-----------GCAWCDTKQTWDVLEV 49

Query: 57  ----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
                     + GT G     D  A  +   +       R+ V+TGGEP +     L + 
Sbjct: 50  NKVMPEQVISVDGTIGRW--ADHTAQSLIAAFHAKGFTARHIVITGGEPCMYDLCELTET 107

Query: 107 LNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKLVFPQVNV 158
           L+ +GF   +ET+GT +       W+ VSPK       K          E+K      N 
Sbjct: 108 LHSQGFATQIETSGTFDINCADDTWVTVSPKVNMKGGYKVLTQALNRANEIKHPIATENH 167

Query: 159 SPE-----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             E       I    +   LQP+        T LA+  C     WRLS+QTHK++ I
Sbjct: 168 IAELDELLQDIDISAKTICLQPISQK--PRATELAMKVCIAR-NWRLSIQTHKYLNI 221


>gi|74313345|ref|YP_311764.1| hypothetical protein SSON_2930 [Shigella sonnei Ss046]
 gi|73856822|gb|AAZ89529.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|323167196|gb|EFZ52913.1| radical SAM superfamily protein [Shigella sonnei 53G]
          Length = 223

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 92/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWEKLED 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAASSEDLLAVISRQG----YTARHVVITGGEPCIHDLLPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYDVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLTDDKPRVIALQPISQKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|253988156|ref|YP_003039512.1| hypothetical protein PAU_00675 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253779606|emb|CAQ82767.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 223

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 63/236 (26%), Positives = 98/236 (41%), Gaps = 41/236 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y I EIF TLQGEG   G  A+F R  GC +            C +CDT     +  +
Sbjct: 1   MFYPINEIFQTLQGEGFFTGVPAIFIRLQGCPV-----------GCSWCDTKHTWEKKAE 49

Query: 62  GGRY---------NVDQLADL----IEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
             +            D+  +     I   ++      R+ V+TGGEP +   +PL + L 
Sbjct: 50  KQQMLETILLKTNESDEWGEASPKQIATLFVQQGYTARHVVITGGEPCIYDLIPLTEELE 109

Query: 109 KRGFEIAVETNGTIEPPQG-IDWICVSPKA-------GCDLKIKGGQELKL-VFPQVNVS 159
             G++  +ET+GT         W+ VSPK             ++   E+K  V  + ++ 
Sbjct: 110 NLGYQCQIETSGTYHVECSAATWVTVSPKVKMRGGYQVLQQALQRANEIKHPVARERDIE 169

Query: 160 PENYIGFDFER-----FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             + +    +       +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 170 ALDELLATLDNNSSRIIALQPISQK--EDATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|160875275|ref|YP_001554591.1| radical activating enzyme [Shewanella baltica OS195]
 gi|160860797|gb|ABX49331.1| radical activating enzyme [Shewanella baltica OS195]
 gi|315267469|gb|ADT94322.1| Radical SAM domain protein [Shewanella baltica OS678]
          Length = 222

 Score =  195 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 65/237 (27%), Positives = 91/237 (38%), Gaps = 44/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y + E+F T+QGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MNYPVNEVFETIQGEGVFTGVPAIFVRLQGCPV-----------GCAWCDTKQTWDVLEV 49

Query: 57  ----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
                     + GT G     D  A  +   +       R+ V+TGGEP +     L + 
Sbjct: 50  NKVTPEQVITVDGTIGRW--ADHTAQSLIAAFHAKGFTARHIVITGGEPCMYDLRELTET 107

Query: 107 LNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKLVFPQVNV 158
           L+ +GF   +ET+GT +       W+ VSPK       K          E+K      N 
Sbjct: 108 LHSQGFATQIETSGTFDINCADDTWVTVSPKVNMKGGYKVLAQALNRANEIKHPIATENH 167

Query: 159 SPE-----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             E       I    +   LQP+        T LA+  C     WRLS+QTHK++ I
Sbjct: 168 IAELDELLQGIDISTKTICLQPISQK--PRATELAMKVCIAR-NWRLSIQTHKYLNI 221


>gi|117620682|ref|YP_856352.1| radical activating enzyme [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|117562089|gb|ABK39037.1| radical activating enzyme [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 237

 Score =  195 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 63/240 (26%), Positives = 95/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I EIF T+QGEG   G  A+F R  GC +            C +CDT    +    
Sbjct: 15  MHYPINEIFQTIQGEGVFTGLPAIFVRLQGCPV-----------GCPWCDTRHTWVVDPA 63

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +     + + +Q+    ++       + R+ V+TGGEP L     L 
Sbjct: 64  REVGVQAVLDCSNESDGWSKMSTEQILASFQQLG----YQARHVVITGGEPCLYDLQDLS 119

Query: 105 QALNKRGFEIAVETNGTIEPPQG-IDWICVSPKAGCD-------LKIKGGQELKLVFPQV 156
            AL + G+++ +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 120 AALIEAGYQVQIETSGTSEIQTHEQTWVTVSPKINMKGGLPVLVSALERANEIKHPVATE 179

Query: 157 NVSPENYIGFDFER------FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               E        R       +LQP+        T LA++ C     WRLS+QTHK++ I
Sbjct: 180 RHVEELDALLATARLRENVVIALQPISQK--PRATQLAMTTCIAR-NWRLSIQTHKYLDI 236


>gi|288933817|ref|YP_003437876.1| radical SAM protein [Klebsiella variicola At-22]
 gi|290511103|ref|ZP_06550472.1| queuosine biosynthesis protein QueE [Klebsiella sp. 1_1_55]
 gi|288888546|gb|ADC56864.1| Radical SAM domain protein [Klebsiella variicola At-22]
 gi|289776096|gb|EFD84095.1| queuosine biosynthesis protein QueE [Klebsiella sp. 1_1_55]
          Length = 223

 Score =  195 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 68/240 (28%), Positives = 94/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDKLAD 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q  T     R+ V+TGGEP +    PL 
Sbjct: 50  REVSLFSILAKTKESDKWGPASSEDLLAIIGRQGWT----ARHVVITGGEPCIHDLTPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L + GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 SLLEQNGFSCQIETSGTHEVRCSHNTWVTVSPKVNMRGGYDVLSQALQRADEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++   E          +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLETLSDDKPRIIALQPISQK--EDATRLCIDTCIAR-NWRLSMQTHKYLNI 222


>gi|227114089|ref|ZP_03827745.1| hypothetical protein PcarbP_14034 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 223

 Score =  195 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 95/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I E+F TLQGEG   G  AVF R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAVFVRLQGCPV-----------GCSWCDTKHTWDKLAE 49

Query: 57  ------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +    G  + D +  L+ +Q        R+ V+TGGEP +    PL 
Sbjct: 50  RETSLDQVLVKTEESDAWGAASADDILALMVQQG----YTARHIVITGGEPCIHDLAPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQ- 155
             L K+GF   +ET+GT +       W+ VSPK          D  ++   E+K    + 
Sbjct: 106 LQLEKQGFSCQIETSGTHDVRCSPKTWVTVSPKVNMRGGMKVLDQALQRADEIKHPVARE 165

Query: 156 -----VNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+      + T L I+ C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDALLARLDDDKPRIVALQPISQKD--DATKLCIATCIAR-NWRLSMQTHKYLNI 222


>gi|56460021|ref|YP_155302.1| organic radical activating protein [Idiomarina loihiensis L2TR]
 gi|56179031|gb|AAV81753.1| Organic radical activating enzyme [Idiomarina loihiensis L2TR]
          Length = 233

 Score =  195 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 62/237 (26%), Positives = 91/237 (38%), Gaps = 43/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I EIF TLQGEG   G  ++F R  GC +            C +CDT         
Sbjct: 11  MSYRINEIFETLQGEGTFTGVPSIFLRLQGCPV-----------GCPWCDTQHTWETNPT 59

Query: 58  ----------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
                     +     +++     D+I      G    ++ V+TGGEP +   +PL +AL
Sbjct: 60  DQVSIDALMAKTEASAKWSEMTAEDIIARFEQEG-YSAKHVVITGGEPAMFDLLPLGKAL 118

Query: 108 NKRGFEIAVETNGTIE-PPQGIDWICVSPK-------AGCDLKIKGGQELKLVFPQVNVS 159
             +G+++ +ET+GT E       W+ VSPK             +    E+K         
Sbjct: 119 EAKGYQLQIETSGTFELKVTDSTWVTVSPKLDMPGGYLVRPDCMARANEIKHPIAMQKHI 178

Query: 160 PENYIGFDFER------FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                  +           LQP+        T LA+  C     WRLSVQ HK++ I
Sbjct: 179 DALDSLLERCPPKADAIICLQPISQ--RPRATELAMKTCIAR-NWRLSVQMHKYLNI 232


>gi|193071786|ref|ZP_03052680.1| conserved hypothetical protein [Escherichia coli E110019]
 gi|300906700|ref|ZP_07124387.1| radical SAM domain protein [Escherichia coli MS 84-1]
 gi|300920372|ref|ZP_07136808.1| radical SAM domain protein [Escherichia coli MS 115-1]
 gi|301304544|ref|ZP_07210654.1| radical SAM domain protein [Escherichia coli MS 124-1]
 gi|192954902|gb|EDV85411.1| conserved hypothetical protein [Escherichia coli E110019]
 gi|300401505|gb|EFJ85043.1| radical SAM domain protein [Escherichia coli MS 84-1]
 gi|300412622|gb|EFJ95932.1| radical SAM domain protein [Escherichia coli MS 115-1]
 gi|300840148|gb|EFK67908.1| radical SAM domain protein [Escherichia coli MS 124-1]
 gi|315256635|gb|EFU36603.1| radical SAM domain protein [Escherichia coli MS 85-1]
 gi|323172921|gb|EFZ58552.1| hypothetical protein ECLT68_2322 [Escherichia coli LT-68]
          Length = 223

 Score =  195 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 92/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWEKLED 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAASSEDLLAVISRQG----YTARHVVITGGEPCIHDLLPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLTDDKPRVIALQPISQKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|296104445|ref|YP_003614591.1| radical SAM domain-containing protein [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058904|gb|ADF63642.1| radical SAM domain-containing protein [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 223

 Score =  195 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 94/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDKLAD 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q  T     R+ V+TGGEP +    PL 
Sbjct: 50  REVSLFSVLAKTKESDKWGAGSAEDLLAIIGRQGWT----ARHVVITGGEPCIHDLTPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
           + L K G+   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 ELLEKNGYSCQIETSGTHEVRCSHTTWVTVSPKVNMRGGYDVLSQALERADEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLTDEKQRVIALQPISQK--EDATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|293392806|ref|ZP_06637124.1| anaerobic ribonucleoside-triphosphate reductase small subunit
           [Serratia odorifera DSM 4582]
 gi|291424665|gb|EFE97876.1| anaerobic ribonucleoside-triphosphate reductase small subunit
           [Serratia odorifera DSM 4582]
          Length = 223

 Score =  195 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 63/240 (26%), Positives = 93/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCSWCDTKHTWEKEAN 49

Query: 57  ------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +    G    +QL ++++ Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVDMQRILVKTEESDAWGSATAEQLLEVVQRQG----YTARHIVITGGEPCIYDLIPLT 105

Query: 105 QALNKRGFEIAVETNGTIEPPQGI-DWICVSPKAGC-------DLKIKGGQELKLV---- 152
           +     G+   +ET+GT E       W+ VSPK          +  +    E+K      
Sbjct: 106 KLFELNGYACQIETSGTHEILCTPSTWVTVSPKVNMRGGMKVLEQALMRADEIKHPVGRQ 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++   +          +LQP+      E T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDALLDTLNDEKRRIIALQPISQKD--EATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|238896239|ref|YP_002920975.1| putative coenzyme PQQ synthesis protein [Klebsiella pneumoniae
           NTUH-K2044]
 gi|238548557|dbj|BAH64908.1| putative coenzyme PQQ synthesis protein [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
          Length = 223

 Score =  195 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 68/240 (28%), Positives = 94/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDKLAD 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q  T     R+ V+TGGEP +    PL 
Sbjct: 50  REVSLFSILAKTKESDKWGPASSEDLLAIIGRQGWT----ARHVVITGGEPCIHDLTPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L + GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 SLLEQNGFSCQIETSGTHEVRCSPNTWVTVSPKVNMRGGYDVLSQALQRADEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++   E          +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLETLSDDKPRIIALQPISQK--EDATRLCIDTCIAR-NWRLSMQTHKYLNI 222


>gi|62181454|ref|YP_217871.1| hypothetical protein SC2884 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|62129087|gb|AAX66790.1| putative Organic radical activating enzymes [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|322715938|gb|EFZ07509.1| Radical SAM [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 223

 Score =  195 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 92/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDKLSD 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAASSEDLLAVINRQG----YTARHVVITGGEPCIHDLMPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKSGFSCQIETSGTHEVRCTPNTWVTVSPKVNMRGGYDVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                +               +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALGELLATLSDDKPRVIALQPISQK--EDATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|238758186|ref|ZP_04619365.1| hypothetical protein yaldo0001_25950 [Yersinia aldovae ATCC 35236]
 gi|238703516|gb|EEP96054.1| hypothetical protein yaldo0001_25950 [Yersinia aldovae ATCC 35236]
          Length = 225

 Score =  195 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 68/242 (28%), Positives = 94/242 (38%), Gaps = 50/242 (20%)

Query: 1   MKL-YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI-- 57
           M++ Y I E+F TLQGEG   G  A+F R  GC +            C +CDT       
Sbjct: 1   MQMQYPINEMFQTLQGEGYFTGVPAIFVRLQGCPV-----------GCSWCDTKHTWEKE 49

Query: 58  ---------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP 102
                          +    G  +  QL DL  +Q        R+ V+TGGEP +    P
Sbjct: 50  ADREVDMQRIMVKTAESDAWGSASEQQLLDLFIQQG----YTARHVVITGGEPAIYDLFP 105

Query: 103 LIQALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV-- 152
           L   L + G+   +ET+GT E       W+ VSPK             ++   E+K    
Sbjct: 106 LTSQLEQAGYRCQIETSGTHEVRCSATTWVTVSPKVNMRGGLKVLPQALERADEIKHPVG 165

Query: 153 ----FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                  +    E          +LQP+      E T L I  C     WRLS+QTHK++
Sbjct: 166 RLRDIEALEALLETLTDDKKRIIALQPISQKD--EATKLCIETCIAR-NWRLSMQTHKYL 222

Query: 209 GI 210
            I
Sbjct: 223 NI 224


>gi|330830002|ref|YP_004392954.1| Radical activating enzyme [Aeromonas veronii B565]
 gi|328805138|gb|AEB50337.1| Radical activating enzyme [Aeromonas veronii B565]
          Length = 230

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 65/237 (27%), Positives = 95/237 (40%), Gaps = 43/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I EIF T+QGEG   G  A+F R  GC +            C +CDT    +    
Sbjct: 8   MHYPINEIFQTIQGEGIFTGLPAIFVRLQGCPV-----------GCPWCDTRHTWVVDPA 56

Query: 58  ----------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
                     +  +   ++    A +I+     G  + R+ V+TGGEP L     L  AL
Sbjct: 57  REVGKAAVLDRSNESDCWSQLSTAQIIKSFGELG-YQARHVVITGGEPCLYDLHELSSAL 115

Query: 108 NKRGFEIAVETNGTIEPPQG-IDWICVSPKAGCD-------LKIKGGQELKLVFPQVNVS 159
              G+++ +ET+GT E       W+ VSPK G           ++   E+K      +  
Sbjct: 116 LAAGYQVQIETSGTSEIKTHEQTWVTVSPKIGMKGGLPVLVSALERANEIKHPVATEHHI 175

Query: 160 PENYIGFDFER------FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E                +LQP+        T LA+  C     WRLS+QTHK++ I
Sbjct: 176 EELDTLLATATLRPDVVIALQPISQK--PRATQLAMDTCIAR-NWRLSIQTHKYLDI 229


>gi|218709344|ref|YP_002416965.1| organic radical activating enzyme [Vibrio splendidus LGP32]
 gi|218322363|emb|CAV18509.1| Organic radical activating enzyme [Vibrio splendidus LGP32]
          Length = 222

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 64/236 (27%), Positives = 94/236 (39%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------ 56
           +Y I E+F T+QGEG   G  AVF R   C +            C +CDT          
Sbjct: 1   MYKINEMFETIQGEGVFTGVPAVFVRLQICPV-----------GCSWCDTKQTWEALPED 49

Query: 57  --------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                   ++      +       ++ E    G    ++ V+TGGEP +   VPL +A  
Sbjct: 50  ETSLGDIMVKTEDSPTWTAIDAQGIVNEYIKQG-YTAKHIVITGGEPCIYDLVPLTEAFE 108

Query: 109 KRGFEIAVETNGTIEPPQGID-WICVSPKAGCDLKIK-------GGQELKLV------FP 154
           + G    +ET+GT E     D W+ VSPK     K+           E+K          
Sbjct: 109 QHGCRCQIETSGTSEVKATPDTWVTVSPKVSMKAKLDILDSALVRANEIKHPVGTGKDIE 168

Query: 155 QVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           Q++         +    +LQP+     E  T L I  C +   WRLS+QTHK++ I
Sbjct: 169 QLDALIARADVPENTVIALQPISQK--ERATQLCIDTCIER-NWRLSIQTHKYLSI 221


>gi|293412124|ref|ZP_06654847.1| conserved hypothetical protein [Escherichia coli B354]
 gi|291468895|gb|EFF11386.1| conserved hypothetical protein [Escherichia coli B354]
          Length = 223

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 92/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWEKLED 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAASSEDLLAVIGRQG----YTARHVVITGGEPCIHDLLPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYKVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLTDDKPRVIALQPISQKD--DATRLCIDTCIAR-NWRLSMQTHKYLNI 222


>gi|170018977|ref|YP_001723931.1| hypothetical protein EcolC_0935 [Escherichia coli ATCC 8739]
 gi|312973008|ref|ZP_07787181.1| uncharacterized protein ygcF [Escherichia coli 1827-70]
 gi|169753905|gb|ACA76604.1| conserved hypothetical protein [Escherichia coli ATCC 8739]
 gi|310332950|gb|EFQ00164.1| uncharacterized protein ygcF [Escherichia coli 1827-70]
 gi|323941542|gb|EGB37724.1| queuosine biosynthesis protein QueE [Escherichia coli E482]
          Length = 223

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 92/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWEKLED 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAASSEDLLAIIGRQG----YTARHVVITGGEPCIHDLLPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLTDDKPRVIALQPISQKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|206580457|ref|YP_002236871.1| radical SAM domain protein [Klebsiella pneumoniae 342]
 gi|206569515|gb|ACI11291.1| radical SAM domain protein [Klebsiella pneumoniae 342]
          Length = 223

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 68/240 (28%), Positives = 94/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDKLAD 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q  T     R+ V+TGGEP +    PL 
Sbjct: 50  REVSLFSILAKTKESDKWGPASSEDLLAIIGRQGWT----ARHVVITGGEPCIHDLTPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L + GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 SLLEQNGFSCQIETSGTHEVCCSHNTWVTVSPKVNMRGGYDVLSQALQRADEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++   E          +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLETLSDDKPRIIALQPISQK--EDATRLCIDTCIAR-NWRLSMQTHKYLNI 222


>gi|218555326|ref|YP_002388239.1| hypothetical protein ECIAI1_2883 [Escherichia coli IAI1]
 gi|300820561|ref|ZP_07100712.1| radical SAM domain protein [Escherichia coli MS 119-7]
 gi|309795241|ref|ZP_07689660.1| radical SAM domain protein [Escherichia coli MS 145-7]
 gi|331669510|ref|ZP_08370356.1| putative Organic radical activating enzyme [Escherichia coli TA271]
 gi|331678753|ref|ZP_08379427.1| putative Organic radical activating enzyme [Escherichia coli H591]
 gi|218362094|emb|CAQ99703.1| conserved hypothetical protein [Escherichia coli IAI1]
 gi|300526825|gb|EFK47894.1| radical SAM domain protein [Escherichia coli MS 119-7]
 gi|308121212|gb|EFO58474.1| radical SAM domain protein [Escherichia coli MS 145-7]
 gi|320202418|gb|EFW76988.1| Queuosine Biosynthesis QueE Radical SAM [Escherichia coli EC4100B]
 gi|331063178|gb|EGI35091.1| putative Organic radical activating enzyme [Escherichia coli TA271]
 gi|331073583|gb|EGI44904.1| putative Organic radical activating enzyme [Escherichia coli H591]
          Length = 223

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 92/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWEKLED 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGSASSEDLLAVIGRQG----YTARHVVITGGEPCIHDLLPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYDVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLTDDKPRVIALQPISQKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|331664336|ref|ZP_08365242.1| putative Organic radical activating enzyme [Escherichia coli TA143]
 gi|284922713|emb|CBG35801.1| conserved hypothetical protein [Escherichia coli 042]
 gi|331058267|gb|EGI30248.1| putative Organic radical activating enzyme [Escherichia coli TA143]
          Length = 223

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 92/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWEKLED 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAASSEDLLAVIGRQG----YTARHVVITGGEPCIHDLLPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLTDDKPRVIALQPISQKD--DATRLCIDTCIAR-NWRLSMQTHKYLNI 222


>gi|253689736|ref|YP_003018926.1| hypothetical protein PC1_3374 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251756314|gb|ACT14390.1| conserved hypothetical protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 223

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 95/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I E+F TLQGEG   G  AVF R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAVFVRLQGCPV-----------GCSWCDTKHTWDKLAE 49

Query: 57  ------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +    G  + D +  L+ +Q        R+ V+TGGEP +    PL 
Sbjct: 50  RETSLDQVLVKTEESDAWGAASADDILALMTQQG----YTARHIVITGGEPCIHDLTPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQ- 155
             L K+GF   +ET+GT +       W+ VSPK          D  ++   E+K    + 
Sbjct: 106 LQLEKQGFSCQIETSGTHDVRCSPKTWVTVSPKVNMRGGMKVLDQALQRADEIKHPVARE 165

Query: 156 -----VNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+      + T L I+ C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDALLARLDDDKPRIVALQPISQKD--DATKLCIATCIAR-NWRLSMQTHKYLNI 222


>gi|50122475|ref|YP_051642.1| hypothetical protein ECA3554 [Pectobacterium atrosepticum SCRI1043]
 gi|49613001|emb|CAG76452.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 223

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 95/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I E+F TLQGEG   G  AVF R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAVFVRLQGCPV-----------GCSWCDTKHTWDKLAE 49

Query: 57  ------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +    G  + D +  L+ +Q        R+ V+TGGEP +    PL 
Sbjct: 50  RETSLDQVLVKTEESDAWGAASADDILALMAQQG----YTARHIVITGGEPCIHDLAPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQ- 155
             L K+GF   +ET+GT +       W+ VSPK          D  ++   E+K    + 
Sbjct: 106 LQLEKQGFSCQIETSGTHDVRCSPKTWVTVSPKVNMRGGMKVLDQALQRADEIKHPVARE 165

Query: 156 -----VNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+      + T L I+ C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDTLLARLDDDKPRIVALQPISQKD--DATKLCIATCIAR-NWRLSMQTHKYLNI 222


>gi|110806555|ref|YP_690075.1| hypothetical protein SFV_2678 [Shigella flexneri 5 str. 8401]
 gi|110616103|gb|ABF04770.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
          Length = 223

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 92/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHAWEKLED 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAASSEDLLAVIGRQG----YTARHVVITGGEPCIHDLLPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLTDDKPRVIALQPISQKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|82545074|ref|YP_409021.1| hypothetical protein SBO_2656 [Shigella boydii Sb227]
 gi|187733920|ref|YP_001881485.1| hypothetical protein SbBS512_E3099 [Shigella boydii CDC 3083-94]
 gi|193065022|ref|ZP_03046097.1| conserved hypothetical protein [Escherichia coli E22]
 gi|209920225|ref|YP_002294309.1| hypothetical protein ECSE_3034 [Escherichia coli SE11]
 gi|256019438|ref|ZP_05433303.1| hypothetical protein ShiD9_11027 [Shigella sp. D9]
 gi|260845423|ref|YP_003223201.1| hypothetical protein ECO103_3320 [Escherichia coli O103:H2 str.
           12009]
 gi|260856887|ref|YP_003230778.1| hypothetical protein ECO26_3847 [Escherichia coli O26:H11 str.
           11368]
 gi|260869456|ref|YP_003235858.1| hypothetical protein ECO111_3501 [Escherichia coli O111:H- str.
           11128]
 gi|300815807|ref|ZP_07096031.1| radical SAM domain protein [Escherichia coli MS 107-1]
 gi|300923910|ref|ZP_07139923.1| radical SAM domain protein [Escherichia coli MS 182-1]
 gi|301325508|ref|ZP_07218983.1| radical SAM domain protein [Escherichia coli MS 78-1]
 gi|81246485|gb|ABB67193.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|187430912|gb|ACD10186.1| conserved hypothetical protein [Shigella boydii CDC 3083-94]
 gi|192927319|gb|EDV81938.1| conserved hypothetical protein [Escherichia coli E22]
 gi|209913484|dbj|BAG78558.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|257755536|dbj|BAI27038.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
 gi|257760570|dbj|BAI32067.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009]
 gi|257765812|dbj|BAI37307.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
 gi|300419842|gb|EFK03153.1| radical SAM domain protein [Escherichia coli MS 182-1]
 gi|300531736|gb|EFK52798.1| radical SAM domain protein [Escherichia coli MS 107-1]
 gi|300847675|gb|EFK75435.1| radical SAM domain protein [Escherichia coli MS 78-1]
 gi|320183542|gb|EFW58388.1| Queuosine Biosynthesis QueE Radical SAM [Shigella flexneri CDC
           796-83]
 gi|323155006|gb|EFZ41198.1| radical SAM superfamily protein [Escherichia coli EPECa14]
 gi|323159909|gb|EFZ45879.1| radical SAM superfamily protein [Escherichia coli E128010]
 gi|323180206|gb|EFZ65758.1| radical SAM superfamily protein [Escherichia coli 1180]
 gi|324016296|gb|EGB85515.1| radical SAM domain protein [Escherichia coli MS 117-3]
 gi|332092167|gb|EGI97245.1| radical SAM superfamily protein [Shigella boydii 3594-74]
 gi|332102910|gb|EGJ06256.1| conserved hypothetical protein [Shigella sp. D9]
          Length = 223

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 92/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWEKLED 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAASSEDLLAVIGRQG----YTARHVVITGGEPCIHDLLPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYDVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLTDDKPRVIALQPISQKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|27366011|ref|NP_761539.1| Queuosine Biosynthesis QueE Radical SAM [Vibrio vulnificus CMCP6]
 gi|37679724|ref|NP_934333.1| organic radical activating enzyme [Vibrio vulnificus YJ016]
 gi|320156525|ref|YP_004188904.1| queuosine Biosynthesis QueE Radical SAM [Vibrio vulnificus
           MO6-24/O]
 gi|27362211|gb|AAO11066.1| Queuosine Biosynthesis QueE Radical SAM [Vibrio vulnificus CMCP6]
 gi|37198469|dbj|BAC94304.1| organic radical activating enzyme [Vibrio vulnificus YJ016]
 gi|319931837|gb|ADV86701.1| queuosine Biosynthesis QueE Radical SAM [Vibrio vulnificus
           MO6-24/O]
          Length = 224

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 67/237 (28%), Positives = 97/237 (40%), Gaps = 41/237 (17%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M LY + E+F T+QGEG   G  AVF R   C +            C +CDT        
Sbjct: 1   MTLYKVNEMFETIQGEGVFTGVPAVFVRLQICPV-----------GCSWCDTKQTWEAAE 49

Query: 61  KGGRYNVDQL-------------ADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
           +  +   + +             A  I EQ+       ++ V+TGGEP L     L QA 
Sbjct: 50  QDEQSFAEIIVKTGDSPTWCQADAAAIVEQYQRQGYSAKHIVITGGEPCLYDLTELTQAF 109

Query: 108 NKRGFEIAVETNGTIEPPQ-GIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNV 158
              G +  +ET+GT E       W+ VSPK     K+           E+K  V  Q ++
Sbjct: 110 EAIGCQCQIETSGTYEVKASENTWVTVSPKVAMKGKLPILDSALQRANEIKHPVGTQKDI 169

Query: 159 SPENYIGFDFE-----RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              + +    +       +LQP+     E  T L I  C +   WRLS+QTHK++ I
Sbjct: 170 DQLDALLLRAQVPATTVIALQPISQK--ERATQLCIDTCIKR-NWRLSIQTHKYLSI 223


>gi|15803295|ref|NP_289328.1| hypothetical protein Z4089 [Escherichia coli O157:H7 EDL933]
 gi|25497213|pir||C85928 hypothetical protein ygcF [imported] - Escherichia coli  (strain
           O157:H7, substrain EDL933)
 gi|12517243|gb|AAG57887.1|AE005505_5 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
          Length = 223

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 62/237 (26%), Positives = 90/237 (37%), Gaps = 43/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWEKLED 49

Query: 58  ----------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
                     +  +  ++      BL+           R+ V+TGGEP +   +PL   L
Sbjct: 50  REVSLFSILAKTKESDKWGAASSEBLL-AVIGRQGYTARHVVITGGEPCIHDLLPLTDLL 108

Query: 108 NKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV------F 153
            K GF   +ET+GT E       W+ VSPK             ++   E+K         
Sbjct: 109 EKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVGRVRDI 168

Query: 154 PQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             ++              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 169 EALDELLATLTDDKPRVIALQPISQKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|295097341|emb|CBK86431.1| Organic radical activating enzymes [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 223

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 94/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDKLAD 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q  T     R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAGSAEDLLAIISRQGWT----ARHVVITGGEPCIHDLMPLT 105

Query: 105 QALNKRGFEIAVETNGTIEPPQGI-DWICVSPKAGC-------DLKIKGGQELKLV---- 152
           + L K G+   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 ELLEKNGYSCQIETSGTHEVRCSHSTWVTVSPKVNMRGGYDVLSQALERADEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLTDEKQRVIALQPISQKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|161501996|ref|YP_001569108.1| hypothetical protein SARI_00012 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160863343|gb|ABX19966.1| hypothetical protein SARI_00012 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 223

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 94/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDKLSD 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q    +   R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLYSILAKTKESDKWGAASSEDLLTVINRQ----DYTARHVVITGGEPCIHDLMPLT 105

Query: 105 QALNKRGFEIAVETNGTIEP-PQGIDWICVSPKAGCD-------LKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKSGFSSQIETSGTHEVLCTPNTWVTVSPKVNMRGGYDVLTQALERANEIKHPVGRI 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLSDDKPRVIALQPISQK--EDATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|157962169|ref|YP_001502203.1| radical SAM domain-containing protein [Shewanella pealeana ATCC
           700345]
 gi|157847169|gb|ABV87668.1| Radical SAM domain protein [Shewanella pealeana ATCC 700345]
          Length = 222

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 65/237 (27%), Positives = 98/237 (41%), Gaps = 44/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y + E+F T+QGEG H G  A+F R  GC +            C +CDT         
Sbjct: 1   MKYPVNEVFETIQGEGTHTGVPAIFVRLQGCPV-----------GCSWCDTKQTWELLED 49

Query: 57  ----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
                     + GT G R++   +  L+   +       +  V+TGGEP L     L Q 
Sbjct: 50  NRVAPDLVIQVDGTVG-RWSELTVEQLV-SAFEDKGFTAKLVVITGGEPCLYDLSELTQY 107

Query: 107 LNKRGFEIAVETNGTIEPPQGID-WICVSPKAGCD-------LKIKGGQELKLVFPQVNV 158
           L+ +G++  +ET+GT +     D W+ VSPK             +    E+K        
Sbjct: 108 LHAQGYQTQIETSGTFDVLCHPDTWVTVSPKVNMKGGYAVLAQALNRANEIKHPVATQKH 167

Query: 159 SPENYIGFDF-----ERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             E  +  +      +   LQP+    +   T LA+  C +   WRLSVQTHK++ I
Sbjct: 168 IDELDLLLEDINLTGKTVCLQPISQ--IPRATELAMKTCIER-NWRLSVQTHKYLNI 221


>gi|332036527|gb|EGI72995.1| queuosine biosynthesis QueE radical SAM [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 221

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 61/234 (26%), Positives = 93/234 (39%), Gaps = 40/234 (17%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------ 56
           +Y I E+F T+QGE    G  ++F R  GC +            C +CDT          
Sbjct: 1   MYKINEVFETIQGEASFTGTPSIFLRLQGCPV-----------GCSWCDTKQTWDVDNVY 49

Query: 57  -------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNK 109
                  ++      +  +  A+ I   + +     ++ V+TGGEP +    P+   L++
Sbjct: 50  KVSLDETVEKKADSDHWANASAEQILALFQSRGYTAKHVVITGGEPCMFDLNPVCNLLHE 109

Query: 110 RGFEIAVETNGTIEP-PQGIDWICVSPKAGCD-------LKIKGGQELKLVFPQVNVSPE 161
            GF   +ET+GT E       W+ VSPK             +K   E+K          E
Sbjct: 110 HGFSTQIETSGTFEILAPEQTWVTVSPKINMRGGYEVLTSTMKRANEIKHPVAMQKHVEE 169

Query: 162 NYIGF-----DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               F     + +   LQP+        T LAI  C     WRLS+Q HK++GI
Sbjct: 170 LEELFAKTGVNPKLVYLQPISQKVS--ATKLAIDTCIAK-NWRLSIQVHKYLGI 220


>gi|331648502|ref|ZP_08349590.1| putative Organic radical activating enzyme [Escherichia coli M605]
 gi|331042249|gb|EGI14391.1| putative Organic radical activating enzyme [Escherichia coli M605]
          Length = 223

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 65/237 (27%), Positives = 92/237 (38%), Gaps = 43/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWEKLED 49

Query: 58  ----------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
                     +  +  ++      DL+      G    R+ V+TGGEP +   +PL   L
Sbjct: 50  REVSLFSILAKTKESDKWGAASSEDLLVVIGRQG-YTARHVVITGGEPCIHDLLPLTDLL 108

Query: 108 NKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV------F 153
            K GF   +ET+GT E       W+ VSPK             ++   E+K         
Sbjct: 109 EKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVGRVRDI 168

Query: 154 PQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             ++              +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 169 EALDELLATLTDDKPRVIALQPISQK--EDATRLCIDTCIAR-NWRLSMQTHKYLNI 222


>gi|15832887|ref|NP_311660.1| hypothetical protein ECs3633 [Escherichia coli O157:H7 str. Sakai]
 gi|16130684|ref|NP_417257.1| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|24114061|ref|NP_708571.1| hypothetical protein SF2790 [Shigella flexneri 2a str. 301]
 gi|30064123|ref|NP_838294.1| hypothetical protein S2984 [Shigella flexneri 2a str. 2457T]
 gi|82778146|ref|YP_404495.1| hypothetical protein SDY_2981 [Shigella dysenteriae Sd197]
 gi|89109563|ref|AP_003343.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|157155007|ref|YP_001464098.1| hypothetical protein EcE24377A_3080 [Escherichia coli E24377A]
 gi|157162228|ref|YP_001459546.1| hypothetical protein EcHS_A2918 [Escherichia coli HS]
 gi|168749899|ref|ZP_02774921.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|168758464|ref|ZP_02783471.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|168762823|ref|ZP_02787830.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|168768869|ref|ZP_02793876.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|168778760|ref|ZP_02803767.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|168788031|ref|ZP_02813038.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
 gi|168802847|ref|ZP_02827854.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|170082350|ref|YP_001731670.1| hypothetical protein ECDH10B_2944 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170682101|ref|YP_001744934.1| hypothetical protein EcSMS35_2910 [Escherichia coli SMS-3-5]
 gi|170766131|ref|ZP_02900942.1| conserved hypothetical protein [Escherichia albertii TW07627]
 gi|188495163|ref|ZP_03002433.1| conserved hypothetical protein [Escherichia coli 53638]
 gi|194434862|ref|ZP_03067109.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gi|194438962|ref|ZP_03071046.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|195939488|ref|ZP_03084870.1| hypothetical protein EscherichcoliO157_24278 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208805739|ref|ZP_03248076.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4206]
 gi|208813020|ref|ZP_03254349.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4045]
 gi|208819186|ref|ZP_03259506.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4042]
 gi|209398503|ref|YP_002272239.1| hypothetical protein ECH74115_4033 [Escherichia coli O157:H7 str.
           EC4115]
 gi|217327761|ref|ZP_03443844.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           TW14588]
 gi|218547712|ref|YP_002381503.1| hypothetical protein EFER_0293 [Escherichia fergusonii ATCC 35469]
 gi|218696375|ref|YP_002404042.1| hypothetical protein EC55989_3051 [Escherichia coli 55989]
 gi|218706272|ref|YP_002413791.1| hypothetical protein ECUMN_3104 [Escherichia coli UMN026]
 gi|238901913|ref|YP_002927709.1| hypothetical protein BWG_2512 [Escherichia coli BW2952]
 gi|253772373|ref|YP_003035204.1| hypothetical protein ECBD_0953 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254037826|ref|ZP_04871884.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
 gi|254162703|ref|YP_003045811.1| hypothetical protein ECB_02622 [Escherichia coli B str. REL606]
 gi|254794716|ref|YP_003079553.1| hypothetical protein ECSP_3726 [Escherichia coli O157:H7 str.
           TW14359]
 gi|256024721|ref|ZP_05438586.1| hypothetical protein E4_15200 [Escherichia sp. 4_1_40B]
 gi|261226072|ref|ZP_05940353.1| hypothetical protein EscherichiacoliO157_15958 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261256672|ref|ZP_05949205.1| hypothetical protein EscherichiacoliO157EcO_12655 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291284103|ref|YP_003500921.1| hypothetical protein G2583_3426 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293406268|ref|ZP_06650194.1| aconitate hydratase [Escherichia coli FVEC1412]
 gi|293416022|ref|ZP_06658662.1| ygcF protein [Escherichia coli B185]
 gi|293449103|ref|ZP_06663524.1| ygcF protein [Escherichia coli B088]
 gi|298382006|ref|ZP_06991603.1| ygcF protein [Escherichia coli FVEC1302]
 gi|300899636|ref|ZP_07117868.1| radical SAM domain protein [Escherichia coli MS 198-1]
 gi|300931233|ref|ZP_07146574.1| radical SAM domain protein [Escherichia coli MS 187-1]
 gi|300950504|ref|ZP_07164414.1| radical SAM domain protein [Escherichia coli MS 116-1]
 gi|300958089|ref|ZP_07170250.1| radical SAM domain protein [Escherichia coli MS 175-1]
 gi|301020692|ref|ZP_07184762.1| radical SAM domain protein [Escherichia coli MS 196-1]
 gi|301645261|ref|ZP_07245212.1| radical SAM domain protein [Escherichia coli MS 146-1]
 gi|307139461|ref|ZP_07498817.1| hypothetical protein EcolH7_15212 [Escherichia coli H736]
 gi|307312795|ref|ZP_07592425.1| Radical SAM domain protein [Escherichia coli W]
 gi|309786123|ref|ZP_07680751.1| uncharacterized protein ygcF [Shigella dysenteriae 1617]
 gi|331643461|ref|ZP_08344592.1| putative Organic radical activating enzyme [Escherichia coli H736]
 gi|331654257|ref|ZP_08355257.1| putative Organic radical activating enzyme [Escherichia coli M718]
 gi|331684398|ref|ZP_08384990.1| putative Organic radical activating enzyme [Escherichia coli H299]
 gi|54040228|sp|P64555|YGCF_ECO57 RecName: Full=7-carboxy-7-deazaguanine synthase homolog
 gi|54040229|sp|P64556|YGCF_SHIFL RecName: Full=7-carboxy-7-deazaguanine synthase homolog
 gi|54042396|sp|P64554|YGCF_ECOLI RecName: Full=7-carboxy-7-deazaguanine synthase homolog
 gi|882671|gb|AAA69287.1| ORF_f223 [Escherichia coli str. K-12 substr. MG1655]
 gi|1789139|gb|AAC75819.1| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|13363104|dbj|BAB37056.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|24053188|gb|AAN44278.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30042379|gb|AAP18104.1| hypothetical protein S2984 [Shigella flexneri 2a str. 2457T]
 gi|81242294|gb|ABB63004.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|85675596|dbj|BAE76851.1| conserved hypothetical protein [Escherichia coli str. K12 substr.
           W3110]
 gi|157067908|gb|ABV07163.1| conserved hypothetical protein [Escherichia coli HS]
 gi|157077037|gb|ABV16745.1| conserved hypothetical protein [Escherichia coli E24377A]
 gi|169890185|gb|ACB03892.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
 gi|170125277|gb|EDS94208.1| conserved hypothetical protein [Escherichia albertii TW07627]
 gi|170519819|gb|ACB17997.1| conserved hypothetical protein [Escherichia coli SMS-3-5]
 gi|188015830|gb|EDU53952.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|188490362|gb|EDU65465.1| conserved hypothetical protein [Escherichia coli 53638]
 gi|189003552|gb|EDU72538.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|189354704|gb|EDU73123.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|189362097|gb|EDU80516.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|189366881|gb|EDU85297.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|189372100|gb|EDU90516.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
 gi|189375278|gb|EDU93694.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|194416881|gb|EDX33003.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gi|194422083|gb|EDX38086.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|208725540|gb|EDZ75141.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4206]
 gi|208734297|gb|EDZ82984.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4045]
 gi|208739309|gb|EDZ86991.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4042]
 gi|209159903|gb|ACI37336.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4115]
 gi|209761508|gb|ACI79066.1| hypothetical protein ECs3633 [Escherichia coli]
 gi|209761510|gb|ACI79067.1| hypothetical protein ECs3633 [Escherichia coli]
 gi|209761512|gb|ACI79068.1| hypothetical protein ECs3633 [Escherichia coli]
 gi|209761514|gb|ACI79069.1| hypothetical protein ECs3633 [Escherichia coli]
 gi|209761516|gb|ACI79070.1| hypothetical protein ECs3633 [Escherichia coli]
 gi|217320128|gb|EEC28553.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           TW14588]
 gi|218353107|emb|CAU98932.1| conserved hypothetical protein [Escherichia coli 55989]
 gi|218355253|emb|CAQ87860.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469]
 gi|218433369|emb|CAR14271.1| conserved hypothetical protein [Escherichia coli UMN026]
 gi|226839450|gb|EEH71471.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
 gi|238860367|gb|ACR62365.1| conserved protein [Escherichia coli BW2952]
 gi|242378324|emb|CAQ33101.1| conserved protein [Escherichia coli BL21(DE3)]
 gi|253323417|gb|ACT28019.1| conserved hypothetical protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253974604|gb|ACT40275.1| hypothetical protein ECB_02622 [Escherichia coli B str. REL606]
 gi|253978769|gb|ACT44439.1| hypothetical protein ECD_02622 [Escherichia coli BL21(DE3)]
 gi|254594116|gb|ACT73477.1| conserved protein [Escherichia coli O157:H7 str. TW14359]
 gi|260448173|gb|ACX38595.1| conserved hypothetical protein [Escherichia coli DH1]
 gi|281602138|gb|ADA75122.1| hypothetical protein SFxv_3060 [Shigella flexneri 2002017]
 gi|290763976|gb|ADD57937.1| hypothetical protein G2583_3426 [Escherichia coli O55:H7 str.
           CB9615]
 gi|291322193|gb|EFE61622.1| ygcF protein [Escherichia coli B088]
 gi|291426274|gb|EFE99306.1| aconitate hydratase [Escherichia coli FVEC1412]
 gi|291432211|gb|EFF05193.1| ygcF protein [Escherichia coli B185]
 gi|298277146|gb|EFI18662.1| ygcF protein [Escherichia coli FVEC1302]
 gi|299881782|gb|EFI89993.1| radical SAM domain protein [Escherichia coli MS 196-1]
 gi|300315222|gb|EFJ65006.1| radical SAM domain protein [Escherichia coli MS 175-1]
 gi|300356797|gb|EFJ72667.1| radical SAM domain protein [Escherichia coli MS 198-1]
 gi|300450164|gb|EFK13784.1| radical SAM domain protein [Escherichia coli MS 116-1]
 gi|300460946|gb|EFK24439.1| radical SAM domain protein [Escherichia coli MS 187-1]
 gi|301076426|gb|EFK91232.1| radical SAM domain protein [Escherichia coli MS 146-1]
 gi|306907230|gb|EFN37736.1| Radical SAM domain protein [Escherichia coli W]
 gi|308925868|gb|EFP71347.1| uncharacterized protein ygcF [Shigella dysenteriae 1617]
 gi|309703136|emb|CBJ02470.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
 gi|313647836|gb|EFS12282.1| uncharacterized protein ygcF [Shigella flexneri 2a str. 2457T]
 gi|315062058|gb|ADT76385.1| conserved protein [Escherichia coli W]
 gi|315137383|dbj|BAJ44542.1| hypothetical protein ECDH1ME8569_2686 [Escherichia coli DH1]
 gi|315615162|gb|EFU95799.1| uncharacterized protein ygcF [Escherichia coli 3431]
 gi|320182388|gb|EFW57285.1| Queuosine Biosynthesis QueE Radical SAM [Shigella boydii ATCC 9905]
 gi|320189106|gb|EFW63765.1| Queuosine Biosynthesis QueE Radical SAM [Escherichia coli O157:H7
           str. EC1212]
 gi|320640422|gb|EFX09961.1| hypothetical protein ECO5101_03379 [Escherichia coli O157:H7 str.
           G5101]
 gi|320645668|gb|EFX14653.1| hypothetical protein ECO9389_22861 [Escherichia coli O157:H- str.
           493-89]
 gi|320650968|gb|EFX19408.1| hypothetical protein ECO2687_10848 [Escherichia coli O157:H- str. H
           2687]
 gi|320656464|gb|EFX24360.1| hypothetical protein ECO7815_01005 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320662360|gb|EFX29757.1| hypothetical protein ECO5905_04892 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320667058|gb|EFX34021.1| hypothetical protein ECOSU61_08009 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323183315|gb|EFZ68712.1| hypothetical protein ECOK1357_3090 [Escherichia coli 1357]
 gi|323377359|gb|ADX49627.1| Radical SAM domain protein [Escherichia coli KO11]
 gi|323933926|gb|EGB30415.1| queuosine biosynthesis protein QueE [Escherichia coli E1520]
 gi|323946500|gb|EGB42526.1| queuosine biosynthesis protein QueE [Escherichia coli H120]
 gi|323960705|gb|EGB56329.1| queuosine biosynthesis protein QueE [Escherichia coli H489]
 gi|323966752|gb|EGB62183.1| queuosine biosynthesis protein QueE [Escherichia coli M863]
 gi|323971622|gb|EGB66853.1| queuosine biosynthesis protein QueE [Escherichia coli TA007]
 gi|323978613|gb|EGB73695.1| queuosine biosynthesis protein QueE [Escherichia coli TW10509]
 gi|324111402|gb|EGC05384.1| hypothetical protein ERIG_04120 [Escherichia fergusonii B253]
 gi|324119819|gb|EGC13698.1| queuosine biosynthesis protein QueE [Escherichia coli E1167]
 gi|325496184|gb|EGC94043.1| hypothetical protein ECD227_0281 [Escherichia fergusonii ECD227]
 gi|326339155|gb|EGD62970.1| Queuosine Biosynthesis QueE Radical SAM [Escherichia coli O157:H7
           str. 1044]
 gi|326342962|gb|EGD66730.1| Queuosine Biosynthesis QueE Radical SAM [Escherichia coli O157:H7
           str. 1125]
 gi|327251511|gb|EGE63197.1| hypothetical protein ECSTEC7V_3359 [Escherichia coli STEC_7v]
 gi|331036932|gb|EGI09156.1| putative Organic radical activating enzyme [Escherichia coli H736]
 gi|331047639|gb|EGI19716.1| putative Organic radical activating enzyme [Escherichia coli M718]
 gi|331078013|gb|EGI49219.1| putative Organic radical activating enzyme [Escherichia coli H299]
 gi|332087574|gb|EGI92702.1| hypothetical protein SB521682_3318 [Shigella boydii 5216-82]
 gi|332087749|gb|EGI92876.1| hypothetical protein SD15574_3520 [Shigella dysenteriae 155-74]
          Length = 223

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 92/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWEKLED 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAASSEDLLAVIGRQG----YTARHVVITGGEPCIHDLLPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLTDDKPRVIALQPISQKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|256425881|ref|YP_003126534.1| hypothetical protein Cpin_6932 [Chitinophaga pinensis DSM 2588]
 gi|256040789|gb|ACU64333.1| conserved hypothetical protein [Chitinophaga pinensis DSM 2588]
          Length = 209

 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 65/214 (30%), Positives = 97/214 (45%), Gaps = 26/214 (12%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F TLQGEG + G+ A F R  GC++            C +CD      +     
Sbjct: 14  LPVMERFYTLQGEGNYQGQAAYFIRLGGCDV-----------GCHWCDVK----ESWDAS 58

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIE 123
           R+ +  +++L+ +        GR  V+TGGEPL+    PL  AL+   F   +ET+G+  
Sbjct: 59  RHPLIAISELVRD---AAVHPGRIAVITGGEPLMHNLDPLTDALHAASFRTHMETSGSSP 115

Query: 124 PPQGIDWICVSP---KAGCDLKIKGGQELKLVFPQV-NVSPENYIGF---DFERFSLQPM 176
                DWI +SP   KA      +   ELK+V     + +             +  LQP 
Sbjct: 116 LSGHWDWITLSPKKFKAPLPEVCEVAHELKVVIFNKSDFAWAEKYAALAGPHCKLYLQPE 175

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                 + T L I Y  +NPKW+LS+QTHK+I +
Sbjct: 176 WEK-SAQVTPLIIDYIKENPKWQLSLQTHKYINV 208


>gi|153000640|ref|YP_001366321.1| radical activating enzyme [Shewanella baltica OS185]
 gi|151365258|gb|ABS08258.1| conserved hypothetical protein [Shewanella baltica OS185]
          Length = 222

 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 65/237 (27%), Positives = 91/237 (38%), Gaps = 44/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y + E+F T+QGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MNYPVNEVFETIQGEGVFTGVPAIFVRLQGCPV-----------GCAWCDTKQTWDVLEA 49

Query: 57  ----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
                     + GT G     D  A  +   +       R+ V+TGGEP +     L + 
Sbjct: 50  NKVTPEQVISVDGTIGRW--ADHTAQSLIAAFHAKGFTARHIVITGGEPCMYDLRELTET 107

Query: 107 LNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKLVFPQVNV 158
           L+ +GF   +ET+GT +       W+ VSPK       K          E+K      N 
Sbjct: 108 LHSQGFATQIETSGTFDINCADDTWVTVSPKVNMKGGYKVLAQALNRANEIKHPIATENH 167

Query: 159 SPE-----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             E       I    +   LQP+        T LA+  C     WRLS+QTHK++ I
Sbjct: 168 IAELDELLQDIDISTKAICLQPISQK--PRATELAMKVCITR-NWRLSIQTHKYLNI 221


>gi|327395003|dbj|BAK12425.1| organic radical Activating YgcF [Pantoea ananatis AJ13355]
          Length = 223

 Score =  194 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 69/240 (28%), Positives = 95/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I E+F TLQGEG + G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYYTGVPAIFIRLQGCPV-----------GCSWCDTKHTWEKQAD 49

Query: 57  ------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                       ++    G  +   L   I +Q  T     R+ V+TGGEP +    PL 
Sbjct: 50  RETSLGDILVKTVESDAWGNADTATLLSSIAQQGWT----ARHVVITGGEPAIYDLRPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKL-VFPQ 155
            +L   GF+  +ET+GT E       W+ VSPK             +    E+K  V  Q
Sbjct: 106 ASLEAAGFQCQIETSGTHEIHCSEQTWVTVSPKVNMRGGYDVLAQALSRADEIKHPVARQ 165

Query: 156 VNVSPEN-----YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +V   +              +LQP+      E T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDVEALDDLLAGIQDSKARIIALQPISRKD--EATKLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|291618623|ref|YP_003521365.1| YgcF [Pantoea ananatis LMG 20103]
 gi|291153653|gb|ADD78237.1| YgcF [Pantoea ananatis LMG 20103]
          Length = 223

 Score =  194 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 69/240 (28%), Positives = 95/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I E+F TLQGEG + G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYYTGVPAIFIRLQGCPV-----------GCSWCDTKHTWEKQAD 49

Query: 57  ------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                       ++    G  +   L   I +Q  T     R+ V+TGGEP +    PL 
Sbjct: 50  RETSLGDILVKTVESDAWGNADTATLLSSIAQQGWT----ARHAVITGGEPAIYDLRPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKL-VFPQ 155
            +L   GF+  +ET+GT E       W+ VSPK             +    E+K  V  Q
Sbjct: 106 ASLEAAGFQCQIETSGTHEIHCSEQTWVTVSPKVNMRGGYDVLAQALSRADEIKHPVARQ 165

Query: 156 VNVSPEN-----YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +V   +              +LQP+      E T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDVEALDDLLAGIQDSKARIIALQPISRKD--EATKLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|170726897|ref|YP_001760923.1| radical activating enzyme [Shewanella woodyi ATCC 51908]
 gi|169812244|gb|ACA86828.1| radical activating enzyme [Shewanella woodyi ATCC 51908]
          Length = 222

 Score =  194 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 65/237 (27%), Positives = 97/237 (40%), Gaps = 44/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y + E+F T+QGEG + G  A+F R  GC +            C +CDT         
Sbjct: 1   MKYPVNEVFETIQGEGFYTGVPAIFVRLQGCPV-----------GCSWCDTKHTWELLDV 49

Query: 57  ----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
                     + GT G R++    ++LI       E    + V+TGGEP L     + + 
Sbjct: 50  NKVQPEMVIQVDGTIG-RWSELTTSELI-SFLKQKEFTASHVVITGGEPCLHDLTAMTEE 107

Query: 107 LNKRGFEIAVETNGTIE-PPQGIDWICVSPK-------AGCDLKIKGGQELKLVFPQVNV 158
            N  G+   +ET+GT E       W+ VSPK       A     +K   E+K      + 
Sbjct: 108 FNDAGYSTQIETSGTFEVHCSEKTWVTVSPKLKMKAGLAVLPQALKRANEIKHPVATASH 167

Query: 159 SPE-----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             +     N +    +   LQP+        T LA+  C +   WRLS+QTHK++ I
Sbjct: 168 IDDLDELLNGVDLKGKTICLQPISQKT--RATELAMRVCIER-NWRLSIQTHKYLDI 221


>gi|146298250|ref|YP_001192841.1| radical SAM domain-containing protein [Flavobacterium johnsoniae
           UW101]
 gi|146152668|gb|ABQ03522.1| Radical SAM domain protein [Flavobacterium johnsoniae UW101]
          Length = 210

 Score =  194 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 60/215 (27%), Positives = 89/215 (41%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + E F T+QGEG H G  A F R  GC++            C +CD      +    
Sbjct: 15  MLPLMEEFYTIQGEGFHTGTAAYFIRIGGCDV-----------GCHWCDVK----ESWNA 59

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             +    +  ++              V+TGGEPL      L Q L  +  ++ +ET+G  
Sbjct: 60  ELHPPTNIDIIVN----NASSYANTVVVTGGEPLTWDMTLLTQQLKDKNLKVHIETSGAY 115

Query: 123 EPPQGIDWICVSPKAGC---DLKIKGGQELKLVFPQVN----VSPENYIGFDFERFSLQP 175
                 DWIC+SPK              ELK++    +       +  +  D     LQP
Sbjct: 116 PLSGTWDWICLSPKKNKLPTPDVYANAHELKVIIYNKHDFIFAEEQAELVNDNAILFLQP 175

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +    EE T L + Y   NPKWR+S+QTHK++ I
Sbjct: 176 -EWSKKEEMTPLIVDYVMNNPKWRVSLQTHKYLNI 209


>gi|217973439|ref|YP_002358190.1| radical activating enzyme [Shewanella baltica OS223]
 gi|217498574|gb|ACK46767.1| radical activating enzyme [Shewanella baltica OS223]
          Length = 222

 Score =  194 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 65/237 (27%), Positives = 91/237 (38%), Gaps = 44/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y + E+F T+QGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MNYPVNEVFETIQGEGVFTGVPAIFVRLQGCPV-----------GCAWCDTKQTWDVLEV 49

Query: 57  ----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
                     + GT G     D  A  +   +       R+ V+TGGEP +     L + 
Sbjct: 50  NKVMPEQVISVDGTIGRW--ADHTAQSLIAAFHAKGFTARHIVITGGEPCMYDLCELTET 107

Query: 107 LNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKLVFPQVNV 158
           L+ +GF   +ET+GT +       W+ VSPK       K          E+K      N 
Sbjct: 108 LHSQGFATQIETSGTFDINCADDTWVTVSPKVNMKGGYKVLTQALNRANEIKHPIATENH 167

Query: 159 SPE-----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             E       I    +   LQP+        T LA+  C     WRLS+QTHK++ I
Sbjct: 168 IAELDELLQGIDISTKTICLQPISQK--PRATELAMKVCIAR-NWRLSIQTHKYLNI 221


>gi|299141903|ref|ZP_07035038.1| organic radical activating enzyme [Prevotella oris C735]
 gi|298576754|gb|EFI48625.1| organic radical activating enzyme [Prevotella oris C735]
          Length = 190

 Score =  194 bits (493), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 86/213 (40%), Positives = 111/213 (52%), Gaps = 28/213 (13%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           K Y + EIF +LQGEG + GR AVF RFSGCNL            C FCDTDF       
Sbjct: 3   KTYKVNEIFYSLQGEGRNTGRAAVFIRFSGCNLK-----------CSFCDTDFKLYH--- 48

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
                 + + D + E    G     + VLTGGEP LQVD  LI AL+  GF +A+E+NGT
Sbjct: 49  --EMTAEAIVDAVREWKTAG-----FVVLTGGEPTLQVDSQLIDALHAEGFYVAMESNGT 101

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMD---G 178
             PP  +DW+ +SPK    + +    ELK +F      P + +G + + + LQP D    
Sbjct: 102 NVPPANLDWLTISPKEH--VVVTECNELKCIFDGQK--PVDDLGIEADYYYLQPCDVGND 157

Query: 179 PFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
                 T   I Y   +PKWRLS+QTHK IG +
Sbjct: 158 VQNRAITQACIRYIASHPKWRLSLQTHKMIGFQ 190


>gi|262171605|ref|ZP_06039283.1| queuosine Biosynthesis QueE Radical SAM [Vibrio mimicus MB-451]
 gi|261892681|gb|EEY38667.1| queuosine Biosynthesis QueE Radical SAM [Vibrio mimicus MB-451]
          Length = 222

 Score =  194 bits (493), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 64/236 (27%), Positives = 94/236 (39%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI----- 57
           +Y I E+F T+QGEG   G  AVF R  GC +            C +CDT          
Sbjct: 1   MYRINEMFETIQGEGVFTGVPAVFVRLQGCPV-----------GCAWCDTKQTWETLESD 49

Query: 58  ---------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                    + +    +      D+IE     G  + ++ V+TGGEP +     L QA  
Sbjct: 50  QTSFPQILLKTSDAPTWCQASAQDVIERYRAQG-YQAKHIVITGGEPCIYDLTELTQAFE 108

Query: 109 KRGFEIAVETNGTIEPPQGI-DWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVS 159
             G +  +ET+GT E       W+ VSPK     K+           E+K  V  + ++ 
Sbjct: 109 AIGCQCQIETSGTYEILATPTTWVTVSPKVAMKGKLPILDSALQRANEIKHPVATEKDID 168

Query: 160 PENYIGFDF-----ERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             + +            +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 169 NLDELLVRASVDAKTVIALQPISQK--PRATELCIRTCIAR-NWRLSIQTHKYLNI 221


>gi|260174975|ref|ZP_05761387.1| hypothetical protein BacD2_24170 [Bacteroides sp. D2]
 gi|315923210|ref|ZP_07919450.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|313697085|gb|EFS33920.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 181

 Score =  194 bits (493), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 74/209 (35%), Positives = 106/209 (50%), Gaps = 28/209 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF ++QGEG   G  AVF RFSGCNL            C FCDT         G
Sbjct: 1   MKKINEIFYSIQGEGYRTGTPAVFVRFSGCNLK-----------CPFCDTQHSS-----G 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              + +++   +           R+ VLTGGEP LQVD   I  L++ G  + +ETNGT+
Sbjct: 45  REMSDEEIIKEV------CFYPTRFVVLTGGEPGLQVDQEFINKLHQAGKFVQIETNGTV 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P GIDWI  SPK G  + +    E+K+V+   ++S    +      + LQP       
Sbjct: 99  PLPIGIDWITCSPKEGSKVFVVNPHEIKVVYTGQDLSTYEAMT--AAVYYLQPCSC---- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           +NT   I+Y  ++PKW+LS+QT K + ++
Sbjct: 153 QNTEEVINYVKEHPKWKLSLQTQKILNVQ 181


>gi|331674271|ref|ZP_08375031.1| putative Organic radical activating enzyme [Escherichia coli TA280]
 gi|331068365|gb|EGI39760.1| putative Organic radical activating enzyme [Escherichia coli TA280]
          Length = 223

 Score =  194 bits (493), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 92/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWEKLED 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAASSEDLLAVIGRQG----YTARHVVITGGEPCIHDLMPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLTDDKPRVIALQPISQKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|157148316|ref|YP_001455635.1| hypothetical protein CKO_04133 [Citrobacter koseri ATCC BAA-895]
 gi|157085521|gb|ABV15199.1| hypothetical protein CKO_04133 [Citrobacter koseri ATCC BAA-895]
          Length = 223

 Score =  194 bits (493), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 93/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDKLED 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLYSILAKTKESDKWGAASSEDLLAVISRQG----YTARHVVITGGEPCIHDLMPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKVNMRGGYDVLSQALERANEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLSDDKPRIIALQPISQK--EDATRLCIETCIVR-NWRLSMQTHKYLNI 222


>gi|262165604|ref|ZP_06033341.1| queuosine Biosynthesis QueE Radical SAM [Vibrio mimicus VM223]
 gi|262025320|gb|EEY43988.1| queuosine Biosynthesis QueE Radical SAM [Vibrio mimicus VM223]
          Length = 222

 Score =  194 bits (493), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 64/236 (27%), Positives = 94/236 (39%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI----- 57
           +Y I E+F T+QGEG   G  AVF R  GC +            C +CDT          
Sbjct: 1   MYRINEMFETIQGEGVFTGVPAVFVRLQGCPV-----------GCAWCDTKQTWETLESD 49

Query: 58  ---------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                    + +    +      D+IE     G  + ++ V+TGGEP +     L QA  
Sbjct: 50  QTSFPQILLKTSDAPTWCQASAQDVIERYRAQG-YQAKHIVITGGEPCIYDLTELTQAFA 108

Query: 109 KRGFEIAVETNGTIEPPQGI-DWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVS 159
             G +  +ET+GT E       W+ VSPK     K+           E+K  V  + ++ 
Sbjct: 109 AIGCQCQIETSGTYEILATPTTWVTVSPKVAMKGKLPILDSALQRANEIKHPVATEKDID 168

Query: 160 PENYIGFDF-----ERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             + +            +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 169 NLDELLVRASVDAKTVIALQPISQK--PRATELCIRTCIAR-NWRLSIQTHKYLNI 221


>gi|311278265|ref|YP_003940496.1| Radical SAM domain-containing protein [Enterobacter cloacae SCF1]
 gi|308747460|gb|ADO47212.1| Radical SAM domain protein [Enterobacter cloacae SCF1]
          Length = 223

 Score =  193 bits (492), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 90/240 (37%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDMLED 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G    + L   I  Q  T     R+ V+TGGEP +    PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAATAEDLLTAITRQGWT----ARHVVITGGEPCIHDLTPLT 105

Query: 105 QALNKRGFEIAVETNGTIEPPQGI-DWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L + G+   +ET+GT E       W+ VSPK             +    E+K      
Sbjct: 106 ALLEQNGYSCQIETSGTHEVRCSHSTWVTVSPKVNMRGGFEVLSQALHRADEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++   E          +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLETLSDDKQRVIALQPISQKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|290476591|ref|YP_003469496.1| putative coenzyme PQQ synthesis protein with nitrogenase
           iron-molybdenum domain [Xenorhabdus bovienii SS-2004]
 gi|289175929|emb|CBJ82732.1| putative coenzyme PQQ synthesis protein with nitrogenase
           iron-molybdenum domain [Xenorhabdus bovienii SS-2004]
          Length = 223

 Score =  193 bits (492), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 65/237 (27%), Positives = 91/237 (38%), Gaps = 43/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
            +Y I EIF TLQGEG   G  +VF R  GC +            C +CDT         
Sbjct: 1   MIYPINEIFQTLQGEGVFTGVPSVFIRLQGCPV-----------GCSWCDTKHTWEKEAD 49

Query: 57  ---------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
                    ++      +       +I   +I      R+ V+TGGEP L    PL + L
Sbjct: 50  KQQPMENILVKSQDSDTWGAATARQII-NLFIRQGYTARHIVVTGGEPCLYNLRPLTETL 108

Query: 108 NKRGFEIAVETNGTI-EPPQGIDWICVSPKA-------GCDLKIKGGQELKLVF---PQV 156
              G++  +ET+GT         W+ VSPK             +    E+K        +
Sbjct: 109 ESEGYQCQIETSGTHAIQCSEKTWVTVSPKVKMRGGYQVLPEAMNRANEIKHPVGRERDI 168

Query: 157 NVSPENYIGFDFE---RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               E     D +     +LQP+     EE T L I  C     WR S+QTHK++ I
Sbjct: 169 EALDELLTMLDEKADPVIALQPISQK--EEATRLCIETCIAR-NWRFSMQTHKYLNI 222


>gi|157375186|ref|YP_001473786.1| radical activating enzyme [Shewanella sediminis HAW-EB3]
 gi|157317560|gb|ABV36658.1| radical activating enzyme [Shewanella sediminis HAW-EB3]
          Length = 222

 Score =  193 bits (492), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 66/237 (27%), Positives = 99/237 (41%), Gaps = 44/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y + E+F T+QGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MKYPVNEVFETIQGEGFFTGVPAIFVRLQGCPV-----------GCSWCDTKHTWDVIEE 49

Query: 57  ----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
                     + GT G     +  A+ +   +       ++ V+TGGEP L   +PL ++
Sbjct: 50  NRVAPELVIQVDGTIGRW--AELTAEELISNFKAKGFTAKHVVITGGEPCLHDLIPLTES 107

Query: 107 LNKRGFEIAVETNGTIEPPQ-GIDWICVSPKAGCD-------LKIKGGQELKL-VFPQVN 157
           LN  G+   +ET+GT E       W+ VSPK             +    E+K  V  Q +
Sbjct: 108 LNLSGYATQIETSGTFEVICSDKTWVTVSPKINMKAGLPILNQALIRANEIKHPVATQAH 167

Query: 158 VSPENY----IGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +   +     I  D +   LQP+        T LA+  C +   WRLS+QTHK++ I
Sbjct: 168 IDDLDCLLKGISLDEKTICLQPISQK--SRATELAMRVCIER-NWRLSIQTHKYLEI 221


>gi|163752023|ref|ZP_02159232.1| radical activating enzyme [Shewanella benthica KT99]
 gi|161328075|gb|EDP99244.1| radical activating enzyme [Shewanella benthica KT99]
          Length = 222

 Score =  193 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 63/236 (26%), Positives = 96/236 (40%), Gaps = 42/236 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y + E+F T+QGEG   G  A+F R  GC +            C +CDT        K
Sbjct: 1   MKYPVNEVFETIQGEGVFTGVAAIFVRLQGCPV-----------GCSWCDTKHTWDVLEK 49

Query: 62  G--------------GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
                          GR++     +LI   +I      ++ V+TGGEP +     L   L
Sbjct: 50  NRVAPELVIQVDGVIGRWSELTAEELI-NFFIRKGFNAKHVVITGGEPCIHDLTELTSQL 108

Query: 108 NKRGFEIAVETNGTIE-PPQGIDWICVSPKAGCD-------LKIKGGQELKLVFPQVNVS 159
           N++G+   +ET+GT E       W+ VSPK             ++   E+K    +    
Sbjct: 109 NRQGYGTQIETSGTFEVTCSDKTWVTVSPKVNMKAGMTVLTQALERADEIKHPVARSKHI 168

Query: 160 PE-----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +       I  + +   LQP+        T LA+  C +   WRLS+QTHK++ I
Sbjct: 169 DDLDELLEGIEVEGKIICLQPISQK--PRATELAMKICIER-NWRLSIQTHKYLNI 221


>gi|85058492|ref|YP_454194.1| hypothetical protein SG0514 [Sodalis glossinidius str. 'morsitans']
 gi|84779012|dbj|BAE73789.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 223

 Score =  193 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 66/237 (27%), Positives = 93/237 (39%), Gaps = 43/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y + EIF TLQGEG   G  A+F R  GC +            C +CDT     Q  +
Sbjct: 1   MQYPLNEIFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCSWCDTKHTWQQ-DE 48

Query: 62  GGRYNVDQL--------------ADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
             R    ++              A+ I    +      R+ V+TGGEP L   +PL   L
Sbjct: 49  AERVTAGEIPLKTADSSRWASITAEEIIALMVKQGWTARHVVITGGEPCLHDLMPLTHTL 108

Query: 108 NKRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKLV------F 153
            ++GF   +ET+GT E       W+ VSPK      +           E+K         
Sbjct: 109 EQQGFSCQIETSGTQEIHCTPQTWVTVSPKINMRGGLPVLAQALGRSDEIKHPAARQSDI 168

Query: 154 PQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +++              +LQP+     E  T L I  C     WRLS+QTHK++ I
Sbjct: 169 DELDALLATLHDTKQRVIALQPISQK--EAATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|90408082|ref|ZP_01216253.1| putative organic radical activating enzyme [Psychromonas sp. CNPT3]
 gi|90310839|gb|EAS38953.1| putative organic radical activating enzyme [Psychromonas sp. CNPT3]
          Length = 225

 Score =  193 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 62/234 (26%), Positives = 89/234 (38%), Gaps = 41/234 (17%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------- 56
           Y + EIF T+QGEG H G  A+F R  GC++            C +CDT           
Sbjct: 5   YKVNEIFQTIQGEGVHTGCAAIFIRLQGCDV-----------GCAWCDTKHTWSANENDK 53

Query: 57  ------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKR 110
                    +       D  A+ I  +    E   +  ++TGGEP +    PL   L+  
Sbjct: 54  VPLNLVTDLSNSSAQWADVSAEHILAEIKNLEYTAKLVIITGGEPCIFDLRPLTALLHAH 113

Query: 111 GFEIAVETNGTIEPPQG-IDWICVSPKAGCDLKIK-------GGQELKLV------FPQV 156
           GF+  +ET+GT         W+ VSPK     K +          E+K          Q+
Sbjct: 114 GFQTQIETSGTYPILVDAKSWVTVSPKVNMRAKKEVLLSALQRADEIKHPVGTQKDIEQL 173

Query: 157 NVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +           +   LQP+        T L +  C     WRLSVQ HK++ I
Sbjct: 174 DALLARLGDTHNKTICLQPISQK--ANATALCMRTCIAR-NWRLSVQLHKYLDI 224


>gi|308187939|ref|YP_003932070.1| hypothetical protein Pvag_2457 [Pantoea vagans C9-1]
 gi|308058449|gb|ADO10621.1| Uncharacterized protein ygcF [Pantoea vagans C9-1]
          Length = 223

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 69/240 (28%), Positives = 96/240 (40%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I E+F TLQGEG + G  A+F R  GC +            C +CDT         
Sbjct: 1   MFYPINEMFQTLQGEGYYTGVPAIFIRLQGCPV-----------GCSWCDTKHTWEKRAD 49

Query: 57  ------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                       ++    G  +   L   IE+Q  T     R+ V+TGGEP +    PL 
Sbjct: 50  RETSLGDILIKTVESDAWGDADASTLLRSIEQQGWT----ARHVVITGGEPAIYDLRPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKL-VFPQ 155
             L + GF+  +ET+GT E       W+ VSPK             +    E+K  V  Q
Sbjct: 106 TILEQHGFQCQIETSGTHEIHCSEQTWVTVSPKVNMRGGYDVLPQALSRADEIKHPVARQ 165

Query: 156 VNVSPEN-----YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +V   +              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDVDALDGLLAGIDDTKARIIALQPISRKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|300718116|ref|YP_003742919.1| Putative organic radical activating enzyme [Erwinia billingiae
           Eb661]
 gi|299063952|emb|CAX61072.1| Putative organic radical activating enzyme [Erwinia billingiae
           Eb661]
          Length = 223

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 63/236 (26%), Positives = 89/236 (37%), Gaps = 41/236 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y I E+F TLQGEG + G  A+F R  GC +            C +CDT     +   
Sbjct: 1   MQYPINEMFQTLQGEGFYTGVPAIFIRLQGCPV-----------GCSWCDTKHTWDKLAD 49

Query: 62  GGRYNVDQLADLIE-------------EQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                 D L   +E                       R+ V+TGGEP +    PL   L 
Sbjct: 50  RETSLGDILTKTVETDAWGSANAAALLAVIANHGWTARHIVITGGEPCIHDLTPLTATLQ 109

Query: 109 KRGFEIAVETNGTIEPPQG-IDWICVSPKAGC-------DLKIKGGQELKLVFPQV---- 156
           + GF   +ET+GT E       W+ VSPK          +  +    E+K    +     
Sbjct: 110 QHGFSCQIETSGTHEVLCSAETWVTVSPKVNMRGGYDVLNQALVRADEVKHPVARQRDVE 169

Query: 157 --NVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                            +LQP+      + T L I  C ++  WRLS+QTHK++ I
Sbjct: 170 ALQALLATLNDDKPRIIALQPISQKD--DATKLCIETCIKH-NWRLSMQTHKYLNI 222


>gi|317049298|ref|YP_004116946.1| Radical SAM domain-containing protein [Pantoea sp. At-9b]
 gi|316950915|gb|ADU70390.1| Radical SAM domain protein [Pantoea sp. At-9b]
          Length = 223

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 68/240 (28%), Positives = 94/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I E+F TLQGEG + G  A+F R  GC +            C +CDT         
Sbjct: 1   MYYPINEMFQTLQGEGFYTGVPALFIRLQGCPV-----------GCSWCDTKHTWEKLAD 49

Query: 57  ------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                       ++    G  +   L D I+ Q  T     R+ V+TGGEP +    PL 
Sbjct: 50  RETSLGDILVKTVESDAWGNADAAMLIDTIQRQGWT----ARHVVITGGEPAIYDLRPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQV 156
            AL   GF   +ET+GT E       W+ VSPK             ++   E+K    +V
Sbjct: 106 SALEAAGFACQIETSGTHEIRCSDSTWVTVSPKVNMRGGYDVLPQALQRADEIKHPVARV 165

Query: 157 ------NVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                 +              +LQP+     +  T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDVEALDALLAGLHDEKKRIIALQPIS--RGDAATKLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|329295553|ref|ZP_08252889.1| Radical SAM domain-containing protein [Plautia stali symbiont]
          Length = 223

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 70/240 (29%), Positives = 98/240 (40%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I E+F TLQGEG + G  A+F R  GC +            C +CDT         
Sbjct: 1   MFYPINEMFQTLQGEGFYTGVPAIFIRLQGCPV-----------GCSWCDTKHTWETRAD 49

Query: 57  ------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                       ++    G  +   L + I+ Q  T     R+ V+TGGEP +    PL 
Sbjct: 50  LETSLGDILVKTVESDAWGSADAATLIETIQRQGWT----ARHLVITGGEPAIFDLRPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQ- 155
           +AL   GF+  +ET+GT E       W+ VSPK             ++   E+K    + 
Sbjct: 106 EALETAGFQCQIETSGTHEVHCSAATWVTVSPKVNMRGGYDVLPQALQRADEIKHPVARE 165

Query: 156 --VNVSPENYIGFDFER---FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             V        G   E+    +LQP+     E  T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDVEALDALLAGLQDEKKRIVALQPIS--RGEAATRLCIETCIVR-NWRLSMQTHKYLNI 222


>gi|262275962|ref|ZP_06053771.1| queuosine Biosynthesis QueE Radical SAM [Grimontia hollisae CIP
           101886]
 gi|262219770|gb|EEY71086.1| queuosine Biosynthesis QueE Radical SAM [Grimontia hollisae CIP
           101886]
          Length = 220

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 60/238 (25%), Positives = 97/238 (40%), Gaps = 49/238 (20%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------ 56
           +Y++ EIF T+QGEG   G  +VF R  GC +            C +CDT          
Sbjct: 1   MYNVNEIFETIQGEGTFTGIPSVFIRLQGCPV-----------GCPWCDTRQTWDTLPLD 49

Query: 57  -----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQ 105
                       +     R + + +   ++ +        ++ V+TGGEP +   +PL  
Sbjct: 50  QRDFGTIIAKNDESPLWARVSAEDILSHLQSR-----YTAKHIVITGGEPCMFDLMPLTS 104

Query: 106 ALNKRGFEIAVETNGTI-EPPQGIDWICVSPKAGCDLKIK-------GGQELKL-VFPQV 156
            L+  G+   +ET+GT         W+ VSPK     K+           E+K  V  + 
Sbjct: 105 LLDAHGYRCQIETSGTYVVYATENTWVTVSPKINMRGKLPILKEALDRANEIKHPVGTES 164

Query: 157 NVSPEN----YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           ++   +    ++    +  +LQP+        T L I  C     WRLSVQTHK++ I
Sbjct: 165 DIEKLDELLKHVDLKGKEVALQPISQK--ARATALCIETCIAR-NWRLSVQTHKYLNI 219


>gi|261342207|ref|ZP_05970065.1| radical SAM domain protein [Enterobacter cancerogenus ATCC 35316]
 gi|288315541|gb|EFC54479.1| radical SAM domain protein [Enterobacter cancerogenus ATCC 35316]
          Length = 223

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 68/240 (28%), Positives = 95/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDKLAD 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  N + L  +I  Q  T     R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAGNAEDLLAIIGRQGWT----ARHVVITGGEPCIHDLMPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
           + L K G+   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 ELLEKNGYSCQIETSGTHEVRCSHTTWVTVSPKVNMRGGYDVLSQALERADEIKHPVGRV 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLTDEKQRIIALQPISQK--EDATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|269138400|ref|YP_003295100.1| radical SAM domain protein [Edwardsiella tarda EIB202]
 gi|267984060|gb|ACY83889.1| radical SAM domain protein [Edwardsiella tarda EIB202]
 gi|304558427|gb|ADM41091.1| Queuosine Biosynthesis QueE Radical SAM [Edwardsiella tarda FL6-60]
          Length = 223

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 66/237 (27%), Positives = 97/237 (40%), Gaps = 43/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y I EIF +LQGEG + G  AVF R  GC +            C +CD+     Q  +
Sbjct: 1   MQYPINEIFQSLQGEGFYTGVPAVFIRLQGCPV-----------GCSWCDSQHTWHQRPE 49

Query: 62  GGRYNVDQLADLIEE--------------QWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
             + ++ Q+ +   E                     + R+ V+TGGEP +   +PL  AL
Sbjct: 50  -CQADLAQIVEKTAESEAWASADAAALVALLRQRGYQARHVVITGGEPCMHDLLPLTTAL 108

Query: 108 NKRGFEIAVETNGTIE-PPQGIDWICVSPKAGCD-------LKIKGGQELKLVFPQV--- 156
            + G+   +ET+GT         W+ VSPK G           ++   E+K    +    
Sbjct: 109 EQGGYRCQIETSGTHPVRCSAQTWVTVSPKVGMRGGMTVLTDALRRANEIKHPVARARDI 168

Query: 157 ---NVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              +       G      +LQP+     EE T L I  C     WRLS+QTHK++ I
Sbjct: 169 EALDALLARLDGELPPVVALQPISCK--EEATRLCIETCLAR-NWRLSMQTHKYLNI 222


>gi|238897449|ref|YP_002923126.1| hypothetical protein HDEF_0210 [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465204|gb|ACQ66978.1| conserved hypothetical protein, Radical_SAM domain protein
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 223

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 66/236 (27%), Positives = 90/236 (38%), Gaps = 41/236 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
            LY I EIF TLQGEG   G  A+F R  GC +            C +CDT     +  +
Sbjct: 1   MLYPINEIFQTLQGEGHFMGTPAIFIRLQGCPV-----------GCSWCDTKHTWEKKNE 49

Query: 62  -------------GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                           +        +         +  + V+TGGEP L    PL Q L 
Sbjct: 50  QQVDLFSILQKKTANDFWSHSGEQNLLAVIRAQGYQASHVVITGGEPCLYDLTPLTQLLE 109

Query: 109 KRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQ----- 155
           + G+   +ET+GT         W+ VSPK             ++   ELK V  +     
Sbjct: 110 QEGYFCQIETSGTHLVHCTPSCWVTVSPKINMRGGFKIQHQALERADELKHVVARKSDIE 169

Query: 156 -VNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            ++    N         SLQP+        T L I  C +   WRLSVQ HK++GI
Sbjct: 170 TLDALIGNLKDRKKRIISLQPVSQKKS--ATQLCIDTCIER-NWRLSVQMHKYLGI 222


>gi|330445748|ref|ZP_08309400.1| conserved protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328489939|dbj|GAA03897.1| conserved protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 222

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 63/236 (26%), Positives = 94/236 (39%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y I E+F T+QGEG   G  A+F R   C +            C +CDT          
Sbjct: 1   MYKINEVFETIQGEGVFTGVPAIFVRLQVCPV-----------GCSWCDTKQTWT-AEPQ 48

Query: 63  GRYNVDQLADL--------------IEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
              +++Q+                 + +  I  +   ++ V+TGGEP +    PL +AL 
Sbjct: 49  DLASLEQIMAKTEDSPLWTQLDANGVVQLLIDQKYTAKHVVITGGEPCIYDLRPLTEALE 108

Query: 109 KRGFEIAVETNGTIEPPQGID-WICVSPKAGCDLKIK-------GGQELKLV------FP 154
             GF   +ET+GT E     + W+ VSPK     K+           E+K          
Sbjct: 109 AAGFNCQIETSGTSEIQASNNTWVTVSPKINMKAKLPVLASALERANEIKHPVGTSKDIE 168

Query: 155 QVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           Q++   E          +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 169 QLDALLEGKNLKSDITIALQPISQK--PRATELCIETCIAR-NWRLSIQTHKYLAI 221


>gi|281426145|ref|ZP_06257058.1| radical SAM domain protein [Prevotella oris F0302]
 gi|281399721|gb|EFB30552.1| radical SAM domain protein [Prevotella oris F0302]
          Length = 190

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 85/213 (39%), Positives = 111/213 (52%), Gaps = 28/213 (13%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           K Y + EIF +LQGEG + GR AVF RFSGCNL            C FCDTDF       
Sbjct: 3   KTYKVNEIFYSLQGEGRNTGRAAVFIRFSGCNLK-----------CSFCDTDFKLYH--- 48

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
                 + + D + +    G     + VLTGGEP LQVD  LI AL+  GF +A+E+NGT
Sbjct: 49  --EMTAEAIVDAVRDWKTAG-----FVVLTGGEPTLQVDGKLIDALHAEGFYVAMESNGT 101

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMD---G 178
             PP  +DW+ +SPK    + +    ELK +F      P + +G + + + LQP D    
Sbjct: 102 NVPPPNLDWLTISPKEH--VVVTECNELKCIFDGQK--PVDDLGIEADYYYLQPCDVGND 157

Query: 179 PFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
                 T   I Y   +PKWRLS+QTHK IG +
Sbjct: 158 VQNRTITQACIRYIASHPKWRLSLQTHKMIGFQ 190


>gi|22124729|ref|NP_668152.1| hypothetical protein y0816 [Yersinia pestis KIM 10]
 gi|45440171|ref|NP_991710.1| hypothetical protein YP_0312 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51595107|ref|YP_069298.1| coenzyme PQQ synthesis protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108808863|ref|YP_652779.1| hypothetical protein YPA_2872 [Yersinia pestis Antiqua]
 gi|108810883|ref|YP_646650.1| hypothetical protein YPN_0718 [Yersinia pestis Nepal516]
 gi|145600242|ref|YP_001164318.1| hypothetical protein YPDSF_2985 [Yersinia pestis Pestoides F]
 gi|153949574|ref|YP_001402270.1| radical SAM domain-containing protein [Yersinia pseudotuberculosis
           IP 31758]
 gi|153997583|ref|ZP_02022683.1| hypothetical protein YPE_4042 [Yersinia pestis CA88-4125]
 gi|162421287|ref|YP_001605539.1| radical SAM domain-containing protein [Yersinia pestis Angola]
 gi|165925701|ref|ZP_02221533.1| radical SAM domain protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165936653|ref|ZP_02225220.1| radical SAM domain protein [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166009994|ref|ZP_02230892.1| radical SAM domain protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166214107|ref|ZP_02240142.1| radical SAM domain protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167398407|ref|ZP_02303931.1| radical SAM domain protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167420659|ref|ZP_02312412.1| radical SAM domain protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167423406|ref|ZP_02315159.1| radical SAM domain protein [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167470705|ref|ZP_02335409.1| radical SAM domain protein [Yersinia pestis FV-1]
 gi|170025659|ref|YP_001722164.1| radical SAM domain-containing protein [Yersinia pseudotuberculosis
           YPIII]
 gi|186894119|ref|YP_001871231.1| radical SAM domain-containing protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|218930391|ref|YP_002348266.1| hypothetical protein YPO3374 [Yersinia pestis CO92]
 gi|229839004|ref|ZP_04459163.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229896484|ref|ZP_04511652.1| conserved protein [Yersinia pestis Pestoides A]
 gi|229899572|ref|ZP_04514713.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229901094|ref|ZP_04516217.1| conserved protein [Yersinia pestis Nepal516]
 gi|270489273|ref|ZP_06206347.1| radical SAM domain protein [Yersinia pestis KIM D27]
 gi|294505081|ref|YP_003569143.1| hypothetical protein YPZ3_2972 [Yersinia pestis Z176003]
 gi|21957546|gb|AAM84403.1|AE013684_5 hypothetical protein y0816 [Yersinia pestis KIM 10]
 gi|45435027|gb|AAS60587.1| Organic radical activating enzymes [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51588389|emb|CAH19997.1| putative coenzyme PQQ synthesis protein, nitrogenase
           iron-molybdenum domain [Yersinia pseudotuberculosis IP
           32953]
 gi|108774531|gb|ABG17050.1| hypothetical protein YPN_0718 [Yersinia pestis Nepal516]
 gi|108780776|gb|ABG14834.1| hypothetical protein YPA_2872 [Yersinia pestis Antiqua]
 gi|115349002|emb|CAL21963.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145211938|gb|ABP41345.1| hypothetical protein YPDSF_2985 [Yersinia pestis Pestoides F]
 gi|149289220|gb|EDM39300.1| hypothetical protein YPE_4042 [Yersinia pestis CA88-4125]
 gi|152961069|gb|ABS48530.1| radical SAM domain protein [Yersinia pseudotuberculosis IP 31758]
 gi|162354102|gb|ABX88050.1| radical SAM domain protein [Yersinia pestis Angola]
 gi|165915302|gb|EDR33912.1| radical SAM domain protein [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165922313|gb|EDR39490.1| radical SAM domain protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165990901|gb|EDR43202.1| radical SAM domain protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166204738|gb|EDR49218.1| radical SAM domain protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166961465|gb|EDR57486.1| radical SAM domain protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167050911|gb|EDR62319.1| radical SAM domain protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167057576|gb|EDR67322.1| radical SAM domain protein [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169752193|gb|ACA69711.1| Radical SAM domain protein [Yersinia pseudotuberculosis YPIII]
 gi|186697145|gb|ACC87774.1| Radical SAM domain protein [Yersinia pseudotuberculosis PB1/+]
 gi|229681819|gb|EEO77912.1| conserved protein [Yersinia pestis Nepal516]
 gi|229687064|gb|EEO79139.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229695370|gb|EEO85417.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229700558|gb|EEO88589.1| conserved protein [Yersinia pestis Pestoides A]
 gi|262363141|gb|ACY59862.1| hypothetical protein YPD4_2958 [Yersinia pestis D106004]
 gi|262367071|gb|ACY63628.1| hypothetical protein YPD8_2956 [Yersinia pestis D182038]
 gi|270337777|gb|EFA48554.1| radical SAM domain protein [Yersinia pestis KIM D27]
 gi|294355540|gb|ADE65881.1| hypothetical protein YPZ3_2972 [Yersinia pestis Z176003]
 gi|320016570|gb|ADW00142.1| conserved protein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 223

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 68/240 (28%), Positives = 92/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
            LY I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MLYPINEMFQTLQGEGYFTGVPAIFVRLQGCPV-----------GCSWCDTKHTWEKEAD 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +    G  +  QL DL  +Q        R+ V+TGGEP +    PL 
Sbjct: 50  REVDMQRIMVKTAESDAWGSASEQQLLDLFAQQG----YTARHVVITGGEPSIYDLQPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L + GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 SLLEQAGFSCQIETSGTHEVRCSAQTWVTVSPKVNMRGGLKILSQALQRADEIKHPVGRL 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                +               +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALEALLATLDDDKKRIIALQPISQK--EDATKLCIETCIAK-NWRLSMQTHKYLNI 222


>gi|300724656|ref|YP_003713981.1| putative coenzyme PQQ synthesis protein with nitrogenase
           iron-molybdenum domain [Xenorhabdus nematophila ATCC
           19061]
 gi|297631198|emb|CBJ91893.1| putative coenzyme PQQ synthesis protein with nitrogenase
           iron-molybdenum domain [Xenorhabdus nematophila ATCC
           19061]
          Length = 223

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 65/236 (27%), Positives = 93/236 (39%), Gaps = 41/236 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
            +Y I EIF TLQGEG   G  +VF R  GC +            C +CDT     +   
Sbjct: 1   MIYPINEIFQTLQGEGVFTGVPSVFVRLQGCPV-----------GCSWCDTKHTWEKDAD 49

Query: 62  GGRYNVDQLADL-------------IEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
             +   + L                +   +       R+ V+TGGEP L    PL + L 
Sbjct: 50  KQQVMENILLKTRDSDLWGVATAKQLINIFTRQGYSARHIVITGGEPCLYDLRPLTETLE 109

Query: 109 KRGFEIAVETNGTIE-PPQGIDWICVSPKA-------GCDLKIKGGQELKLVF---PQVN 157
           + G++  +ET+GT         W+ VSPK             +K   E+K        + 
Sbjct: 110 REGYQCQIETSGTHSIQCSDKTWVTVSPKVKMRGGYKVLPEAMKRADEIKHPVGRERDIE 169

Query: 158 VSPENYIGFDFE---RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              E  +  D +     +LQP+     EE T L I  C     WR S+QTHK++ I
Sbjct: 170 ALDELLVMLDGKSSPVIALQPISQK--EEATRLCIETCIAR-NWRFSMQTHKYLHI 222


>gi|325103801|ref|YP_004273455.1| Radical SAM domain protein [Pedobacter saltans DSM 12145]
 gi|324972649|gb|ADY51633.1| Radical SAM domain protein [Pedobacter saltans DSM 12145]
          Length = 207

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 58/216 (26%), Positives = 94/216 (43%), Gaps = 26/216 (12%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
            +  + E F T+QGEG + G+ A F R  GC++            C +CD      +   
Sbjct: 10  SMLPLMEEFYTIQGEGFNTGKAAYFIRLGGCDV-----------GCHWCDVK----ESWD 54

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
              + +     ++E      +  G+  V+TGGEPLL     L   L ++G    +ET+G 
Sbjct: 55  AELHPLTSADKIVEN---AEKYPGKAVVITGGEPLLYNLDYLTAKLKEKGILTFIETSGA 111

Query: 122 IEPPQGIDWICVSP---KAGCDLKIKGGQELKLVFPQVNVSPENYIGF----DFERFSLQ 174
                  DW+C+SP   K+      +   ELK++    +             D  +  LQ
Sbjct: 112 YPISGSWDWVCLSPKKFKSPSPNIAQHADELKIIVFNKSDFEWAEAHARTVGDKCKLYLQ 171

Query: 175 PMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           P +    ++   L I Y  +NPKW +S+QTHK++ I
Sbjct: 172 P-EWSKSQDMLPLIIEYVKENPKWEISLQTHKYLNI 206


>gi|33866959|ref|NP_898518.1| organic radical activating protein [Synechococcus sp. WH 8102]
 gi|33639560|emb|CAE08944.1| possible organic radical activating enzyme [Synechococcus sp. WH
           8102]
          Length = 206

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 64/217 (29%), Positives = 89/217 (41%), Gaps = 25/217 (11%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              + E F +LQGEG H+GR A F R +GCN+            C +CDT          
Sbjct: 7   TLPVVETFHSLQGEGHHSGRSAFFIRLAGCNV-----------GCPWCDTKH----SWPV 51

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKR-GFEIAVETNGT 121
             +    L  L  +          + V+TGGEPL      L  AL +     + +ET+G 
Sbjct: 52  NTHPQRSLRALAADVEQAERNGAAFTVITGGEPLQHNLDGLASALREASSHPLHLETSGV 111

Query: 122 IEPPQGIDWICVSPKAGCDLKIK---GGQELKLVFPQVNVSPENYIGFDF----ERFSLQ 174
                  DWI +SPK     + +      ELK+V    +                   LQ
Sbjct: 112 DGLSGDPDWITLSPKPHRPPRQELLSHCDELKVVIHTADDLLFAESMAAAVSKQTVLLLQ 171

Query: 175 PMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           P  G    E   LAI +    P+WRLS+QTHK++G+R
Sbjct: 172 P--GWDSSEGQRLAIDHVQNQPRWRLSLQTHKWLGVR 206


>gi|145298762|ref|YP_001141603.1| radical activating enzyme [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|142851534|gb|ABO89855.1| radical activating enzyme [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 250

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 63/240 (26%), Positives = 95/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I EIF T+QGEG   G  A+F R  GC +            C +CDT    I    
Sbjct: 28  MHYPINEIFQTIQGEGIFTGLPAIFVRLQGCPV-----------GCPWCDTRHTWIVDPA 76

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +     + + DQ+    ++       + R+ V+TGGEP L     L 
Sbjct: 77  REVGVQAVLDCSNESDSWSKMSTDQILASFQQLG----YQARHVVITGGEPCLYDLHELS 132

Query: 105 QALNKRGFEIAVETNGTIEPPQGI-DWICVSPKAGCD-------LKIKGGQELKL----- 151
             L   G+++ +ET+GT E       W+ VSPK G           ++   E+K      
Sbjct: 133 TVLLAAGYQVQIETSGTSEIKTHDSTWVTVSPKIGMKGGLPVLVSALERANEIKHPVATE 192

Query: 152 -VFPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               +++              +LQP+        T LA++ C     WRLS+QTHK++ I
Sbjct: 193 RHIEELDALLATATLRPDVEIALQPISQK--PRATQLAMAVCIAR-NWRLSIQTHKYLDI 249


>gi|127512989|ref|YP_001094186.1| radical SAM domain-containing protein [Shewanella loihica PV-4]
 gi|126638284|gb|ABO23927.1| Radical SAM domain protein [Shewanella loihica PV-4]
          Length = 222

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 60/236 (25%), Positives = 95/236 (40%), Gaps = 42/236 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y + E+F T+QGEG + G  A+F R  GC +            C +CDT        +
Sbjct: 1   MKYPVNEVFETIQGEGVYTGVPAIFVRLQGCPV-----------GCSWCDTKHTWETLAE 49

Query: 62  G--------------GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
                          GR+      +L+    + G    ++ V+TGGEP +   + L QA 
Sbjct: 50  NRVSSEQVIQVDGAIGRWAELDARELLMHFKVQG-FSAKHVVITGGEPCIYDLIALTQAF 108

Query: 108 NKRGFEIAVETNGTIEPPQGID-WICVSPKAGC-------DLKIKGGQELKLVFPQVNVS 159
              G +  +ET+GT +       W+ VSPK          +  ++   E+K    + +  
Sbjct: 109 ADAGMQCQIETSGTFDVLVDPRAWVTVSPKINMKGGYKVLEQALERADEIKHPVAKASHI 168

Query: 160 PENYIGFD-----FERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E            +   LQP+        T LA+  C +   WRLS+QTHK++ I
Sbjct: 169 EELDELLKGIDTLGKTICLQPISQK--PRATELAMKVCIER-NWRLSIQTHKYLNI 221


>gi|308050954|ref|YP_003914520.1| hypothetical protein Fbal_3247 [Ferrimonas balearica DSM 9799]
 gi|307633144|gb|ADN77446.1| conserved hypothetical protein [Ferrimonas balearica DSM 9799]
          Length = 224

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 65/232 (28%), Positives = 88/232 (37%), Gaps = 39/232 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y + E+F T+QGEG H G  A+F R  GC +            C +CDT           
Sbjct: 6   YPVNELFETIQGEGVHTGVPAIFLRLQGCPV-----------GCSWCDTKHTWDLQENRK 54

Query: 64  RYNVDQLADLIEEQWI------------TGEKEGRYCVLTGGEPLLQVDVPLIQALNKRG 111
               D L    E                       + V+TGGEP +    PL +     G
Sbjct: 55  VMLSDVLVKTEESVMWCSVGPREILDLCMSRYTATHLVITGGEPCMYDLQPLCEVFEAEG 114

Query: 112 FEIAVETNGTIE-PPQGIDWICVSPK-------AGCDLKIKGGQELKLVFPQVNVSPENY 163
           + I VET+GT         W+ VSPK       +     I    E+K     V    +  
Sbjct: 115 YSIQVETSGTYPVMVSDSAWVTVSPKIKMRGGLSVLASAIDRADEIKHPVATVKDIEQLD 174

Query: 164 IGF-----DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                      + +LQP+      + T LAI  C +   WRLSVQTHK++GI
Sbjct: 175 ELLTGSAGADAKVALQPISQK--PKATELAIRTCIKR-NWRLSVQTHKYLGI 223


>gi|326800682|ref|YP_004318501.1| radical SAM protein [Sphingobacterium sp. 21]
 gi|326551446|gb|ADZ79831.1| Radical SAM domain protein [Sphingobacterium sp. 21]
          Length = 230

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 63/216 (29%), Positives = 95/216 (43%), Gaps = 26/216 (12%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
            L  + E F T+QGEG H G+ A F R  GC++            C +CD      +   
Sbjct: 33  TLLPLMEEFYTIQGEGYHTGKAAYFIRLGGCDV-----------GCHWCDVK----ESWD 77

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
              + + +  D+I           +  V+TGGEPL+     L + L   G +  +ET+G 
Sbjct: 78  AELHPLTKADDIIRN---AARYPAKTVVITGGEPLIYNLDYLTRGLQDAGIKTFIETSGA 134

Query: 122 IEPPQGIDWICVSP---KAGCDLKIKGGQELK-LVFPQVNVSPENYIGFDFE---RFSLQ 174
                  DW+C+SP   KA     I+   ELK +VF + +               +  LQ
Sbjct: 135 YPLSGHWDWVCLSPKKFKAPLPDVIEAAGELKVIVFNKSDFEWAERYAAQIPVGRKLYLQ 194

Query: 175 PMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           P +     + T L I Y  +NPKW +S+QTHK++ I
Sbjct: 195 P-EWSKAAQMTPLIIDYVKENPKWEISLQTHKYLNI 229


>gi|89073954|ref|ZP_01160460.1| putative organic radical activating enzyme [Photobacterium sp.
           SKA34]
 gi|89050282|gb|EAR55786.1| putative organic radical activating enzyme [Photobacterium sp.
           SKA34]
          Length = 222

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 64/236 (27%), Positives = 93/236 (39%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y I E+F T+QGEG   G  A+F R   C +            C +CDT          
Sbjct: 1   MYKINEVFETIQGEGVFTGVPAIFVRLQVCPV-----------GCSWCDTKQTWT-AEPQ 48

Query: 63  GRYNVDQLADL--------------IEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
              N+DQ+                 + +     +   ++ V+TGGEP +    PL QAL 
Sbjct: 49  DLANLDQIMAKTGDSPLWTNLDANGVVQLLQDQKYTAKHVVITGGEPCIYDLRPLTQALE 108

Query: 109 KRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKLV------FP 154
             GF   +ET+GT +       W+ VSPK     K+           E+K          
Sbjct: 109 DAGFNCQIETSGTSDIQTSENTWVTVSPKINMKAKLPVLVSSLARANEIKHPVGTSKDIE 168

Query: 155 QVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           Q++   +          +LQP+        T L I  C Q   WRLS+QTHK++ I
Sbjct: 169 QLDALIDGVTLKPDVTIALQPISQK--PRATELCIETCIQR-NWRLSIQTHKYLAI 221


>gi|146312870|ref|YP_001177944.1| radical SAM domain-containing protein [Enterobacter sp. 638]
 gi|145319746|gb|ABP61893.1| Radical SAM domain protein [Enterobacter sp. 638]
          Length = 223

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 65/240 (27%), Positives = 92/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDKLAD 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q  T     R+ V+TGGEP +   + L 
Sbjct: 50  REVSLFSILAKTKESDKWGAGSAEDLLAIIGRQGWT----ARHVVITGGEPCIHDLMSLT 105

Query: 105 QALNKRGFEIAVETNGTIEPPQGID-WICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K G+   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 DLLEKNGYSCQIETSGTHEVRCSHTAWVTVSPKVNMRGGYDVLSQALERADEIKHPVGRM 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALDELLATLTDEKQRIIALQPISQKD--DATRLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|238797157|ref|ZP_04640659.1| hypothetical protein ymoll0001_8670 [Yersinia mollaretii ATCC
           43969]
 gi|238719004|gb|EEQ10818.1| hypothetical protein ymoll0001_8670 [Yersinia mollaretii ATCC
           43969]
          Length = 229

 Score =  191 bits (486), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 66/241 (27%), Positives = 92/241 (38%), Gaps = 49/241 (20%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI--- 57
           + LY I E+F TLQGEG   G  A+F R  GC +            C +CDT        
Sbjct: 6   LMLYPINEMFQTLQGEGYFTGVPAIFVRLQGCPV-----------GCSWCDTKHTWEKEA 54

Query: 58  --------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL 103
                         +    G     QL D+  +Q        R+ V+TGGEP +    PL
Sbjct: 55  DREVDMQRIMVKTAESDAWGSATEQQLLDIFSQQG----YTARHVVITGGEPSIYDLRPL 110

Query: 104 IQALNKRGFEIAVETNGTIEPPQG-IDWICVSPKAGC-------DLKIKGGQELKLV--- 152
              L + G+   +ET+GT E       W+ VSPK             ++   E+K     
Sbjct: 111 TSLLEQGGYSCQIETSGTHEVQCSATTWVTVSPKVNMRGGLKVLPQALQRADEIKHPVGR 170

Query: 153 ---FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIG 209
                 +               +LQP+     E+ T L I  C     WRLS+QTHK++ 
Sbjct: 171 LRDIEALEALLATLHDDKKRIIALQPISQK--EDATKLCIETCIAK-NWRLSMQTHKYLN 227

Query: 210 I 210
           I
Sbjct: 228 I 228


>gi|59713678|ref|YP_206453.1| hypothetical protein VF_A0495 [Vibrio fischeri ES114]
 gi|59481926|gb|AAW87565.1| conserved protein [Vibrio fischeri ES114]
          Length = 226

 Score =  191 bits (486), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 60/236 (25%), Positives = 91/236 (38%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           L+ I E+F T+QGEG   G  ++F R  GC +            C +CDT          
Sbjct: 5   LFKINELFETIQGEGTFTGVPSIFLRLQGCPV-----------GCSWCDTKQTW-DVELS 52

Query: 63  GRYNVDQLADL--------------IEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
            + ++  +                 I E         ++ V+TGGEP +     L Q L 
Sbjct: 53  DKTDLQTILAKTEDTPSWTELSSTQIIEMLENQGYTAKHMVITGGEPCMYDLTSLTQELE 112

Query: 109 KRGFEIAVETNGTIEPPQ-GIDWICVSPKAGCDLKIK-------GGQELKLV------FP 154
           + G+   +ET+GT         W+ VSPK     K+           E+K          
Sbjct: 113 QHGYRCQIETSGTYPILASDDTWVTVSPKINMKGKLPVLPVALSRANEIKHPVGTTKDIE 172

Query: 155 QVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           Q++   E     +    +LQP+        T L I  C +   WRLS+QTHK++ I
Sbjct: 173 QLDALLEGVELLEDVTIALQPISQK--PRATELCIETCIKR-NWRLSIQTHKYLAI 225


>gi|221135470|ref|ZP_03561773.1| organic radical activating protein [Glaciecola sp. HTCC2999]
          Length = 227

 Score =  191 bits (486), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 65/235 (27%), Positives = 95/235 (40%), Gaps = 43/235 (18%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------- 56
           Y I EIF ++QGEG + G  ++F R  GC +            C +CDT           
Sbjct: 7   YPINEIFESIQGEGSYTGVPSIFIRLQGCPV-----------GCPWCDTQHTWKVDTDDQ 55

Query: 57  -------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNK 109
                   +      + +  +  L+ E  I G    ++ V+TGGEP +   VPL + L  
Sbjct: 56  IPVVQLREKSADAPTHALMNVTALLHEYEIRG-YLAKHVVITGGEPAMHDLVPLTEVLLS 114

Query: 110 RGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKLVFPQVNVSPE 161
           +GF + +ET+GT         ++ VSPK     K            E+K          E
Sbjct: 115 KGFSVQIETSGTFALRCADDVYVTVSPKIDMPGKYPILPEVMARANEIKHAVAMQKHVDE 174

Query: 162 NYIGFDFER------FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             +  +           LQP+        T LA+  C +   WRLS+QTHKFIGI
Sbjct: 175 LKLLLERAPIQTNTLIYLQPISQ--QARATQLAVETCIK-ENWRLSLQTHKFIGI 226


>gi|261210910|ref|ZP_05925200.1| queuosine Biosynthesis QueE Radical SAM [Vibrio sp. RC341]
 gi|260839885|gb|EEX66485.1| queuosine Biosynthesis QueE Radical SAM [Vibrio sp. RC341]
          Length = 222

 Score =  191 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 62/236 (26%), Positives = 94/236 (39%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI----- 57
           +Y I E+F T+QGEG   G  AVF R  GC +            C +CDT          
Sbjct: 1   MYRINEMFETIQGEGVFTGVPAVFVRLQGCPV-----------GCAWCDTKQTWESLDAD 49

Query: 58  ---------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                    + +    +      D+++     G  + ++ V+TGGEP +     L QA  
Sbjct: 50  QTSFSQILLKTSDAPTWCHASAQDVVQRYQTQG-YQAKHIVITGGEPCIYDLTELTQAFE 108

Query: 109 KRGFEIAVETNGTIEPPQGI-DWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVS 159
             G    +ET+GT E       W+ VSPK     K+           E+K  V  + ++ 
Sbjct: 109 SIGCHCQIETSGTYEVRATPLTWVTVSPKVAMKGKLPILDSALQRANEIKHPVATEKDID 168

Query: 160 PENYIGFDFE-----RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             + +    +       +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 169 NLDELLVRAKVTEKTVVALQPISQK--PRATELCIRTCIAR-NWRLSIQTHKYLNI 221


>gi|315607677|ref|ZP_07882671.1| GntS protein [Prevotella buccae ATCC 33574]
 gi|315250613|gb|EFU30608.1| GntS protein [Prevotella buccae ATCC 33574]
          Length = 210

 Score =  191 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 89/226 (39%), Positives = 113/226 (50%), Gaps = 35/226 (15%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           MK Y I EIF +LQGEG + GR AVF RFSGCNL            C FCDTDF      
Sbjct: 5   MKRYRINEIFYSLQGEGRNTGRAAVFVRFSGCNL-----------ACSFCDTDFRAY--- 50

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRY-----------CVLTGGEPLLQVDVPLIQALNK 109
                  D++ + ++    +                   VLTGGEP LQVD  LI AL+ 
Sbjct: 51  --REMTSDEVVNTVKGILPSFVDNRSGEGVGTARSSVLVVLTGGEPTLQVDFDLIDALHH 108

Query: 110 RGF-EIAVETNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDF 168
            GF E+A+E+NGT EPP  +DW+ VSPK    +      ELK +F +   + +  I  DF
Sbjct: 109 AGFPEVAMESNGTKEPPPNLDWLTVSPKEQVSVN--RCNELKCLFDESGRADDCGIRADF 166

Query: 169 ERFSLQPM---DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             + LQP    D     E       Y  Q+PKW+LS+QTHK IG +
Sbjct: 167 --YYLQPCDTGDPVRNAEIIAACTEYIKQHPKWQLSLQTHKLIGFK 210


>gi|291086244|ref|ZP_06355196.2| radical SAM domain protein [Citrobacter youngae ATCC 29220]
 gi|291068637|gb|EFE06746.1| radical SAM domain protein [Citrobacter youngae ATCC 29220]
          Length = 242

 Score =  191 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 94/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 20  MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDKLED 68

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I+ Q        R+ V+TGGEP +   +PL 
Sbjct: 69  REVSLYSILAKTKESDKWGAASSEDLLAVIQRQG----YTARHVVITGGEPCIHDLMPLT 124

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L K GF   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 125 DLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKVNMRGGYDVLSQALERANEIKHPVGRV 184

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                ++              +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 185 RDIEALDELLATLSDDKPRIIALQPISQK--EDATRLCIDTCIA-CNWRLSMQTHKYLNI 241


>gi|88859840|ref|ZP_01134479.1| queC protein [Pseudoalteromonas tunicata D2]
 gi|88817834|gb|EAR27650.1| queC protein [Pseudoalteromonas tunicata D2]
          Length = 221

 Score =  191 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 62/234 (26%), Positives = 90/234 (38%), Gaps = 40/234 (17%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------ 56
           +Y I EIF T+QGE    G  ++F R  GC +            C +CDT          
Sbjct: 1   MYKINEIFETIQGEASFTGMPSIFVRLQGCPV-----------GCAWCDTKQTWETSDTY 49

Query: 57  -------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNK 109
                  ++         D     +   ++    + ++ V+TGGEP +   VPL + L+ 
Sbjct: 50  KVDLQKTVEKKADSELWADVTVAQLLALFVEKGYQAKHIVITGGEPCMYDLVPLCEGLHA 109

Query: 110 RGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQVNVSPE 161
            G+   VET+GT E       W+ VSPK             ++   E+K          E
Sbjct: 110 AGYGTQVETSGTFEIKVPAETWVTVSPKINMRGGYAVLKSAMQRANEIKHPIAMQRHVDE 169

Query: 162 NYIGFDFE-----RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                           LQP+      + T LAI  C     WRLSVQ HK++GI
Sbjct: 170 LEQLMAECGVTPKLIYLQPISQK--AKATQLAIEVCKAK-NWRLSVQVHKYLGI 220


>gi|90579565|ref|ZP_01235374.1| putative organic radical activating enzyme [Vibrio angustum S14]
 gi|90439139|gb|EAS64321.1| putative organic radical activating enzyme [Vibrio angustum S14]
          Length = 222

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 64/236 (27%), Positives = 94/236 (39%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y I E+F T+QGEG   G  A+F R   C +            C +CDT          
Sbjct: 1   MYKINEVFETIQGEGVFTGVPAIFVRLQVCPV-----------GCSWCDTKQTWT-AEPQ 48

Query: 63  GRYNVDQLADL--------------IEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
              ++DQ+                 + +     +   ++ V+TGGEP +    PL QAL 
Sbjct: 49  DLVSLDQIMAKTGDSPLWTNLDANGVVQLLQDQKYTAKHVVITGGEPCIYDLRPLTQALE 108

Query: 109 KRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKLV------FP 154
           + GF   +ET+GT E       W+ VSPK     K+           E+K          
Sbjct: 109 EAGFNCQIETSGTSEIQTSDNTWVTVSPKINMKAKLPVLASSLARANEIKHPVGTSKDIE 168

Query: 155 QVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           Q++   +          +LQP+        T L I  C Q   WRLS+QTHK++ I
Sbjct: 169 QLDALIDGVTLKPDVTIALQPISQKT--RATELCIETCIQR-NWRLSIQTHKYLAI 221


>gi|153212696|ref|ZP_01948353.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|124116346|gb|EAY35166.1| conserved hypothetical protein [Vibrio cholerae 1587]
          Length = 245

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 61/236 (25%), Positives = 93/236 (39%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI----- 57
           LY I E+F T+QGEG   G  AVF R  GC +            C +CDT          
Sbjct: 24  LYRINEMFETIQGEGVFTGVPAVFVRLQGCPV-----------GCAWCDTKQTWETLDSD 72

Query: 58  ---------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                    + +    +      ++++        + ++ V+TGGEP +     L QA  
Sbjct: 73  QTSFSQILLKTSDAPTWCQASAQEVVQRY-QAQGYQAKHIVITGGEPCIYDLTELTQAFE 131

Query: 109 KRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVS 159
             G    +ET+GT E       W+ VSPK     K+           E+K  V  + ++ 
Sbjct: 132 AMGCRCQIETSGTYEVYATENTWVTVSPKVAMKGKLPILDSALQRANEIKHPVATEKDID 191

Query: 160 PENYIGFDFER-----FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             + +    +       +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 192 NLDELLARAQVSAQTAIALQPISQK--PRATELCIRTCIAR-NWRLSIQTHKYLNI 244


>gi|197337552|ref|YP_002158091.1| queuosine biosynthesis protein QueE [Vibrio fischeri MJ11]
 gi|197314804|gb|ACH64253.1| queuosine biosynthesis protein QueE [Vibrio fischeri MJ11]
          Length = 226

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 60/236 (25%), Positives = 91/236 (38%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           L+ I E+F T+QGEG   G  ++F R  GC +            C +CDT          
Sbjct: 5   LFKINELFETIQGEGTFTGVPSIFLRLQGCPV-----------GCSWCDTKQTW-DVELS 52

Query: 63  GRYNVDQLADL--------------IEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
            + ++  +                 I E         ++ V+TGGEP +     L Q L 
Sbjct: 53  DKTDLQTILAKTEDTPSWTELSSTQIIEMLENQGYTAKHMVITGGEPCMYDLTSLTQELE 112

Query: 109 KRGFEIAVETNGTIEPPQ-GIDWICVSPKAGCDLKIK-------GGQELKLV------FP 154
           + G+   +ET+GT         W+ VSPK     K+           E+K          
Sbjct: 113 QHGYRCQIETSGTYPILASENTWVTVSPKINMKGKLPVLPVALSRANEIKHPVGTTKDIE 172

Query: 155 QVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           Q++   E     +    +LQP+        T L I  C +   WRLS+QTHK++ I
Sbjct: 173 QLDALLEGVELLEDVTIALQPISQK--PRATELCIETCIKR-NWRLSIQTHKYLAI 225


>gi|260768533|ref|ZP_05877467.1| queuosine Biosynthesis QueE Radical SAM [Vibrio furnissii CIP
           102972]
 gi|260616563|gb|EEX41748.1| queuosine Biosynthesis QueE Radical SAM [Vibrio furnissii CIP
           102972]
          Length = 246

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 64/237 (27%), Positives = 93/237 (39%), Gaps = 43/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
            LY + E+F T+QGEG   G  AVF R   C +            C +CDT         
Sbjct: 24  TLYKVNEMFETIQGEGVFTGVPAVFVRLQECPV-----------GCAWCDTKQTW-DAAP 71

Query: 62  GGRYNVDQL--------------ADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
               + D++              A  I E++       ++ V+TGGEP +   VPL QA 
Sbjct: 72  ADERSFDEILVKTEDNPNWCSASAQQIIERYRAQGYTAKHIVITGGEPCIYDLVPLTQAF 131

Query: 108 NKRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNV 158
              G    +ET+GT         W+ VSPK     K+           E+K  V  + ++
Sbjct: 132 EAIGCRCQIETSGTFAVQATENTWVTVSPKVAMKGKLPVVDVALQRANEIKHPVATEKDI 191

Query: 159 SPENYIGFDF-----ERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              + +            +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 192 DNLDQLLARAGVPATTVVALQPISQK--PRATQLCIDTCIAR-NWRLSIQTHKYLSI 245


>gi|288924671|ref|ZP_06418608.1| radical SAM [Prevotella buccae D17]
 gi|288338458|gb|EFC76807.1| radical SAM [Prevotella buccae D17]
          Length = 206

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 89/226 (39%), Positives = 113/226 (50%), Gaps = 35/226 (15%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           MK Y I EIF +LQGEG + GR AVF RFSGCNL            C FCDTDF      
Sbjct: 1   MKRYRINEIFYSLQGEGRNTGRAAVFVRFSGCNL-----------ACSFCDTDFRAY--- 46

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRY-----------CVLTGGEPLLQVDVPLIQALNK 109
                  D++ + ++    +                   VLTGGEP LQVD  LI AL+ 
Sbjct: 47  --REMTSDEVVNTVKGILPSFVDNRSGEGVGTARSSVLVVLTGGEPTLQVDFDLIDALHH 104

Query: 110 RGF-EIAVETNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDF 168
            GF E+A+E+NGT EPP  +DW+ VSPK    +      ELK +F +   + +  I  DF
Sbjct: 105 AGFPEVAMESNGTKEPPPNLDWLTVSPKEQVSVN--RCNELKCLFDESGRADDCGIRADF 162

Query: 169 ERFSLQPM---DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             + LQP    D     E       Y  Q+PKW+LS+QTHK IG +
Sbjct: 163 --YYLQPCDTGDPVRNAEIIAACTEYIKQHPKWQLSLQTHKLIGFK 206


>gi|85711961|ref|ZP_01043015.1| Organic radical activating enzyme [Idiomarina baltica OS145]
 gi|85694147|gb|EAQ32091.1| Organic radical activating enzyme [Idiomarina baltica OS145]
          Length = 223

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 60/237 (25%), Positives = 87/237 (36%), Gaps = 43/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I EIF TLQGEG   G  ++F R  GC +            C +CDT         
Sbjct: 1   MTYRINEIFETLQGEGTFTGVPSIFIRLQGCPV-----------GCPWCDTQHTWDVKQE 49

Query: 58  ----------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
                     +      +     AD++ E         ++ V+TGGEP +     L + L
Sbjct: 50  DQVSVATMMAKSEATSEWAEMSSADIV-ELIKQRGYRAKHVVITGGEPAMYDLRELGEVL 108

Query: 108 NKRGFEIAVETNGTIE-PPQGIDWICVSPKAGCD-------LKIKGGQELKLVFPQVNVS 159
             +G  + +ET+GT E       W+ VSPK             +    E+K         
Sbjct: 109 EAQGMRLQIETSGTYELLITAGTWVTVSPKLDMPGGYLVRSDCLSRADEIKHPIAMQKHI 168

Query: 160 PENYIGFDFER------FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                    ++        LQP+        T LA+  C +   WRLSVQ HK++ I
Sbjct: 169 DALDRLLQGQKLKSDVVICLQPISQ--RPRATELAMKTCIER-NWRLSVQMHKYLNI 222


>gi|153825305|ref|ZP_01977972.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|183179363|ref|ZP_02957574.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|149741133|gb|EDM55192.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|183012774|gb|EDT88074.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
          Length = 245

 Score =  190 bits (484), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 61/236 (25%), Positives = 93/236 (39%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI----- 57
           LY I E+F T+QGEG   G  AVF R  GC +            C +CDT          
Sbjct: 24  LYRINEMFETIQGEGVFTGVPAVFVRLQGCPV-----------GCAWCDTKQTWETLDSD 72

Query: 58  ---------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                    + +    +      ++++        + ++ V+TGGEP +     L QA  
Sbjct: 73  QTSFSQILLKTSDAPTWCQASAQEVVQRY-QAQGYQAKHIVITGGEPCIYDLTELTQAFE 131

Query: 109 KRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVS 159
             G    +ET+GT E       W+ VSPK     K+           E+K  V  + ++ 
Sbjct: 132 AMGCRCQIETSGTYEVRATENTWVTVSPKVAMKGKLPILDSALQRANEIKHPVATEKDID 191

Query: 160 PENYIGFDFER-----FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             + +    +       +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 192 NLDELLARAQVSAQTAIALQPISQK--PRATELCIRTCIAR-NWRLSIQTHKYLNI 244


>gi|126662368|ref|ZP_01733367.1| hypothetical protein FBBAL38_03415 [Flavobacteria bacterium BAL38]
 gi|126625747|gb|EAZ96436.1| hypothetical protein FBBAL38_03415 [Flavobacteria bacterium BAL38]
          Length = 210

 Score =  190 bits (484), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 60/215 (27%), Positives = 88/215 (40%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + E F T+QGEG H G  A F R  GC++            C +CD      +    
Sbjct: 15  MLPLMEEFYTIQGEGYHTGTAAYFIRIGGCDV-----------GCHWCDVK----ESWNA 59

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             +       ++       +K     V+TGGEPL      L   L ++   + +ET+G  
Sbjct: 60  ELHPPTNTDIIV----SNAKKYADTVVVTGGEPLTWDMTLLTSKLKEQNLRVHIETSGAY 115

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQ---ELKLVF---PQVNVSPENYIGFDFERF-SLQP 175
           E     DW C+SPK              ELK++         + E     +      LQP
Sbjct: 116 EVTGTWDWFCLSPKKNKLPVQSAYDIANELKVIIYNKHDFIFAEEQAAKVNPNAILFLQP 175

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +    EE T L + Y   NPKWR+S+QTHK++ I
Sbjct: 176 -EWSKKEEMTPLIVDYVMNNPKWRVSLQTHKYLNI 209


>gi|328950182|ref|YP_004367517.1| Radical SAM domain protein [Marinithermus hydrothermalis DSM 14884]
 gi|328450506|gb|AEB11407.1| Radical SAM domain protein [Marinithermus hydrothermalis DSM 14884]
          Length = 199

 Score =  190 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 64/219 (29%), Positives = 95/219 (43%), Gaps = 28/219 (12%)

Query: 1   MKL-YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+  Y + E F ++QGEG   G  A F R +GC++            C FCDT       
Sbjct: 1   MRKGYPVVETFHSVQGEGHWTGTSAFFIRLAGCDV-----------GCWFCDTKESW-DM 48

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
           ++    +VD L    +             V+TGGEPL+    PL +AL   G    +ET+
Sbjct: 49  SQHPWRSVDALVAEAQAASPA------IVVVTGGEPLMHDLTPLSRALRAAGLRAHLETS 102

Query: 120 GTIEPPQGIDWICVSPK---AGCDLKIKGGQELK-LVFPQVNVSPENYIGFDFERF---S 172
           G        DW+ +SPK              ELK +V  Q +++                
Sbjct: 103 GAHPFSGAWDWVTLSPKKFRPPHPSVYPHVHELKVVVVNQSDLAWAETHAARVPPTALKY 162

Query: 173 LQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           LQP      E++  L + Y  Q+P+WR+S+QTHK +G+R
Sbjct: 163 LQPEWS--TEKSRQLILEYVLQHPEWRVSLQTHKVLGVR 199


>gi|297578950|ref|ZP_06940878.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297536544|gb|EFH75377.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 245

 Score =  190 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 61/236 (25%), Positives = 93/236 (39%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI----- 57
           LY I E+F T+QGEG   G  AVF R  GC +            C +CDT          
Sbjct: 24  LYRINEMFETIQGEGVFTGVPAVFVRLQGCPV-----------GCAWCDTKQTWETLDSD 72

Query: 58  ---------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                    + +    +      ++++        + ++ V+TGGEP +     L QA  
Sbjct: 73  QTSFSQILLKTSDAPTWCQATAQEVVQRY-QAQGYQAKHIVITGGEPCIYDLTELTQAFE 131

Query: 109 KRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVS 159
             G    +ET+GT E       W+ VSPK     K+           E+K  V  + ++ 
Sbjct: 132 AIGCRCQIETSGTYEVCATDNTWVTVSPKVAMKGKLPILDSALQRANEIKHPVATEKDID 191

Query: 160 PENYIGFDFER-----FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             + +    +       +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 192 NLDELLARAQVSAQTAIALQPISQK--PRATELCIRTCIAR-NWRLSIQTHKYLNI 244


>gi|121587998|ref|ZP_01677750.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|153828785|ref|ZP_01981452.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|229515737|ref|ZP_04405196.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae TMA 21]
 gi|229521471|ref|ZP_04410890.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae TM
           11079-80]
 gi|229529559|ref|ZP_04418949.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae 12129(1)]
 gi|121547739|gb|EAX57830.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|148875738|gb|EDL73873.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|229333333|gb|EEN98819.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae 12129(1)]
 gi|229341569|gb|EEO06572.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae TM
           11079-80]
 gi|229347506|gb|EEO12466.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae TMA 21]
          Length = 245

 Score =  190 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 61/236 (25%), Positives = 93/236 (39%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI----- 57
           LY I E+F T+QGEG   G  AVF R  GC +            C +CDT          
Sbjct: 24  LYRINEMFETIQGEGVFTGVPAVFVRLQGCPV-----------GCAWCDTKQTWETLDSD 72

Query: 58  ---------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                    + +    +      ++++        + ++ V+TGGEP +     L QA  
Sbjct: 73  QTSFSQILLKTSDAPTWCQASAQEVVQRY-QAQGYQAKHIVITGGEPCIYDLTELTQAFE 131

Query: 109 KRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVS 159
             G    +ET+GT E       W+ VSPK     K+           E+K  V  + ++ 
Sbjct: 132 AMGCRCQIETSGTYEVCATENTWVTVSPKVAMKGKLPILDSALQRANEIKHPVATEKDID 191

Query: 160 PENYIGFDFER-----FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             + +    +       +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 192 NLDELLARAQVSAQTAIALQPISQK--PRATELCIRTCIAR-NWRLSIQTHKYLNI 244


>gi|56750231|ref|YP_170932.1| hypothetical protein syc0222_c [Synechococcus elongatus PCC 6301]
 gi|81300141|ref|YP_400349.1| hypothetical protein Synpcc7942_1332 [Synechococcus elongatus PCC
           7942]
 gi|56685190|dbj|BAD78412.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gi|81169022|gb|ABB57362.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 206

 Score =  190 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 67/216 (31%), Positives = 100/216 (46%), Gaps = 27/216 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I E F ++QGEG   G  A F R +GC++            C +CDT     Q    
Sbjct: 11  TLPIVETFHSVQGEGAWMGCSAFFIRLAGCDV-----------GCPWCDTK----QSWPR 55

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
            R+    +ADL+E        + ++ V+TGGEPLL     L  AL  +G    +ET+G+ 
Sbjct: 56  DRHPEVAIADLVEAAVAA---QPQFVVITGGEPLLHDLTELTNALRSQGLRCHLETSGSA 112

Query: 123 EPPQGIDWICVSP---KAGCDLKIKGGQELKLVF---PQVNVSPENYIGFDFERF-SLQP 175
            P    DW+ +SP   KA          ELK+V       + + +  I         LQP
Sbjct: 113 SPSGSFDWVTLSPKPFKAVVAANYNWANELKVVIQTDADFDFAEQEAIAVPETTLKLLQP 172

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
                  E+ +  ++Y  Q+P+WR+S+QTHKF+G+R
Sbjct: 173 EWNS--PESCDRVVNYVRQHPRWRVSLQTHKFLGVR 206


>gi|229523533|ref|ZP_04412938.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae bv.
           albensis VL426]
 gi|254225344|ref|ZP_04918956.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|125622185|gb|EAZ50507.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|229337114|gb|EEO02131.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae bv.
           albensis VL426]
          Length = 245

 Score =  190 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 61/236 (25%), Positives = 93/236 (39%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI----- 57
           LY I E+F T+QGEG   G  AVF R  GC +            C +CDT          
Sbjct: 24  LYRINEMFETIQGEGVFTGVPAVFVRLQGCPV-----------GCAWCDTKQTWETLDSD 72

Query: 58  ---------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                    + +    +      ++++        + ++ V+TGGEP +     L QA  
Sbjct: 73  QTSFSQILLKTSDAPTWCQATAQEVVQRY-QAQGYQAKHIVITGGEPCIYDLTELTQAFE 131

Query: 109 KRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVS 159
             G    +ET+GT E       W+ VSPK     K+           E+K  V  + ++ 
Sbjct: 132 AMGCRCQIETSGTYEVCATENTWVTVSPKVAMKGKLPILDSALQRANEIKHPVATEKDID 191

Query: 160 PENYIGFDFER-----FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             + +    +       +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 192 NLDELLARAQVSAQTAIALQPISQK--PRATELCIRTCIAR-NWRLSIQTHKYLNI 244


>gi|218259962|ref|ZP_03475458.1| hypothetical protein PRABACTJOHN_01119 [Parabacteroides johnsonii
           DSM 18315]
 gi|218224823|gb|EEC97473.1| hypothetical protein PRABACTJOHN_01119 [Parabacteroides johnsonii
           DSM 18315]
          Length = 180

 Score =  190 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 77/208 (37%), Positives = 102/208 (49%), Gaps = 29/208 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGFHTGTPAVFVRFSGCNLK-----------CSFCDTRH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              + + +   I              +LTGGEP L +D   I  L+  G  I +ETNGT 
Sbjct: 45  ILMSDEDILQAISA------FPSNVVILTGGEPSLWIDQTFIDLLHMAGKYICIETNGTN 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P+GIDW+  SPK G  L++    E+K+V+   +++   Y G +     LQP       
Sbjct: 99  PLPEGIDWVTCSPK-GFPLRLAHIDEVKVVYTGQDLT--EYAGLEATWHFLQPCSC---- 151

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            NT   + Y   +P+WRLS+QTHK I I
Sbjct: 152 LNTKEVVEYILHHPQWRLSLQTHKLIDI 179


>gi|315180245|gb|ADT87159.1| Organic radical activating enzyme [Vibrio furnissii NCTC 11218]
          Length = 246

 Score =  190 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 64/237 (27%), Positives = 93/237 (39%), Gaps = 43/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
            LY + E+F T+QGEG   G  AVF R   C +            C +CDT         
Sbjct: 24  TLYKVNEMFETIQGEGVFTGVPAVFVRLQECPV-----------GCAWCDTKQTW-DAAP 71

Query: 62  GGRYNVDQL--------------ADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
               + D++              A  I E++       ++ V+TGGEP +   VPL QA 
Sbjct: 72  ADERSFDEILVKTEDNPNWCSASAQQIIERYRAQGYTAKHIVITGGEPCIYDLVPLTQAF 131

Query: 108 NKRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNV 158
              G    +ET+GT         W+ VSPK     K+           E+K  V  + ++
Sbjct: 132 EAIGCRCQIETSGTFAVQATENTWVTVSPKVAMKGKLPVVDVALQRANEIKHPVATEKDI 191

Query: 159 SPENYIGFDF-----ERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              + +            +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 192 DNLDQLLARAGVPETTVVALQPISQK--PRATQLCIDTCIAR-NWRLSIQTHKYLSI 245


>gi|300727783|ref|ZP_07061165.1| organic radical activating enzyme [Prevotella bryantii B14]
 gi|299774936|gb|EFI71546.1| organic radical activating enzyme [Prevotella bryantii B14]
          Length = 196

 Score =  190 bits (484), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 79/216 (36%), Positives = 110/216 (50%), Gaps = 27/216 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H GR A+F RFSGCNL            C FCDTDF        
Sbjct: 1   MKKINEIFYSLQGEGRHTGRAAIFIRFSGCNLK-----------CSFCDTDF-----KDY 44

Query: 63  GRYNVDQLADLIEEQ----WITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVET 118
              + + +   +EE          +     +LTGGEP +QVD   I   +  G+ +A+E+
Sbjct: 45  QEMSDEDILYKVEELRKDKIKDAGQPKPMIILTGGEPTMQVDGAFIDMFHAAGYFVAMES 104

Query: 119 NGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDG 178
           NGT EPP+ +DW+ VSPK    +      ELK +F   +    +  G     + LQP D 
Sbjct: 105 NGTKEPPKQLDWLTVSPKEHVKVAQ--CDELKCIFDGEHQV--DTFGIKAYYYYLQPCDT 160

Query: 179 PFLEENTNL---AISYCFQNPKWRLSVQTHKFIGIR 211
              ++N  +    ++Y  Q+PKWRLS+QTHK IG +
Sbjct: 161 GDAQKNQEILSACVAYIEQHPKWRLSLQTHKLIGFK 196


>gi|332173072|gb|AEE22326.1| Radical SAM domain protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 248

 Score =  190 bits (484), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 67/243 (27%), Positives = 95/243 (39%), Gaps = 51/243 (20%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG---- 56
           +  Y I E+F +LQGEG H G  ++F R  GC +            C +CDT        
Sbjct: 23  LNTYKINEVFESLQGEGAHTGVPSIFIRLQGCPV-----------GCPWCDTKHTWEIDL 71

Query: 57  -------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL 103
                        +   +   +   QL DL  +            +LTGGEP +     L
Sbjct: 72  NLKVEASVVMAQNVDTEQWFEHTPKQLLDLFTQHG----YTASNIILTGGEPCMYDLTDL 127

Query: 104 IQALNKRGFEIAVETNGTIEPPQGID-WICVSPKAGCDLKIK-------GGQELKL-VFP 154
              L + G+ + +ET+GT E     D W+ VSPK     K            E+K  V  
Sbjct: 128 SSVLIENGYSVQIETSGTYEIMAHPDTWVTVSPKVNMPGKRDVLKSALLRANEIKHPVAM 187

Query: 155 QVNVSPENYIGFDFE-------RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKF 207
           + ++   + +    E          LQP+     +  T L I  C     WRLS+QTHKF
Sbjct: 188 EKHIEELDQVLTLLEGSNTTKPLIYLQPISQ--QKRATELCIKTCIAR-NWRLSLQTHKF 244

Query: 208 IGI 210
           IGI
Sbjct: 245 IGI 247


>gi|86133041|ref|ZP_01051623.1| radical SAM superfamily protein [Polaribacter sp. MED152]
 gi|85819904|gb|EAQ41051.1| radical SAM superfamily protein [Polaribacter sp. MED152]
          Length = 210

 Score =  190 bits (484), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 59/215 (27%), Positives = 92/215 (42%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + E F T+QGEG H G  A F R  GC++            C +CD      +    
Sbjct: 15  MLPLMEEFYTIQGEGSHTGTAAYFIRVGGCDV-----------GCHWCDVK----ESWNA 59

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             +       +IE      +K     V+TGGEPL+     + + L K   +  +ET+G  
Sbjct: 60  DLHPPTMADSIIENV----KKYTDTVVITGGEPLMWSMDYITELLQKNNIKTHIETSGAY 115

Query: 123 EPPQGIDWICVSPKA---GCDLKIKGGQELKLVFPQV---NVSPENYIGF-DFERFSLQP 175
                 DW C+SPK          +   ELK++       + + E         +  LQP
Sbjct: 116 SFSGKWDWFCLSPKKTKLPLTENYREADELKMIIHNKSDFDFAEEQATKVGKKCQLFLQP 175

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +    E+ T L + Y  +NPKW++S+QTHK++ I
Sbjct: 176 -EWSKKEKMTELIVDYVMKNPKWKVSLQTHKYLNI 209


>gi|304413345|ref|ZP_07394818.1| radical SAM superfamily domain-containing hypothetical protein
           [Candidatus Regiella insecticola LSR1]
 gi|304284188|gb|EFL92581.1| radical SAM superfamily domain-containing hypothetical protein
           [Candidatus Regiella insecticola LSR1]
          Length = 265

 Score =  190 bits (483), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 68/236 (28%), Positives = 98/236 (41%), Gaps = 40/236 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG      A+F R  GC +            C +CDT           
Sbjct: 42  YPINEIFQSLQGEGYFTNVPAIFIRLQGCPV-----------ACSWCDTKHTWDIKKDKE 90

Query: 64  ---------RYNVDQLADLIEEQWIT---GEKEGRYCVLTGGEPLLQVDVPLIQALNKRG 111
                        D  ++  E+Q +     + + R+ V+TGGEP L    PL   L + G
Sbjct: 91  IDIQGITVKTVAKDTWSNANEQQLVAICKEKYQARHVVITGGEPCLYDLQPLTSLLEENG 150

Query: 112 FEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKL-VFPQVNVSPEN 162
           +   +ET+GT         W+ VSPK G        D  ++   E+K  V  + ++   N
Sbjct: 151 YRCQIETSGTHPVRCSTASWVTVSPKIGMKGGLKLLDQALQRADEIKHPVARERDIERLN 210

Query: 163 YIGFDFE-----RFSLQPM--DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            +            +LQP+       EE T L I  C ++  WRLSVQ HK++ IR
Sbjct: 211 NLLDKLNDGKKPVIALQPIRKTEKESEEATKLCIETCIKH-NWRLSVQMHKYLKIR 265


>gi|312129858|ref|YP_003997198.1| radical sam domain protein [Leadbetterella byssophila DSM 17132]
 gi|311906404|gb|ADQ16845.1| Radical SAM domain protein [Leadbetterella byssophila DSM 17132]
          Length = 202

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 62/214 (28%), Positives = 94/214 (43%), Gaps = 26/214 (12%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F TLQGEG H+G+ A F R  GC++            C +CD      +     
Sbjct: 7   LPVMESFYTLQGEGFHSGKAAYFIRLGGCDV-----------GCVWCDVK----ESWDAE 51

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIE 123
            +   ++ D++       E  GR  V+TGGEPL+     L   L ++GF+  +ET+G   
Sbjct: 52  AHPQFRVEDIVN---GALEYPGRLAVITGGEPLMYDLNELTAELKQKGFQTNIETSGAHP 108

Query: 124 PPQGIDWICVSP---KAGCDLKIKGGQELK-LVFPQVNVSPENYIGFDF---ERFSLQPM 176
                DWIC SP   KA  +       ELK +V+   +               +  LQ +
Sbjct: 109 LSGDWDWICFSPKKFKAPLEEFYAVANELKVIVYNSSDFDFAEIHAAKVNPDCKLFLQ-V 167

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +    E      + Y   NP+WR+S+QTHK++ I
Sbjct: 168 EWDRRERMMPSIVEYVKANPQWRVSIQTHKYMNI 201


>gi|238786213|ref|ZP_04630161.1| hypothetical protein yberc0001_11680 [Yersinia bercovieri ATCC
           43970]
 gi|238712877|gb|EEQ04941.1| hypothetical protein yberc0001_11680 [Yersinia bercovieri ATCC
           43970]
          Length = 223

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 64/236 (27%), Positives = 90/236 (38%), Gaps = 41/236 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
            LY I E+F TLQGEG   G  A+F R  GC +            C +CDT     +   
Sbjct: 1   MLYPINEMFQTLQGEGYFTGVPAIFVRLQGCPV-----------GCSWCDTKHTWEKEAD 49

Query: 62  GG---------RYNVDQLADLIEEQWIT----GEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                          D      E+Q +          R+ V+TGGEP +   +PL   L 
Sbjct: 50  REVDMQRIMVKTAESDAWGSASEQQLLAIFSQQGYTARHVVITGGEPAIYDLLPLTSVLE 109

Query: 109 KRGFEIAVETNGTIEPPQG-IDWICVSPKAGC-------DLKIKGGQELKLV------FP 154
           + G+   +ET+GT E       W+ VSPK             ++   E+K          
Sbjct: 110 QAGYSCQIETSGTHEVQCSAATWVTVSPKVKMRGGLKILPQALQRADEIKHPVGRLRDIE 169

Query: 155 QVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + V             +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 170 ALEVLLATLHDDKKRIIALQPISQKD--DATKLCIETCIAR-NWRLSMQTHKYLNI 222


>gi|121728537|ref|ZP_01681560.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|147675014|ref|YP_001216924.1| hypothetical protein VC0395_A0978 [Vibrio cholerae O395]
 gi|254286183|ref|ZP_04961143.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|121629201|gb|EAX61641.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|146316897|gb|ABQ21436.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|150423852|gb|EDN15793.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|227013282|gb|ACP09492.1| conserved hypothetical protein [Vibrio cholerae O395]
          Length = 245

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 63/235 (26%), Positives = 92/235 (39%), Gaps = 41/235 (17%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQ---- 58
           LY I E+F T+QGEG   G  AVF R  GC +            C +CDT          
Sbjct: 24  LYRINEMFETIQGEGVFTGVPAVFVRLQGCPV-----------GCAWCDTKQTWETLDSD 72

Query: 59  ---------GTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNK 109
                     T          A  + +++     + ++ V+TGGEP +     L QA   
Sbjct: 73  QTSFSQILLKTNDAPTWCQATAQEVVQRYQAQGYQAKHIVITGGEPCIYDLTELTQAFEA 132

Query: 110 RGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVSP 160
            G    +ET+GT E       W+ VSPK     K+           E+K  V  + ++  
Sbjct: 133 MGCRCQIETSGTYEVCATENTWVTVSPKVAMKGKLPILDSALQRANEIKHPVATEKDIDN 192

Query: 161 ENYIGFDFER-----FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + +    +       +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 193 LDELLARAQVSAQTAIALQPISQK--PRATELCIRTCIAR-NWRLSIQTHKYLNI 244


>gi|67924094|ref|ZP_00517541.1| Radical SAM [Crocosphaera watsonii WH 8501]
 gi|67854055|gb|EAM49367.1| Radical SAM [Crocosphaera watsonii WH 8501]
          Length = 213

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 65/216 (30%), Positives = 96/216 (44%), Gaps = 27/216 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            Y I E F +LQGEG   G  A F R +GC++            C +CD      +    
Sbjct: 18  TYPIVETFHSLQGEGTWTGVNAFFIRLAGCDV-----------HCPWCDQK----ESWTS 62

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
            +Y    +  L E   ++        V+TGGEPL+    PL +AL K G  + +ET+G+ 
Sbjct: 63  KKYPQQSIKILAE---VSKMANPFMVVITGGEPLMYDLFPLTKALKKLGLRVHLETSGSH 119

Query: 123 EPPQGIDWICVSPKA---GCDLKIKGGQELKLVFPQV---NVSPENYIGFDFERF-SLQP 175
                 DW+  SPK      +       ELK+V       + + E       E    LQP
Sbjct: 120 SFTGQFDWVTFSPKPFKLPHESIYSQVNELKIVIANQEDLHWAEEEAKKVPREAIKYLQP 179

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
                  E+ +L   Y  ++P+WR+S+QTHKF+G+R
Sbjct: 180 EWN--TPESQSLIFDYILKHPQWRMSLQTHKFLGVR 213


>gi|254228266|ref|ZP_04921695.1| Organic radical activating enzymes [Vibrio sp. Ex25]
 gi|262394169|ref|YP_003286023.1| queuosine Biosynthesis QueE Radical SAM [Vibrio sp. Ex25]
 gi|151939339|gb|EDN58168.1| Organic radical activating enzymes [Vibrio sp. Ex25]
 gi|262337763|gb|ACY51558.1| queuosine Biosynthesis QueE Radical SAM [Vibrio sp. Ex25]
          Length = 226

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 64/237 (27%), Positives = 97/237 (40%), Gaps = 43/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
            LY + E+F T+QGEG   G  AVF R   C +            C +CDT         
Sbjct: 4   TLYKLNEMFETIQGEGVFTGVPAVFVRLQECPV-----------GCSWCDTKQTWYADEN 52

Query: 57  ---------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
                    ++      + V    +++E+  + G    ++ V+TGGEP +    PL +A 
Sbjct: 53  DQRQIGDILVKTEDSPTWCVASAENIVEQYQLQG-FNAKHIVITGGEPCIYDLRPLTKAF 111

Query: 108 NKRGFEIAVETNGTIEPPQ-GIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNV 158
              G +  +ET+GT E       W+ VSPK     K+           E+K  V  Q ++
Sbjct: 112 EDMGCQCQIETSGTSEVITSENTWVTVSPKVAMKGKLPVLNSALERANEIKHPVGTQKDI 171

Query: 159 SPENYIGFDFE-----RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              + +  +         +LQP+        T L I  C     WRLSVQTHK++ I
Sbjct: 172 DHLDELLANANVAVETVIALQPISQK--PRATQLCIETCIAR-NWRLSVQTHKYLSI 225


>gi|123441108|ref|YP_001005097.1| hypothetical protein YE0753 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122088069|emb|CAL10857.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 223

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 62/236 (26%), Positives = 86/236 (36%), Gaps = 41/236 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT     +   
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFVRLQGCPV-----------GCSWCDTKHTWEKEAD 49

Query: 62  GGRYNVDQLADLIEEQWIT-------------GEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                   +   +E                       R+ V+TGGEP +    PL   L 
Sbjct: 50  REVDMQRIMVKTVESDAWATASEQQLLNIFSQQGYTARHVVITGGEPAIYDLFPLTTQLE 109

Query: 109 KRGFEIAVETNGTIEPPQG-IDWICVSPKAGC-------DLKIKGGQELKLV------FP 154
           + G+   +ET+GT E       W+ VSPK             ++   E+K          
Sbjct: 110 QAGYSCQIETSGTHEVQCSAATWVTVSPKVNMRGGLKVLPQALQRADEIKHPVGRLRDIE 169

Query: 155 QVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +    E          +LQP+      E T L I  C     WRLS+QTHK++ I
Sbjct: 170 ALEQLLETLTDDKKRIIALQPISQKD--EATKLCIETCIAK-NWRLSMQTHKYLNI 222


>gi|109899267|ref|YP_662522.1| radical SAM family protein [Pseudoalteromonas atlantica T6c]
 gi|109701548|gb|ABG41468.1| Radical SAM [Pseudoalteromonas atlantica T6c]
          Length = 248

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 67/243 (27%), Positives = 91/243 (37%), Gaps = 51/243 (20%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG---- 56
           +  Y I E+F +LQGEG H G  ++F R  GC +            C +CDT        
Sbjct: 23  LNTYKINEVFESLQGEGAHTGVPSIFIRLQGCPV-----------GCPWCDTKHTWEIDQ 71

Query: 57  -------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL 103
                            +   +  +QL  L ++     E      +LTGGEP +     L
Sbjct: 72  NLKVAAPVVMAQNEDTAQWFEHTPEQLLALFKQH----EYTASNIILTGGEPCMYDLTDL 127

Query: 104 IQALNKRGFEIAVETNGTIEPPQGID-WICVSPKAGCDLK-------IKGGQELKLVFPQ 155
              L + GF + +ET+GT E     D W+ VSPK     K       +    E+K     
Sbjct: 128 SSVLIENGFSVQIETSGTYEILTHPDTWVTVSPKVNMPGKRDVLKSAMHRANEIKHPVAM 187

Query: 156 VNVSPENYI--------GFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKF 207
                E                   LQP+     +  T L I  C     WRLS+QTHKF
Sbjct: 188 EKHIEELEHVLTLLVGSDNPKPLIYLQPISQ--QKRATELCIKTCIAR-NWRLSLQTHKF 244

Query: 208 IGI 210
           IGI
Sbjct: 245 IGI 247


>gi|327405865|ref|YP_004346703.1| Radical SAM domain-containing protein [Fluviicola taffensis DSM
           16823]
 gi|327321373|gb|AEA45865.1| Radical SAM domain protein [Fluviicola taffensis DSM 16823]
          Length = 204

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 63/214 (29%), Positives = 94/214 (43%), Gaps = 26/214 (12%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y + E F T+QGEG + G  A F R  GC++            C +CD            
Sbjct: 9   YPVMEHFYTIQGEGKYTGTSAYFIRLGGCDV-----------GCVWCDVKESW-DADIHP 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIE 123
           +  VD+L  ++ +        G   V+TGGEP +     L+ AL+  G  +A+ET+GT  
Sbjct: 57  KMTVDELITVVAQ------YPGELVVITGGEPAMYDLSVLVDALHSIGKYVAIETSGTSP 110

Query: 124 PPQGIDWICVSP---KAGCDLKIKGGQELKLVF-PQVNVSPENYIGF---DFERFSLQPM 176
               +DW   SP   K+  D       ELK+V   Q ++           D     LQP 
Sbjct: 111 LVGAVDWYTFSPKKFKSPVDEAYNKASELKIVIFHQSDLKWAEEHSLKVNDACVLYLQP- 169

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +    E+     I Y   +PKW++S+QTHK++ I
Sbjct: 170 EWSKREQLLPTIIEYVKNHPKWKISLQTHKYLEI 203


>gi|238750569|ref|ZP_04612069.1| hypothetical protein yrohd0001_3960 [Yersinia rohdei ATCC 43380]
 gi|238711217|gb|EEQ03435.1| hypothetical protein yrohd0001_3960 [Yersinia rohdei ATCC 43380]
          Length = 225

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 94/242 (38%), Gaps = 50/242 (20%)

Query: 1   MKL-YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI-- 57
           M + Y I E+F TLQGEG   G  A+F R  GC +            C +CDT       
Sbjct: 1   MLMQYPINEMFQTLQGEGYFTGVPAIFVRLQGCPV-----------GCSWCDTKHTWEKA 49

Query: 58  ---------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP 102
                          +    G  +  Q+ D+  +Q        R+ V+TGGEP +    P
Sbjct: 50  ANREVDLQRILVKTAESDAWGNASEQQVLDIFIQQG----YTARHVVITGGEPAIYDLRP 105

Query: 103 LIQALNKRGFEIAVETNGTIEPPQGI-DWICVSPKAGC-------DLKIKGGQELKLV-- 152
           L   L + G+   +ET+GT         W+ VSPK             ++   E+K    
Sbjct: 106 LTSHLEQAGYSCQIETSGTHAVQCSPTTWVTVSPKVNMRGGMKVLPQALQRADEIKHPVG 165

Query: 153 ----FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                  + +  +          +LQP+     E+ T L I  C     WRLS+QTHK++
Sbjct: 166 RLRDIEALELLLQTLDDDKKRIIALQPISQK--EDATKLCIETCIAK-NWRLSMQTHKYL 222

Query: 209 GI 210
            I
Sbjct: 223 NI 224


>gi|120437087|ref|YP_862773.1| hypothetical protein GFO_2752 [Gramella forsetii KT0803]
 gi|117579237|emb|CAL67706.1| conserved hypothetical protein [Gramella forsetii KT0803]
          Length = 210

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 63/215 (29%), Positives = 96/215 (44%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + E F T+QGEG H G  A F R  GC++            C +CD      +    
Sbjct: 15  MLPLMEEFYTIQGEGFHKGTAAYFIRIGGCDV-----------GCHWCDVK----ESWDA 59

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             +   ++  ++E       K  +  V+TGGEPL      L  +L K+G +I +ET+G  
Sbjct: 60  EVHPPTRIGQIVE----NAVKYSKTIVITGGEPLTWDMTELTGSLKKKGCDIHIETSGAY 115

Query: 123 EPPQGIDWICVSPKA---GCDLKIKGGQELKLVF---PQVNVSPENYIGF-DFERFSLQP 175
           +     DWIC+SPK      D       ELK++      +  + E      +     LQP
Sbjct: 116 DLTGTWDWICLSPKKIKLPKDKIYPVANELKVIVFNKHDLKFAEEQAAKVGEKCVLYLQP 175

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +    EE   L + Y   NPKW++S+QTHK++ I
Sbjct: 176 -EWSKREEMIPLIVDYVMANPKWKVSLQTHKYLNI 209


>gi|260772755|ref|ZP_05881671.1| queuosine Biosynthesis QueE Radical SAM [Vibrio metschnikovii CIP
           69.14]
 gi|260611894|gb|EEX37097.1| queuosine Biosynthesis QueE Radical SAM [Vibrio metschnikovii CIP
           69.14]
          Length = 224

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 67/238 (28%), Positives = 93/238 (39%), Gaps = 43/238 (18%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M LY + EIF T+QGEG   G  AVF R   C +            C +CDT        
Sbjct: 1   MTLYKVNEIFETIQGEGVFTGVPAVFVRLQQCPV-----------GCAWCDTKQTW-DAE 48

Query: 61  KGGRYNVDQL--------------ADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
              + + +Q+              A+ I  Q+       ++ V+TGGEP L   VPL +A
Sbjct: 49  PQDQRSFEQIIVKQGDSPTWCQGSAEQIVAQYQQQGYTAKHIVITGGEPCLYDLVPLTEA 108

Query: 107 LNKRGFEIAVETNGTIEPPQG-IDWICVSPKAGCDLKIK-------GGQELKLV------ 152
               G +  +ET+GT E       W+ VSPK     K+           E+K        
Sbjct: 109 FEAIGCQCQIETSGTFEIKASAKTWVTVSPKIAMKGKLPIVPSALQRANEIKHPVGTEKD 168

Query: 153 FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             Q+               +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 169 IAQLEALLAQVAISPDTIIALQPISQK--PRATQLCIETCITR-NWRLSIQTHKYLNI 223


>gi|262404009|ref|ZP_06080564.1| queuosine Biosynthesis QueE Radical SAM [Vibrio sp. RC586]
 gi|262349041|gb|EEY98179.1| queuosine Biosynthesis QueE Radical SAM [Vibrio sp. RC586]
          Length = 222

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 62/236 (26%), Positives = 95/236 (40%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI----- 57
           +Y I E+F T+QGEG   G  AVF R  GC +            C +CDT          
Sbjct: 1   MYRINEMFETIQGEGVFTGVPAVFVRLQGCPV-----------GCAWCDTKQTWDMLESE 49

Query: 58  ---------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                    +      +      D+++    T E + ++ V+TGGEP +     L Q   
Sbjct: 50  QTDFSHILLKAGDSPTWCQASAQDVVQRY-QTQEYQAKHIVITGGEPCIYDLTELTQVFE 108

Query: 109 KRGFEIAVETNGTIEPPQGID-WICVSPKAGCDLKIK-------GGQELKL-VFPQVNVS 159
             G +  +ET+GT E     + W+ VSPK     K+           E+K  V  + ++ 
Sbjct: 109 AIGCQCQIETSGTYEILATPNTWVTVSPKVAMKGKLPILDSSLQRANEIKHPVATENDIE 168

Query: 160 PENYIGFDFE-----RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             + +    +       +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 169 NLDALLLRAKVSSATVIALQPISQK--PRATELCIRTCIAR-NWRLSIQTHKYLNI 221


>gi|28898413|ref|NP_798018.1| hypothetical protein VP1639 [Vibrio parahaemolyticus RIMD 2210633]
 gi|28806630|dbj|BAC59902.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
          Length = 222

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 62/236 (26%), Positives = 93/236 (39%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------ 56
           +Y + E+F T+QGEG   G  AVF R   C +            C +CDT          
Sbjct: 1   MYKLNEMFETIQGEGIFTGVPAVFVRLQECPV-----------GCSWCDTKQTWDAEEKD 49

Query: 57  --------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                   ++      +      D++E+    G    ++ V+TGGEP +    PL +A  
Sbjct: 50  QRPIGDILVKTEDSPTWCTASAEDIVEQYKQQG-FNAKHIVITGGEPCIYDLRPLSKAFE 108

Query: 109 KRGFEIAVETNGTIEPPQ-GIDWICVSPKAGCDLKIK-------GGQELKLVF---PQVN 157
             G +  +ET+GT E       W+ VSPK     K+           E+K        ++
Sbjct: 109 DMGCQCQIETSGTSEVVTSEKTWVTVSPKVAMKGKLPVLRSALERANEIKHPVGTQKDID 168

Query: 158 VSPENYIGFDFE---RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              E     D +     +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 169 HLDELLANADIKVETVIALQPISQK--PRATQLCIETCIAR-NWRLSIQTHKYLSI 221


>gi|255531962|ref|YP_003092334.1| Radical SAM domain-containing protein [Pedobacter heparinus DSM
           2366]
 gi|255344946|gb|ACU04272.1| Radical SAM domain protein [Pedobacter heparinus DSM 2366]
          Length = 207

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 61/216 (28%), Positives = 92/216 (42%), Gaps = 26/216 (12%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
            L  + E F T+QGEG + G+ A F R  GC++            C +CD      +   
Sbjct: 10  TLLPLMEEFYTIQGEGFNTGKAAYFIRLGGCDV-----------GCHWCDVK----ESWD 54

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
              + +     ++ +        G+  V+TGGEPL+     L + L ++G    +ET+G 
Sbjct: 55  AELHPLTPADAIVAK---AESYPGKAVVITGGEPLIYNLDYLTRRLREKGILTFIETSGA 111

Query: 122 IEPPQGIDWICVSP---KAGCDLKIKGGQELKLVFPQVN----VSPENYIGFDFERFSLQ 174
                  DWIC+SP   KA          ELK++    +                +  LQ
Sbjct: 112 YPLSGDWDWICLSPKKFKAPRPDITPYANELKVIVFNKSDFEWAEKYAETVSANCKLYLQ 171

Query: 175 PMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           P +    +E T L I Y   NPKW +S+QTHKF+ I
Sbjct: 172 P-EWSKSKEITPLIIDYVMANPKWEISLQTHKFLNI 206


>gi|269967852|ref|ZP_06181896.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|269827557|gb|EEZ81847.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 226

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 63/236 (26%), Positives = 92/236 (38%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------ 56
           LY + E+F T+QGEG   G  AVF R   C +            C +CDT          
Sbjct: 5   LYKLNEMFETIQGEGVFTGVPAVFVRLQECPV-----------GCSWCDTKQTWYADEND 53

Query: 57  --------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                   ++      + V    +++E+    G    ++ V+TGGEP +    PL +A  
Sbjct: 54  QRQIGDILVKTEDSPTWCVASAENIVEQYQQQG-FNAKHIVITGGEPCIYDLRPLTKAFE 112

Query: 109 KRGFEIAVETNGTIEPPQ-GIDWICVSPKAGCDLKIK-------GGQELKLV------FP 154
             G +  +ET+GT E       W+ VSPK     K+           E+K          
Sbjct: 113 DMGCQCQIETSGTSEVITSENTWVTVSPKVAMKGKLPVLNSALERANEIKHPVGTQKDID 172

Query: 155 QVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            ++    N         +LQP+        T L I  C     WRLSVQTHK++ I
Sbjct: 173 HLDDLLANANVAAETIIALQPISQK--PRATQLCIDTCIAR-NWRLSVQTHKYLSI 225


>gi|238761644|ref|ZP_04622619.1| hypothetical protein ykris0001_11220 [Yersinia kristensenii ATCC
           33638]
 gi|238700158|gb|EEP92900.1| hypothetical protein ykris0001_11220 [Yersinia kristensenii ATCC
           33638]
          Length = 223

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 65/240 (27%), Positives = 94/240 (39%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFVRLQGCPV-----------GCSWCDTKHTWEKEAD 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +    G  +  QL D+  +Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVDMQRIMVKTAESDLWGTASEQQLLDIFRQQG----YTARHVVITGGEPAIYDLLPLT 105

Query: 105 QALNKRGFEIAVETNGTIEPPQG-IDWICVSPKAGC-------DLKIKGGQELKLVFPQV 156
             L + G+   +ET+GT E       W+ VSPK             ++   E+K    ++
Sbjct: 106 SQLEQAGYSCQIETSGTHEVQCSATTWVTVSPKVNMRGGLKVLPQALQRADEIKHPVGRL 165

Query: 157 NVSPENYIGF------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                  +             +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALEVLLVTLTDDKKRIIALQPISQK--EDATKLCIETCIAK-NWRLSMQTHKYLNI 222


>gi|325287093|ref|YP_004262883.1| Radical SAM domain-containing protein [Cellulophaga lytica DSM
           7489]
 gi|324322547|gb|ADY30012.1| Radical SAM domain protein [Cellulophaga lytica DSM 7489]
          Length = 215

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 58/215 (26%), Positives = 93/215 (43%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + E F T+QGEG H G  A F R  GC++            C +CD      +    
Sbjct: 20  MLPLMEEFYTIQGEGFHKGTAAYFIRVGGCDV-----------GCHWCDVK----ESWNA 64

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             +    +  ++        K     V+TGGEPL     PL +AL  +  +  +ET+G  
Sbjct: 65  ATHPPTTIDAIVN----NAAKYSNTIVVTGGEPLTWNMAPLTEALKAKNLQTHIETSGAY 120

Query: 123 EPPQGIDWICVSPKAG---CDLKIKGGQELKLVFPQVN---VSPENYIGFD-FERFSLQP 175
                 DWIC+SPK       +      ELK++    N    + E     +      LQP
Sbjct: 121 TLTGIWDWICLSPKKNKLPQGIIYDKADELKMIIYNKNDFKFAEEQAAKVNKDCILYLQP 180

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +    ++ T L + +  +NP+W++S+QTHK++ I
Sbjct: 181 -EWSVKDKMTPLIVDFVMKNPQWKVSLQTHKYLNI 214


>gi|218438303|ref|YP_002376632.1| radical SAM protein [Cyanothece sp. PCC 7424]
 gi|218171031|gb|ACK69764.1| Radical SAM domain protein [Cyanothece sp. PCC 7424]
          Length = 210

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 57/216 (26%), Positives = 91/216 (42%), Gaps = 27/216 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            Y I E F ++QGEG   G  A F R  GC+++           C +CD      +    
Sbjct: 15  TYPIVETFHSVQGEGAWTGVSAFFIRLGGCDVY-----------CPWCDQK----ESWNA 59

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
            R+    +  L +   +         ++TGGEPL+    PL   L K G ++ +ET+G+ 
Sbjct: 60  KRHPHQSVDTLAQAAKMAN---PAIVIITGGEPLMHDLDPLTTELKKLGLQVHLETSGSH 116

Query: 123 EPPQGIDWICVSPKA---GCDLKIKGGQELKLVFP---QVNVSPENYIGFDFERF-SLQP 175
                 DW+  SPK      D       ELK+V      ++++              LQP
Sbjct: 117 PFSGNFDWVTFSPKPYKKPHDSIYNYVNELKVVVANEEDLHMAEVQAAKLSLTVIKYLQP 176

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
                   +  L   +  ++P+WR+S+QTHKF+ +R
Sbjct: 177 EWN--TPNSKELIFDFVLKHPQWRISLQTHKFLNVR 210


>gi|238919074|ref|YP_002932588.1| hypothetical protein NT01EI_1143 [Edwardsiella ictaluri 93-146]
 gi|238868642|gb|ACR68353.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 223

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 64/237 (27%), Positives = 96/237 (40%), Gaps = 43/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y I E+F +LQGEG + G  A+F R  GC +            C +CD+     Q  +
Sbjct: 1   MQYPINEVFQSLQGEGFYTGVPAIFIRLQGCPV-----------GCSWCDSQHTWHQRPE 49

Query: 62  GGRYNVDQLADLIEE--------------QWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
             + ++ Q+ +   E                     + R  V+TGGEP +   +PL  AL
Sbjct: 50  -RQADLAQIVEKTAESEAWASADAAALVALLRQRGYQARRVVITGGEPCMYDLLPLTTAL 108

Query: 108 NKRGFEIAVETNGTIE-PPQGIDWICVSPKAGCD-------LKIKGGQELKLVFPQV--- 156
            + G+   +ET+GT         W+ VSPK G           ++   E+K    +    
Sbjct: 109 EQGGYRCQIETSGTHPVRCSAQTWVTVSPKVGMRGGMEVLTDALRRANEIKHPVARARDI 168

Query: 157 ---NVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              +       G      +LQP+     EE T L I  C     WRLS+QTHK++ I
Sbjct: 169 EALDALLARLDGELPPVVALQPISCK--EEATRLCIETCLAR-NWRLSMQTHKYLNI 222


>gi|34557972|ref|NP_907787.1| organic radical activating enzyme [Wolinella succinogenes DSM 1740]
 gi|34483690|emb|CAE10687.1| conserved hypothetical protein-Organic radical activating enzymes
           [Wolinella succinogenes]
          Length = 193

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 69/211 (32%), Positives = 95/211 (45%), Gaps = 22/211 (10%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y + EIF ++QGEG H+G+ A+F R  GCNL            C FCD           
Sbjct: 1   MYPVTEIFYSIQGEGHHSGKAALFVRLHGCNL-----------ACDFCD-----EPSHTQ 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
           G Y       ++E+          + V+TGGEP L    PLI+ L K G+ +A+ETNG  
Sbjct: 45  GEYENQSQEAILEQL---RAYPAHFVVITGGEPTLFDLNPLIKFLQKEGYFVAIETNGYN 101

Query: 123 -EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDG--P 179
               Q  DWI  SPK    L  +G  ELK +    +        F  +   LQP      
Sbjct: 102 LAHIQAADWITYSPKNWNTLAKEGYDELKFIIHHASDITPLLALFQEKPLYLQPQSDGSA 161

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               N    +    ++P+WRLS+QTHK + I
Sbjct: 162 LNAANVARCVELILEHPEWRLSLQTHKILEI 192


>gi|311746196|ref|ZP_07719981.1| radical activating enzyme [Algoriphagus sp. PR1]
 gi|126576423|gb|EAZ80701.1| radical activating enzyme [Algoriphagus sp. PR1]
          Length = 208

 Score =  188 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 97/214 (45%), Gaps = 26/214 (12%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F T+QGEG   G  A F R  GC++            C +CD      +  + G
Sbjct: 13  LPLMEAFYTIQGEGRFTGHPAYFIRLGGCDV-----------GCVWCDVK----ESWEAG 57

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIE 123
           ++ +  + +++ E     +  GR  V+TGGEPL+    PL   L ++GF   +ET+G   
Sbjct: 58  KWPILPIEEIVAEAV---KYPGRLVVITGGEPLMYDLGPLTSLLKEKGFTTNIETSGAHP 114

Query: 124 PPQGIDWICVSP---KAGCDLKIKGGQELK-LVFPQVNVSPENYIGFDF---ERFSLQPM 176
                DW+C SP   K       K   ELK +VF   + +                LQP 
Sbjct: 115 FSGDFDWVCFSPKKFKKPHPSIYKVANELKVVVFHNSDFAFAEEHALKVNENCELRLQP- 173

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +    E+ T L I+Y   +P W++S+QTHKF+ I
Sbjct: 174 EWSKSEKFTPLIINYSKYHPNWKISLQTHKFMDI 207


>gi|89890614|ref|ZP_01202124.1| organic radical activating enzyme [Flavobacteria bacterium BBFL7]
 gi|89517529|gb|EAS20186.1| organic radical activating enzyme [Flavobacteria bacterium BBFL7]
          Length = 219

 Score =  188 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 56/216 (25%), Positives = 91/216 (42%), Gaps = 27/216 (12%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
            +  + E F T+QGEG H G+ A F R  GC++            C +CD      +   
Sbjct: 23  MMLPLMEEFYTIQGEGSHTGKAAYFIRVGGCDV-----------GCHWCDVK----ESWD 67

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
             ++    +  ++        K  +  V+TGGEPL     PL   L + G ++ +ET+G 
Sbjct: 68  QEKHPPTAVEAIVA----NAAKYSKTIVVTGGEPLTWDMGPLTTGLKEEGMQVHIETSGA 123

Query: 122 IEPPQGIDWICVS---PKAGCDLKIKGGQELKLVFPQVN----VSPENYIGFDFERFSLQ 174
                  DWIC+S    K       +   ELK++    +       E        +  LQ
Sbjct: 124 YPLSGTWDWICLSPKKMKMPLPEVYEAAHELKVIVFNKHDFAFAKAEAEKVSSNCKLYLQ 183

Query: 175 PMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           P +    E+   L   +  +NP+W +S+QTHK++ I
Sbjct: 184 P-EWSVREKMIPLITEFVMENPEWHVSLQTHKYLNI 218


>gi|295135621|ref|YP_003586297.1| radical SAM superfamily protein [Zunongwangia profunda SM-A87]
 gi|294983636|gb|ADF54101.1| radical SAM superfamily protein [Zunongwangia profunda SM-A87]
          Length = 223

 Score =  188 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 61/215 (28%), Positives = 94/215 (43%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + E F T+QGEG H G  A F R  GC++            C +CD      +    
Sbjct: 28  MLPLMEEFYTIQGEGYHKGTAAYFIRIGGCDV-----------GCHWCDVK----ESWNA 72

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
           G +    + +++E          +  V+TGGEPL      L  +L K+G +I +ET+G  
Sbjct: 73  GLHPPTHVGEIVENALKY----SKTIVITGGEPLTWDMTTLTDSLKKQGCQIHIETSGAY 128

Query: 123 EPPQGIDWICVSPKA---GCDLKIKGGQELKLVF---PQVNVSPENYIGF-DFERFSLQP 175
                 DWIC+SPK              ELK++         + E      +     LQP
Sbjct: 129 PLTGIWDWICLSPKKIKLPEPEIYPVANELKVIIFNKHDFKFAEEQAAQVGEHCILYLQP 188

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +    E+   L + Y  +NPKW++S+QTHK++ I
Sbjct: 189 -EWSNREKMIPLIVDYVMRNPKWKVSLQTHKYLNI 222


>gi|91215960|ref|ZP_01252929.1| hypothetical protein P700755_15536 [Psychroflexus torquis ATCC
           700755]
 gi|91185937|gb|EAS72311.1| hypothetical protein P700755_15536 [Psychroflexus torquis ATCC
           700755]
          Length = 210

 Score =  188 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 61/215 (28%), Positives = 91/215 (42%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + E F T+QGEG H G  A F R  GC++            C +CD      +    
Sbjct: 15  MLPLMEEFYTIQGEGYHTGTAAYFIRIGGCDV-----------GCHWCDVK----ESWDP 59

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
            R+   ++  +IE      +K     V+TGGEPL      L Q L      I +ET+G  
Sbjct: 60  ERHPPTRIGSIIE----NAKKYSNTIVITGGEPLTWDMSMLTQGLKDNQLSIHIETSGAY 115

Query: 123 EPPQGIDWICVSPKAG---CDLKIKGGQELKLVFPQVNVSPENYIGF----DFERFSLQP 175
           +     DWIC+SPK              ELK++    +             +     LQP
Sbjct: 116 DLTGVWDWICLSPKKNKLPKPEIYPKVDELKVIIFNKHDFKFAEEHASQVGEDCELFLQP 175

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +    E+ T   + Y  ++PKWR+S+QTHK++ I
Sbjct: 176 -EWSVREKMTPQIVEYVMKHPKWRISLQTHKYLNI 209


>gi|126657071|ref|ZP_01728242.1| hypothetical protein CY0110_28234 [Cyanothece sp. CCY0110]
 gi|126621614|gb|EAZ92324.1| hypothetical protein CY0110_28234 [Cyanothece sp. CCY0110]
          Length = 213

 Score =  188 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 62/218 (28%), Positives = 93/218 (42%), Gaps = 27/218 (12%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           +K Y I E F +LQGEG   G  A F R +GC++            C +CD      +  
Sbjct: 16  LKTYPIVERFHSLQGEGTWTGMSAFFIRLAGCDV-----------HCPWCDQK----ESW 60

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
               Y    +  L +             V+TGGEPL+    PL + L + G  + +ET+G
Sbjct: 61  NSNLYPQQSIKTLTDAAKAAN---PAMVVITGGEPLIHDLFPLTKGLKQLGLRVHLETSG 117

Query: 121 TIEPPQGIDWICVSP---KAGCDLKIKGGQELKLVF---PQVNVSPENYIGFDFERF-SL 173
                   DWI +SP   K   +       ELK++      +N + +       +    L
Sbjct: 118 AYPLTGEFDWITLSPKPFKVPHETVYSQVNELKVIIANEADLNWAEKQEKKVPSQTIKYL 177

Query: 174 QPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           QP       E+ +L   Y   NP+WR+S+Q HKF+G+R
Sbjct: 178 QPEWNS--PESKSLIFDYILSNPQWRMSLQIHKFLGVR 213


>gi|71280858|ref|YP_269588.1| radical SAM domain-containing protein [Colwellia psychrerythraea
           34H]
 gi|71146598|gb|AAZ27071.1| radical SAM domain protein [Colwellia psychrerythraea 34H]
          Length = 222

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 64/239 (26%), Positives = 98/239 (41%), Gaps = 48/239 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F T+QGEG   G+ ++F R  GC +            C +CDT         
Sbjct: 1   MNYKINELFETIQGEGSFTGQPSIFIRLQGCPV-----------GCSWCDTKHTWDIELD 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        + ++   ++ + +  L++E       + ++ V+TGGEP +    PL 
Sbjct: 50  DQVSPDIMLAKKAETSQWANFSAEDILALVKE----KHFKAKHIVITGGEPCMVDLTPLC 105

Query: 105 QALNKRGFEIAVETNGTIEPP-QGIDWICVSPKAGC-------DLKIKGGQELKL-VFPQ 155
           +     G+   +ET+GT E       W+ VSPK             +    E+K  V  +
Sbjct: 106 ETFEDLGYSTQIETSGTFEIITTEKCWVTVSPKIKMRGGYDILASAMSRANEIKHPVATE 165

Query: 156 VNVSPEN----YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            NV            +     LQP+     +  T LAI+ C  N  WRLSVQ HK+IGI
Sbjct: 166 QNVDDLKELLAMHQVENTPVYLQPISQK--KRATELAIATCIAN-NWRLSVQVHKYIGI 221


>gi|153836184|ref|ZP_01988851.1| organic radical activating enzyme [Vibrio parahaemolyticus AQ3810]
 gi|149750459|gb|EDM61204.1| organic radical activating enzyme [Vibrio parahaemolyticus AQ3810]
          Length = 226

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 63/236 (26%), Positives = 93/236 (39%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------ 56
           LY + E+F T+QGEG   G  AVF R   C +            C +CDT          
Sbjct: 5   LYKLNEMFETIQGEGIFTGVPAVFVRLQECPV-----------GCSWCDTKQTWDAEEKD 53

Query: 57  --------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                   ++      +      D++E+    G    ++ V+TGGEP +    PL +A  
Sbjct: 54  QRPIGDILVKTEDSPTWCTASAEDIVEQYKQQG-FNAKHIVITGGEPCIYDLRPLSKAFE 112

Query: 109 KRGFEIAVETNGTIEPPQ-GIDWICVSPKAGCDLKIK-------GGQELKLVF---PQVN 157
             G +  +ET+GT E       W+ VSPK     K+           E+K        ++
Sbjct: 113 DMGCQCQIETSGTSEVVTSEKTWVTVSPKVAMKGKLPVLRSALERANEIKHPVGTQKDID 172

Query: 158 VSPENYIGFDFER---FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              E     D +     +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 173 HLDELLANADIKTETVIALQPISQK--PRATQLCIETCIAR-NWRLSIQTHKYLSI 225


>gi|308049094|ref|YP_003912660.1| radical activating enzyme [Ferrimonas balearica DSM 9799]
 gi|307631284|gb|ADN75586.1| radical activating enzyme [Ferrimonas balearica DSM 9799]
          Length = 222

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 62/236 (26%), Positives = 90/236 (38%), Gaps = 42/236 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y + EIF T+QGEG   G  AVF R  GC +            C +CDT         
Sbjct: 1   MQYPVNEIFETIQGEGHFTGVPAVFLRLQGCPV-----------GCAWCDTRHTWEVLAE 49

Query: 58  ----------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
                      G    R+    L  L+       +   R+ V+TGGEP +    PL + +
Sbjct: 50  DQVEPGLVIGAGDGEPRWAQWPLEQLVAHL-TGPQYRARHLVITGGEPCMYDLRPLTERM 108

Query: 108 NKRGFEIAVETNGTIEPPQG-IDWICVSPKAGCD-------LKIKGGQELKLVFPQVNVS 159
              G+   +ET+G  E       W+ VSPK G           ++   E+K         
Sbjct: 109 IAAGWRCQIETSGCFEVKTDPQTWVTVSPKVGMKGGLEVQRSALERANEIKHPVAMQKHV 168

Query: 160 PENY-----IGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E       +  + +  +LQP+          L +  C +   WRLSVQTHK++ I
Sbjct: 169 DELDALLAGVALEGKEVALQPISQQH--RANELCVRVCIER-NWRLSVQTHKYLNI 221


>gi|294635382|ref|ZP_06713876.1| radical SAM domain protein [Edwardsiella tarda ATCC 23685]
 gi|291091269|gb|EFE23830.1| radical SAM domain protein [Edwardsiella tarda ATCC 23685]
          Length = 249

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 63/240 (26%), Positives = 93/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I EIF +LQGEG + G  A+F R  GC +            C +CD+         
Sbjct: 27  MQYPINEIFHSLQGEGFYTGLPAIFIRLQGCPV-----------GCSWCDSKHTWQQDAV 75

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +       +V  L  L+++         R+ V+TGGEP L   +PL 
Sbjct: 76  RQVALEQVVEKAAESDAWASADVATLCALLQQ----RGYAARHVVITGGEPCLHDLLPLT 131

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGCD-------LKIKGGQELKLVFPQV 156
            AL + G++  +ET+GT         W+ VSPK             ++   E+K    + 
Sbjct: 132 LALEQAGYQCQIETSGTHPVRCSEQTWVTVSPKVAMRGGMAVLTSALRRANEIKHPVARE 191

Query: 157 NVSPENYIGFDF------ERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                             +  +LQP+     E  T L I  C     WRLS+QTHK++ I
Sbjct: 192 RDIAALDALLATLGEALPQVVALQPISCK--EGATRLCIDTCLAR-NWRLSMQTHKYLHI 248


>gi|260876575|ref|ZP_05888930.1| organic radical activating enzyme [Vibrio parahaemolyticus AN-5034]
 gi|260895066|ref|ZP_05903562.1| organic radical activating enzyme [Vibrio parahaemolyticus
           Peru-466]
 gi|308125822|ref|ZP_05777715.2| organic radical activating enzyme [Vibrio parahaemolyticus K5030]
 gi|308126346|ref|ZP_05909319.2| organic radical activating enzyme [Vibrio parahaemolyticus AQ4037]
 gi|308085913|gb|EFO35608.1| organic radical activating enzyme [Vibrio parahaemolyticus
           Peru-466]
 gi|308093608|gb|EFO43303.1| organic radical activating enzyme [Vibrio parahaemolyticus AN-5034]
 gi|308110779|gb|EFO48319.1| organic radical activating enzyme [Vibrio parahaemolyticus AQ4037]
 gi|308111580|gb|EFO49120.1| organic radical activating enzyme [Vibrio parahaemolyticus K5030]
          Length = 226

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 63/236 (26%), Positives = 93/236 (39%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------ 56
           LY + E+F T+QGEG   G  AVF R   C +            C +CDT          
Sbjct: 5   LYKLNEMFETIQGEGIFTGVPAVFVRLQECPV-----------GCSWCDTKQTWDAEEKD 53

Query: 57  --------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                   ++      +      D++E+    G    ++ V+TGGEP +    PL +A  
Sbjct: 54  QRPIGDILVKTEDSPTWCTASAEDIVEQYKQQG-FNAKHIVITGGEPCIYDLRPLSKAFE 112

Query: 109 KRGFEIAVETNGTIEPPQ-GIDWICVSPKAGCDLKIK-------GGQELKLVF---PQVN 157
             G +  +ET+GT E       W+ VSPK     K+           E+K        ++
Sbjct: 113 DMGCQCQIETSGTSEVVTSEKTWVTVSPKVAMKGKLPVLRSALERANEIKHPVGTQKDID 172

Query: 158 VSPENYIGFDFE---RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              E     D +     +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 173 HLDELLANADIKVETVIALQPISQK--PRATQLCIETCIAR-NWRLSIQTHKYLSI 225


>gi|238786798|ref|ZP_04630599.1| hypothetical protein yfred0001_17670 [Yersinia frederiksenii ATCC
           33641]
 gi|238725166|gb|EEQ16805.1| hypothetical protein yfred0001_17670 [Yersinia frederiksenii ATCC
           33641]
          Length = 223

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 65/240 (27%), Positives = 90/240 (37%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFVRLQGCPV-----------GCSWCDTKHTWEKDAN 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +    G     QL D+  +Q        R+ V+TGGEP +    PL 
Sbjct: 50  REVDMQRIMVKTAESDAWGTATEQQLLDIFIQQG----YTARHVVITGGEPAIYDLFPLT 105

Query: 105 QALNKRGFEIAVETNGTIEPPQG-IDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L + G+   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 SHLEQAGYSCQIETSGTHEVQCSATTWVTVSPKVNMRGGLKVLPQALQRADEIKHPVGRL 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                +               +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALEALLATLDDDKKRIIALQPISQK--EDATKLCIETCIVK-NWRLSMQTHKYLNI 222


>gi|332160379|ref|YP_004296956.1| hypothetical protein YE105_C0757 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318604386|emb|CBY25884.1| queuosine Biosynthesis QueE Radical SAM [Yersinia enterocolitica
           subsp. palearctica Y11]
 gi|325664609|gb|ADZ41253.1| hypothetical protein YE105_C0757 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330859861|emb|CBX70192.1| uncharacterized protein ygcF [Yersinia enterocolitica W22703]
          Length = 223

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 93/240 (38%), Gaps = 49/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFVRLQGCPV-----------GCSWCDTKHTWEKAAD 49

Query: 57  ------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                       ++    G  +  QL D+  +Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVDMQRIMVKTVENDAWGTASEQQLLDIFLQQG----YTARHVVITGGEPAIYDLLPLT 105

Query: 105 QALNKRGFEIAVETNGTIEPPQG-IDWICVSPKAGC-------DLKIKGGQELKLV---- 152
             L + G+   +ET+GT E       W+ VSPK             ++   E+K      
Sbjct: 106 SQLEQAGYSCQIETSGTHEVQCSAATWVTVSPKVNMRGGLKILPQALQRADEIKHPVGRL 165

Query: 153 --FPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                +               +LQP+     EE T L I  C     WRLS+QTHK++ I
Sbjct: 166 RDIEALEALLATLADDKKRIIALQPISQK--EEATKLCIETCIAK-NWRLSMQTHKYLNI 222


>gi|114563049|ref|YP_750562.1| radical activating enzyme [Shewanella frigidimarina NCIMB 400]
 gi|114334342|gb|ABI71724.1| radical activating enzyme [Shewanella frigidimarina NCIMB 400]
          Length = 222

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 63/237 (26%), Positives = 92/237 (38%), Gaps = 44/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y + E+F T+QGEG + G  A+F R  GC +            C +CDT         
Sbjct: 1   MKYPVNEVFETIQGEGTYTGVPALFVRLQGCPV-----------GCAWCDTKQTWDVLPE 49

Query: 57  ----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
                     + GT G     D     + + +       ++ VLTGGEP L     L   
Sbjct: 50  NKVTAEQVIQVDGTIGRW--ADHTGYTLLQAFHDKGFTAKHIVLTGGEPCLYNLTELTTI 107

Query: 107 LNKRGFEIAVETNGTIEPPQGID-WICVSPKAGCDLKIK-------GGQELKLVFPQVNV 158
             + G+++ +ET+GT +     D W+ VSPK       K          E+K      + 
Sbjct: 108 FIEAGYQVQIETSGTFDVKCHSDVWVTVSPKINMKGGYKVLEQALNRANEIKHPIATEHH 167

Query: 159 SPE-----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             E       I    +   LQP+        T LA+  C     WRLS+QTHK++ I
Sbjct: 168 IDELDKLLLNIDVSDKTICLQPISQK--ARATELAMKVCISR-NWRLSIQTHKYLNI 221


>gi|54309500|ref|YP_130520.1| putative organic radical activating enzyme [Photobacterium
           profundum SS9]
 gi|46913936|emb|CAG20718.1| putative organic radical activating enzymes [Photobacterium
           profundum SS9]
          Length = 222

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 64/236 (27%), Positives = 92/236 (38%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y I E+F T+QGEG   G  A+F R   C +            C +CDT          
Sbjct: 1   MYKINEVFETIQGEGTFTGVPAIFVRLQVCPV-----------GCSWCDTKQTW-DAEPT 48

Query: 63  GRYNVDQLADL--------------IEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
              +++ +                 I           R+ V+TGGEP +   VPL  AL 
Sbjct: 49  DYASLNDIMAKKGDSPLWTNIDAQGIVTLLQDQGYTARHVVITGGEPCIYDLVPLTAALE 108

Query: 109 KRGFEIAVETNGTIEP-PQGIDWICVSPKAGCDLKIK-------GGQELKLV------FP 154
             GF   +ET+GT E       W+ VSPK     K+           E+K          
Sbjct: 109 TAGFNCQIETSGTSEILATENTWVTVSPKINMKAKLPVLASALSRADEIKHPVGTSKDIK 168

Query: 155 QVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           Q++   +  I       +LQP+        T+L I  C +   WRLS+QTHK++ I
Sbjct: 169 QLDALIDGVILKQNVTIALQPISQK--PRATDLCIETCIKR-NWRLSIQTHKYLAI 221


>gi|119774960|ref|YP_927700.1| radical activating enzyme [Shewanella amazonensis SB2B]
 gi|119767460|gb|ABM00031.1| radical activating enzyme [Shewanella amazonensis SB2B]
          Length = 233

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 61/236 (25%), Positives = 85/236 (36%), Gaps = 40/236 (16%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M  Y I E+F T+QGEG H G  A+F R  GC +            C +CDT        
Sbjct: 11  MTEYPINEVFETIQGEGSHTGLPAIFVRLQGCPV-----------ACPWCDTAQTWDVLE 59

Query: 61  KGGRYNVDQL-------------ADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
           +      D +             A  +   +       +  V+TGGEP +     L Q  
Sbjct: 60  QSKVAPADVIQVDGSIGRWAMHSASSLVAAFNQKGFTAKLVVITGGEPCMHDLTDLTQGF 119

Query: 108 NKRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKLVFPQVNVS 159
              GF   +ET+GT E       ++ VSPK                  E+K         
Sbjct: 120 EAEGFHCQIETSGTFEVHCSDRTYVTVSPKINMKGGYPVLKQALVRANEIKHPVATDAHI 179

Query: 160 PENYIGFD-----FERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            E     +      +   LQP+        T LA+  C     WRLS+QTHK++ I
Sbjct: 180 DELDALLEGIDTSGKTICLQPISQK--PRATELAMKTCIAR-NWRLSIQTHKYLNI 232


>gi|227537400|ref|ZP_03967449.1| radical SAM domain protein [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227242778|gb|EEI92793.1| radical SAM domain protein [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 207

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 61/214 (28%), Positives = 90/214 (42%), Gaps = 26/214 (12%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F T+QGEG H G+ A F R  GC++            C +CD      +     
Sbjct: 12  LPLMEEFYTIQGEGYHTGKAAYFIRLGGCDV-----------GCHWCDVK----ESWDAE 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIE 123
            + +     ++E          +  V+TGGEPL+     L   L   G +  +ET+G   
Sbjct: 57  LHPLTAADTIVEH---ANVHPSKTVVVTGGEPLIYNLDYLTSQLQNAGIQTFLETSGAYP 113

Query: 124 PPQGIDWICVSP---KAGCDLKIKGGQELKLVFPQVN----VSPENYIGFDFERFSLQPM 176
                DWIC+SP   KA     +    ELK++    +          +  D  +  LQP 
Sbjct: 114 LSGHWDWICLSPKKFKAPRPDVLANAGELKVIVFNKSDFQWAEEHARLVNDTCKLYLQP- 172

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +     E T L I Y   NPKW +S+QTHK++ I
Sbjct: 173 EWSKAAEMTPLIIDYVMANPKWEISLQTHKYLNI 206


>gi|209809367|ref|YP_002264905.1| hypothetical protein VSAL_II0580 [Aliivibrio salmonicida LFI1238]
 gi|208010929|emb|CAQ81334.1| conserved hypothetical protein [Aliivibrio salmonicida LFI1238]
          Length = 226

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 58/236 (24%), Positives = 88/236 (37%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI----- 57
           L+ I E+F T+QGEG   G  ++F R  GC +            C +CDT          
Sbjct: 5   LFKINELFETIQGEGTFTGVPSIFLRLQGCPV-----------GCSWCDTKQTWDVELSD 53

Query: 58  ---------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                    +      +       +I+   +      ++ V+TGGEP +     L + L 
Sbjct: 54  KTDLATILAKTEDAPSWTELTALQIID-MLVQQGYTAKHMVITGGEPCMYDLTSLTEELE 112

Query: 109 KRGFEIAVETNGTIEP-PQGIDWICVSPKAGCDLKIK-------GGQELKLVFPQVNVSP 160
           K G+   +ET+GT         W+ VSPK     K+           E+K          
Sbjct: 113 KNGYRCQIETSGTYPILTSNNTWVTVSPKINMKGKLPVLDEALMRANEIKHPVGTTKDIE 172

Query: 161 ENYIGFD------FERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +     D          +LQP+        T L I  C +   WRLS+QTHK++ I
Sbjct: 173 QLEALLDGVNLLTDVTIALQPISQK--PRATELCIETCIKK-NWRLSIQTHKYLAI 225


>gi|288799933|ref|ZP_06405392.1| GntS [Prevotella sp. oral taxon 299 str. F0039]
 gi|288333181|gb|EFC71660.1| GntS [Prevotella sp. oral taxon 299 str. F0039]
          Length = 192

 Score =  188 bits (477), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 78/212 (36%), Positives = 105/212 (49%), Gaps = 30/212 (14%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            + EIF TLQGEG H GR AVF RF+GCNL            C FCDT            
Sbjct: 2   RVNEIFYTLQGEGAHTGRAAVFLRFAGCNLT-----------CSFCDTQH--------ET 42

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIEP 124
           Y      +++       +    + V+TGGEP +Q+   LI  L+  G ++ +ETNGTI P
Sbjct: 43  YTSMSEEEIVISI---NKFPSTWVVITGGEPTIQLTESLIHKLHAIGKKVQIETNGTIIP 99

Query: 125 PQGIDWICVSPKAGC----DLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           P   DWI VSPK       ++K +   ELK+V+   N +   Y     + + LQP D   
Sbjct: 100 PPNTDWITVSPKFEYCKRAEIKAERINELKVVYDGSN-NMSVYETIKADHYFLQPCDLQD 158

Query: 181 LEENTNLA---ISYCFQNPKWRLSVQTHKFIG 209
             +N  +    I Y  +NPKWRLS+QTHK + 
Sbjct: 159 ETKNKKIINQVIEYIKKNPKWRLSLQTHKILN 190


>gi|225011685|ref|ZP_03702123.1| Radical SAM domain protein [Flavobacteria bacterium MS024-2A]
 gi|225004188|gb|EEG42160.1| Radical SAM domain protein [Flavobacteria bacterium MS024-2A]
          Length = 210

 Score =  187 bits (476), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 62/214 (28%), Positives = 93/214 (43%), Gaps = 27/214 (12%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F TLQGEG H G  A F R  GC++            C +CD      +     
Sbjct: 16  LPLMEAFYTLQGEGYHKGSAAYFIRIGGCDV-----------GCHWCDVK----ESWNAD 60

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIE 123
            +   Q+  ++ E     +      V+TGGEPL+    PL  AL+K   +I +ET+G   
Sbjct: 61  LHPPTQIDSIVAEAKKYSD----TVVVTGGEPLMWKMDPLTDALHKEDMQIHIETSGAYS 116

Query: 124 PPQGIDWICVSPKAGCDLKIKGG---QELKLVFPQVN---VSPENYIGF-DFERFSLQPM 176
                DW C+SPK      ++      ELK++    +    + E         +  LQP 
Sbjct: 117 LSGSWDWFCLSPKKNKLPIVEAYAVADELKMIVYNKDDFRFAEEQAAKVGQECKLFLQP- 175

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +    E    L + Y   NPKW++S+QTHK++ I
Sbjct: 176 EWSKRETVMPLLVDYVLGNPKWKVSLQTHKYLNI 209


>gi|197286098|ref|YP_002151970.1| hypothetical protein PMI2252 [Proteus mirabilis HI4320]
 gi|194683585|emb|CAR44467.1| conserved hypothetical protein [Proteus mirabilis HI4320]
          Length = 223

 Score =  187 bits (476), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 62/237 (26%), Positives = 91/237 (38%), Gaps = 43/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT     +  +
Sbjct: 1   MQYPINEVFQTLQGEGVFTGVPALFVRLQGCPV-----------GCSWCDTKHTW-EKEE 48

Query: 62  GGRYNVDQLA--------------DLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
             +  +  +               + I   +       ++ V+TGGEP L    PL + L
Sbjct: 49  SKKVPLGDIPIKTQESDTWGIATVEDILSLFRQQRYSAKHVVITGGEPCLYDLRPLTEGL 108

Query: 108 NKRGFEIAVETNGTIEP-PQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQVNVS 159
            K GF+  +ET+GT +       W+ +SPK G           I    E+K    +    
Sbjct: 109 EKAGFDCQIETSGTHDILCSEATWVTLSPKVGMRGGLSVLSSAINRANEIKHPVAREKDI 168

Query: 160 PENYIGFDFER------FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                             +LQP+     E  T L I  C +   WR S+QTHK++ I
Sbjct: 169 EALDDLLRLRTQQPMAIVALQPISCK--ESATALCIKTCIER-NWRFSMQTHKYLNI 222


>gi|282879508|ref|ZP_06288242.1| radical SAM domain protein [Prevotella timonensis CRIS 5C-B1]
 gi|281306655|gb|EFA98681.1| radical SAM domain protein [Prevotella timonensis CRIS 5C-B1]
          Length = 199

 Score =  187 bits (476), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 79/217 (36%), Positives = 113/217 (52%), Gaps = 30/217 (13%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           + Y + EIF +LQGEG HAG+ AVF RF+ CNL            C FCDT+F       
Sbjct: 6   RTYKVNEIFYSLQGEGHHAGKAAVFVRFAKCNL-----------HCSFCDTNF------- 47

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
              Y       +IE           + V+TGGEP LQV   L+Q  +  G+ +++ETNGT
Sbjct: 48  -DEYTEMSAQQIIENVQQYA--PCNFVVITGGEPTLQVTATLLQLFHVHGYYVSMETNGT 104

Query: 122 IEPPQGIDWICVSPK----AGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPM- 176
              P+G+DWI  SPK       D++IK   E+K+V+  ++  P +  G + E   +QP  
Sbjct: 105 HPIPKGVDWITCSPKKAFIEAGDVQIKQANEIKVVYDGIH--PISTFGIEAEERYVQPCD 162

Query: 177 --DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             D    +E    AI +   +P+W+LS+Q HK IGI+
Sbjct: 163 VGDESRNKEILQKAIQFVKTHPQWKLSLQLHKLIGIQ 199


>gi|86132652|ref|ZP_01051245.1| radical SAM superfamily protein [Dokdonia donghaensis MED134]
 gi|85816894|gb|EAQ38079.1| radical SAM superfamily protein [Dokdonia donghaensis MED134]
          Length = 213

 Score =  187 bits (476), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 59/215 (27%), Positives = 90/215 (41%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + E F T+QGEG H G  A F R  GC++            C +CD      +    
Sbjct: 18  MLPLMEEFYTIQGEGFHKGTAAYFIRVGGCDV-----------GCHWCDVK----ESWDA 62

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             +       + E      +      V+TGGEPL+    PL + L   G    +ET+G  
Sbjct: 63  AIHPPTNANTIAENAAKYSD----TIVVTGGEPLMWDMNPLTKKLKSLGLTTHIETSGAY 118

Query: 123 EPPQGIDWICVSPKAGCDLKI---KGGQELKLVFPQVNVSPENYIGF----DFERFSLQP 175
           E     DWIC+SPK     K    +   ELK++    +             +     LQP
Sbjct: 119 ELSGDWDWICLSPKKRMLPKASVLEKANELKVIIFNKSDFDFAEKHATQVGEDCILYLQP 178

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +    ++   L + Y  +NPKW++S+QTHK++ I
Sbjct: 179 -EWSVRDKMVPLIVDYVMKNPKWKVSLQTHKYLNI 212


>gi|33864484|ref|NP_896044.1| putative organic radical activating protein [Prochlorococcus
           marinus str. MIT 9313]
 gi|33641264|emb|CAE22394.1| possible organic radical activating enzyme [Prochlorococcus marinus
           str. MIT 9313]
          Length = 226

 Score =  187 bits (476), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 68/239 (28%), Positives = 94/239 (39%), Gaps = 48/239 (20%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F +LQGEG H GR A F R +GC++            C +CDT           
Sbjct: 5   LPVVETFHSLQGEGAHVGRSAFFIRLAGCDV-----------GCSWCDTKH----SWNSR 49

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKR-------GFEIAV 116
            +    L  L EE     +    + VLTGGEPL     PL +AL++           I +
Sbjct: 50  NHPQITLEQLAEETATAAKDGAAFVVLTGGEPLQHNIAPLCEALHRATETNHGGPLAIHL 109

Query: 117 ETNGTIEPPQGIDWICVSPKAGCDLKIK---GGQELKLVFPQVNVS--PENYIGFDFER- 170
           ET+G  +      WI +SPK     +        ELK+V  + +     E+      E  
Sbjct: 110 ETSGVNQLSGVPTWITLSPKRHAPPRTDLLAACHELKVVVHETDDLNFAEDMAKAALEAR 169

Query: 171 ------------------FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
                               LQP  G        LA  +   +P WRLS+QTHK++GIR
Sbjct: 170 KNDNASQSRLSNTSKEPLLFLQP--GWKTTRGQQLAFEHVQSHPHWRLSMQTHKWLGIR 226


>gi|300772841|ref|ZP_07082710.1| radical SAM domain protein [Sphingobacterium spiritivorum ATCC
           33861]
 gi|300759012|gb|EFK55839.1| radical SAM domain protein [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 207

 Score =  187 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 61/214 (28%), Positives = 90/214 (42%), Gaps = 26/214 (12%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F T+QGEG H G+ A F R  GC++            C +CD      +     
Sbjct: 12  LPLMEEFYTIQGEGYHTGKAAYFIRLGGCDV-----------GCHWCDVK----ESWDAE 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIE 123
            + +     ++E          +  V+TGGEPL+     L   L   G +  +ET+G   
Sbjct: 57  LHPLTAADTIVEH---ANVHPSKTVVVTGGEPLIYNLDYLTSQLQNAGIQTFLETSGAYP 113

Query: 124 PPQGIDWICVSP---KAGCDLKIKGGQELKLVFPQVN----VSPENYIGFDFERFSLQPM 176
                DWIC+SP   KA     +    ELK++    +          +  D  +  LQP 
Sbjct: 114 LSGHWDWICLSPKKFKAPRPDVLANAGELKVIVFNKSDFQWAEEHARLVSDTCKLYLQP- 172

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +     E T L I Y   NPKW +S+QTHK++ I
Sbjct: 173 EWSKAAEMTPLIIDYVMANPKWEISLQTHKYLNI 206


>gi|269102881|ref|ZP_06155578.1| queuosine Biosynthesis QueE Radical SAM [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268162779|gb|EEZ41275.1| queuosine Biosynthesis QueE Radical SAM [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 222

 Score =  187 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 63/235 (26%), Positives = 93/235 (39%), Gaps = 41/235 (17%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------ 56
           +Y + E+F T+QGEG   G  A+F R   C +            C +CDT          
Sbjct: 1   MYKLNEVFETIQGEGVFTGVPAIFVRLQICPV-----------GCSWCDTKQTWSAEPQD 49

Query: 57  -------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNK 109
                  +  T       +  A  I           ++ V+TGGEP +    PL QAL  
Sbjct: 50  FTTLDRIMAKTGDSPLWTEIDAQGIVSLLQDQGYTAKHVVITGGEPCIYDLRPLTQALEA 109

Query: 110 RGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVSP 160
            G++  +ET+GT E       W+ VSPK     K+           E+K  V  Q ++  
Sbjct: 110 SGYQCQIETSGTSEVQATEATWVTVSPKINMKGKLPVLEKALSRANEIKHPVGTQKDLDQ 169

Query: 161 ENYIGFDFE-----RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + +            +LQP+        T L I  C +   WRLS+QTHK++ I
Sbjct: 170 LDELLNGVALRSDVTIALQPISQK--PRATELCIETCIKR-NWRLSIQTHKYLAI 221


>gi|284929204|ref|YP_003421726.1| organic radical activating enzyme [cyanobacterium UCYN-A]
 gi|284809648|gb|ADB95345.1| organic radical activating enzyme [cyanobacterium UCYN-A]
          Length = 208

 Score =  187 bits (475), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 61/218 (27%), Positives = 96/218 (44%), Gaps = 27/218 (12%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           +  Y I E F ++QGEG   G  A F R +GCN+            C +CD        T
Sbjct: 11  LTTYPIAETFHSIQGEGAWTGVSAFFIRLAGCNV-----------GCPWCDQKESWTDKT 59

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
              +Y+ + L+   ++            V+TGGEPL+    PL   L K G +I +ET+G
Sbjct: 60  -FPKYSSEMLSTKAQQA------NASIVVITGGEPLMYNLFPLTDKLRKLGMKIHLETSG 112

Query: 121 TIEPPQGIDWICVSP---KAGCDLKIKGGQELKLVFPQVN---VSPENYIGFDFERF-SL 173
           +       +W+  SP   KA  +       ELK++         + +     + +    L
Sbjct: 113 SYPFSGNFNWVTFSPKPFKAPHESIYVKASELKIIIADQKDFEWAEKQKSKTNSQSINFL 172

Query: 174 QPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           QP          +L   Y  ++P+WR+S+QTHKF+G+R
Sbjct: 173 QPEWNSRTSS--SLIYKYICKHPEWRMSLQTHKFLGVR 208


>gi|71282067|ref|YP_269647.1| hypothetical protein CPS_2947 [Colwellia psychrerythraea 34H]
 gi|71147807|gb|AAZ28280.1| conserved hypothetical protein [Colwellia psychrerythraea 34H]
          Length = 226

 Score =  187 bits (475), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 66/235 (28%), Positives = 98/235 (41%), Gaps = 40/235 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG-- 59
             Y I EIF TLQGEG   G+ ++F R  GC +            C +CDT         
Sbjct: 5   TTYKINEIFETLQGEGSFTGQPSIFIRLQGCPV-----------GCSWCDTKHTWEVSLE 53

Query: 60  ---------TKGGRYNVDQLADLI--EEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                    +K    +   +  ++  +E +++   + ++ V+TGGEP +    PL Q   
Sbjct: 54  QEVAQNNIVSKKSENDSWGIFTIVQLKELFLSEGYQAKHIVITGGEPCMYDLKPLCQNFE 113

Query: 109 KRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKLVFPQVNVSP 160
             G+   VET+GT E       W+ VSPK       K          E+K          
Sbjct: 114 ALGYSCQVETSGTFEIQVSKKCWVTVSPKVNMKGGFKVLKSALLRADEIKHPVATEQHID 173

Query: 161 E-----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +     N    + ++  +QP+     +  T LAI  C +N  WRLSVQ HK+IGI
Sbjct: 174 DLKALLNEHEIENKQIYIQPISQK--KRATELAIRSCIEN-NWRLSVQVHKYIGI 225


>gi|328468975|gb|EGF39935.1| hypothetical protein VP10329_15155 [Vibrio parahaemolyticus 10329]
          Length = 226

 Score =  187 bits (475), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 63/236 (26%), Positives = 93/236 (39%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------ 56
           LY + E+F T+QGEG   G  AVF R   C +            C +CDT          
Sbjct: 5   LYKLNEMFETIQGEGIFTGVPAVFVRLQECPV-----------GCSWCDTKQTWDAEEKD 53

Query: 57  --------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                   ++      +      D++E+    G    ++ V+TGGEP +    PL +A  
Sbjct: 54  QRPIGDILVKTEDSPTWCTASAEDIVEQYKQQG-FNAKHIVITGGEPCIYDLRPLSKAFE 112

Query: 109 KRGFEIAVETNGTIEPPQ-GIDWICVSPKAGCDLKIK-------GGQELKLVF---PQVN 157
             G +  +ET+GT E       W+ VSPK     K+           E+K        ++
Sbjct: 113 DMGCQCQIETSGTSEVVTSEKTWVTVSPKVAMKGKLPVLKSALERANEIKHPVGTQKDID 172

Query: 158 VSPENYIGFDFER---FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              E     D +     +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 173 HLDELLANADIKTETVIALQPISQK--PRATQLCIETCISR-NWRLSIQTHKYLSI 225


>gi|269964054|ref|ZP_06178359.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269831195|gb|EEZ85349.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 226

 Score =  187 bits (475), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 64/237 (27%), Positives = 92/237 (38%), Gaps = 43/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
            LY + E+F T+QGEG   G  AVF R   C +            C +CDT        +
Sbjct: 4   TLYKLNEMFETIQGEGVFTGVPAVFVRLQVCPV-----------GCSWCDTKQTWYAEEE 52

Query: 62  GGR--------------YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
           G R              +      D++ E    G    ++ V+TGGEP +     L  A 
Sbjct: 53  GQRQIGDILVKTEDSPTWCFASAEDIVAEYKKQG-FNAKHIVITGGEPCIYDLRALTAAF 111

Query: 108 NKRGFEIAVETNGTIEPPQ-GIDWICVSPKAGCDLKIK-------GGQELKLV------F 153
            + G +  +ET+GT E       W+ VSPK     K+           E+K         
Sbjct: 112 EEMGCQCQIETSGTSEVVTSESTWVTVSPKVAMKGKLPVLKSALERANEIKHPVGTQKDI 171

Query: 154 PQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            Q++    +    +    +LQP+        T L I  C     WRLSVQTHK++ I
Sbjct: 172 DQLDSLLASADIAEKTVIALQPISQK--PRATQLCIDTCVAR-NWRLSVQTHKYLSI 225


>gi|323491404|ref|ZP_08096589.1| organic radical activating enzyme [Vibrio brasiliensis LMG 20546]
 gi|323314530|gb|EGA67609.1| organic radical activating enzyme [Vibrio brasiliensis LMG 20546]
          Length = 222

 Score =  187 bits (475), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 62/236 (26%), Positives = 95/236 (40%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y I E+F T+QGEG   G  +VF R   C +            C +CDT       T  
Sbjct: 1   MYKINEMFQTIQGEGVFTGVPSVFVRLQECPV-----------GCAWCDTKQTW-DATPQ 48

Query: 63  GRYNVDQLADL--------------IEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
              ++D++                 I  ++       R+ V+TGGEP +    PL  A  
Sbjct: 49  DECSLDEILAKKEDSPAWCSVSAQDIVNEYQKQGYTARHIVITGGEPCIYDLRPLTAAFE 108

Query: 109 KRGFEIAVETNGTIEPPQ-GIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVS 159
             G +  +ET+GT +       W+ VSPK     K+           E+K  V  Q ++ 
Sbjct: 109 AIGCQCQIETSGTYQVDASENTWVTVSPKVAMKGKLPVIDSALLRANEIKHPVATQKDID 168

Query: 160 PENYIGFDFE-----RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             + +    +       +LQP+        T L I  C +   WRLS+QTHK++ I
Sbjct: 169 QLDELLTRAQVPQSTTIALQPISQK--PRATQLCIDTCVER-NWRLSIQTHKYLSI 221


>gi|167751865|ref|ZP_02423992.1| hypothetical protein ALIPUT_00107 [Alistipes putredinis DSM 17216]
 gi|167660106|gb|EDS04236.1| hypothetical protein ALIPUT_00107 [Alistipes putredinis DSM 17216]
          Length = 211

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 60/216 (27%), Positives = 94/216 (43%), Gaps = 26/216 (12%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           +   + E F T+QGEG H G+ A F R  GC++            CR+CD  +       
Sbjct: 14  RKLPLVEDFYTIQGEGFHTGKPAYFIRLGGCDV-----------GCRWCDAKYTW----N 58

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
              Y    +++++         + +  V+TGGEPLL    PL  AL   G +I +ET+G+
Sbjct: 59  PKLYPPTDISEVVRR---ATSCQAQAIVITGGEPLLYPLGPLTSALKGHGLKIFLETSGS 115

Query: 122 IEPPQGIDWICVSPK---AGCDLKIKGGQELKLVFPQVNVSPENYIGFD----FERFSLQ 174
                  DW+C+SPK              ELK++  +           +      +  LQ
Sbjct: 116 HPFSGYFDWVCLSPKRQQPPLPEAFWRAHELKVIVEREADLQWAERNAEQVGRECKLFLQ 175

Query: 175 PMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           P +    EE   L + Y   +P W +S+QTHK++ I
Sbjct: 176 P-EWSVSEEIMPLLVEYVKAHPAWNISIQTHKYMHI 210


>gi|261252909|ref|ZP_05945482.1| queuosine Biosynthesis QueE Radical SAM [Vibrio orientalis CIP
           102891]
 gi|260936300|gb|EEX92289.1| queuosine Biosynthesis QueE Radical SAM [Vibrio orientalis CIP
           102891]
          Length = 222

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 63/236 (26%), Positives = 92/236 (38%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI----- 57
           +Y I E+F T+QGEG   G  +VF R   C +            C +CDT          
Sbjct: 1   MYKINEMFETIQGEGVFTGVPSVFVRLQECPV-----------GCAWCDTKQTWDATPTD 49

Query: 58  ---------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                    +      +      D++ E    G    ++ V+TGGEP +    PL QA  
Sbjct: 50  ERPLNEILAKTEDSPTWCGVSAEDIVNEYKKQG-YTAKHIVITGGEPCIYDLRPLTQAFE 108

Query: 109 KRGFEIAVETNGTIEPPQ-GIDWICVSPKAGCDLKIK-------GGQELKLV------FP 154
           + G +  +ET+GT E       W+ VSPK     K+           E+K          
Sbjct: 109 ENGCQCQIETSGTFEVKATTKTWVTVSPKVAMKGKLPVIDSALLRANEIKHPVATQKDID 168

Query: 155 QVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           Q++   E     +    +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 169 QLDELLERAKVSEQTTVALQPISQK--PRATQLCIDVCVAR-NWRLSIQTHKYLSI 221


>gi|307150184|ref|YP_003885568.1| Radical SAM domain-containing protein [Cyanothece sp. PCC 7822]
 gi|306980412|gb|ADN12293.1| Radical SAM domain protein [Cyanothece sp. PCC 7822]
          Length = 205

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 56/216 (25%), Positives = 92/216 (42%), Gaps = 27/216 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            Y I E F ++QGEG   G  A F R  GC+++           C +CD      +    
Sbjct: 10  TYPIVETFHSIQGEGAWTGVSAFFIRLGGCDVY-----------CPWCDQK----ESWNP 54

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
            R+    + +L+E   +         V+TGGEPL+   +PL + L   G  + +ET+G+ 
Sbjct: 55  KRHPHQSVENLLESAKMAN---PAIVVITGGEPLMHDLIPLTRELQLLGLRVHLETSGSH 111

Query: 123 EPPQGIDWICVSPKA---GCDLKIKGGQELKLVFP---QVNVSPENYIGFDFERF-SLQP 175
                  W+  SPK      +   +   ELK+V      ++ +              LQP
Sbjct: 112 PFSGNFHWVTFSPKPYKRPHESIYEQVNELKVVIANEEDLHWAQRQAAKLPSTVVKYLQP 171

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
                   +  L   +  ++P+WR+S+QTHKF+ +R
Sbjct: 172 EWN--TPNSGALIFEFVLKHPQWRMSLQTHKFLNVR 205


>gi|332170651|gb|AEE19906.1| Radical SAM domain protein [Krokinobacter diaphorus 4H-3-7-5]
          Length = 213

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 59/215 (27%), Positives = 92/215 (42%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + E F T+QGEG H G  A F R  GC++            C +CD      +    
Sbjct: 18  MLPLMEEFYTIQGEGFHKGTAAYFIRVGGCDV-----------GCHWCDVK----ESWDA 62

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             +       + E      +      V+TGGEPL+    PL   L   G    +ET+G  
Sbjct: 63  AIHPPTNANTIAENAAKYSD----TIVVTGGEPLMWDMNPLTHKLKSLGLTTHIETSGAY 118

Query: 123 EPPQGIDWICVSPKAGCDLKI---KGGQELKLVF---PQVNVSPENYIGF-DFERFSLQP 175
           E     DWIC+SPK     K    +   ELK++       + + ++     +     LQP
Sbjct: 119 ELSGEWDWICLSPKKRMLPKASVLEKANELKVIIFNKSDFDFAEKHAAQVGEDCILYLQP 178

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +    ++   L + Y  +NPKW++S+QTHK++ I
Sbjct: 179 -EWSVRDKMVPLIVDYVMKNPKWKVSLQTHKYLNI 212


>gi|150026231|ref|YP_001297057.1| hypothetical protein FP2200 [Flavobacterium psychrophilum JIP02/86]
 gi|149772772|emb|CAL44256.1| Protein of unknown function YgcF [Flavobacterium psychrophilum
           JIP02/86]
          Length = 210

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 57/214 (26%), Positives = 86/214 (40%), Gaps = 25/214 (11%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + E F T+QGEG H G  A F R  GC++            C +CD      +    
Sbjct: 15  MLPLMEEFYTIQGEGYHTGTAAYFIRIGGCDV-----------GCHWCDVK----ESWNA 59

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             +   +   ++E       K  +  V+TGGEPL      L Q L     ++ +ET+G  
Sbjct: 60  ALHPPTKTDVIVE----NATKYAKTIVVTGGEPLTWDMTVLTQRLKAENLQVHIETSGAY 115

Query: 123 EPPQGIDWICVSPKAGC---DLKIKGGQELKLVF---PQVNVSPENYIGFDFERFSLQPM 176
                 DW C+SPK          +   ELK++         + E     +         
Sbjct: 116 PVTGAWDWFCLSPKKNKLPVAEAYEIAHELKVIIYNKHDFIFAEEQAAKVNKNAILFLQS 175

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +    EE T   + Y   NPKWR+S+QTHK++ I
Sbjct: 176 EWSKKEEMTPFIVDYVMNNPKWRVSLQTHKYLNI 209


>gi|91793369|ref|YP_563020.1| radical activating enzyme [Shewanella denitrificans OS217]
 gi|91715371|gb|ABE55297.1| radical activating enzyme [Shewanella denitrificans OS217]
          Length = 222

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 65/237 (27%), Positives = 89/237 (37%), Gaps = 44/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y + E+F T+QGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MNYPVNEVFETIQGEGCFTGVPALFVRLQGCPV-----------GCAWCDTKQTWDVLAD 49

Query: 57  ----------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
                     + GT G   N D     +   +       ++ VLTGGEP L     +   
Sbjct: 50  NKVTPEQVITVDGTIGRWANHD--GASLITAFKAKGFTAKHIVLTGGEPCLYDLTDITHD 107

Query: 107 LNKRGFEIAVETNGTIEPPQGID-WICVSPKAGCDLKIK-------GGQELKLVFPQVNV 158
               G+ + +ET+GT E     D W+ VSPK       K          E+K      N 
Sbjct: 108 FIAAGYSVQIETSGTFEVKCHQDVWVTVSPKINMKGGYKVLEQALIRANEIKHPIATQNH 167

Query: 159 SPE-----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             E       I    +   LQP+        T LA+  C     WRLS+QTHK++ I
Sbjct: 168 IDELDELLADIDLSGKTICLQPISQKV--RATELAMKTCIAR-NWRLSIQTHKYLNI 221


>gi|90414517|ref|ZP_01222492.1| putative organic radical activating enzyme [Photobacterium
           profundum 3TCK]
 gi|90324425|gb|EAS40987.1| putative organic radical activating enzyme [Photobacterium
           profundum 3TCK]
          Length = 222

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 62/236 (26%), Positives = 90/236 (38%), Gaps = 43/236 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +Y I E+F T+QGEG   G  A+F R   C +            C +CDT          
Sbjct: 1   MYKINEVFETIQGEGTFTGVPAIFVRLQVCPV-----------GCSWCDTKQTW-DAEPT 48

Query: 63  GRYNVDQLADL--------------IEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
              +++ +                 I           R+ V+TGGEP +   +PL  AL 
Sbjct: 49  DYASLNDIMAKKGDSPLWTNIDAQGIVALLQDQGYTARHVVITGGEPCIYDLIPLTAALE 108

Query: 109 KRGFEIAVETNGTIEP-PQGIDWICVSPKAGCDLKIK-------GGQELKLV------FP 154
             GF   +ET+GT E       W+ VSPK     K+           E+K          
Sbjct: 109 TAGFNCQIETSGTSEILATEDTWVTVSPKINMKAKLPVLASALSRADEIKHPVGTSKDIE 168

Query: 155 QVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           Q++              +LQP+        T+L I  C +   WRLS+QTHK++ I
Sbjct: 169 QLDTLINGVTLKQNVTIALQPISQK--PRATDLCIETCIKR-NWRLSIQTHKYLAI 221


>gi|227356608|ref|ZP_03840995.1| radical SAM domain protein [Proteus mirabilis ATCC 29906]
 gi|227163364|gb|EEI48291.1| radical SAM domain protein [Proteus mirabilis ATCC 29906]
          Length = 250

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 62/238 (26%), Positives = 92/238 (38%), Gaps = 43/238 (18%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           +  Y I E+F TLQGEG   G  A+F R  GC +            C +CDT     +  
Sbjct: 27  LMQYPINEVFQTLQGEGVFTGVPALFVRLQGCPV-----------GCSWCDTKHTW-EKE 74

Query: 61  KGGRYNVDQLA--------------DLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQA 106
           +  +  +  +               + I   +       ++ V+TGGEP L    PL + 
Sbjct: 75  ESKKVPLGDIPIKTQESDTWGIATVEDILSLFRQQRYSAKHVVITGGEPCLYDLRPLTEG 134

Query: 107 LNKRGFEIAVETNGTIEP-PQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQVNV 158
           L K GF+  +ET+GT +       W+ +SPK G           I    E+K    +   
Sbjct: 135 LEKAGFDCQIETSGTHDILCSEATWVTLSPKVGMRGGLNVLSSAINRANEIKHPVAREKD 194

Query: 159 SPENYIGFDFER------FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                              +LQP+     E  T L I  C +   WR S+QTHK++ I
Sbjct: 195 IEALDDLLRLRTQQPMAIVALQPISCK--ESATALCIKTCIER-NWRFSMQTHKYLNI 249


>gi|319952143|ref|YP_004163410.1| radical sam domain protein [Cellulophaga algicola DSM 14237]
 gi|319420803|gb|ADV47912.1| Radical SAM domain protein [Cellulophaga algicola DSM 14237]
          Length = 215

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 59/215 (27%), Positives = 89/215 (41%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + E F T+QGEG H G  A F R  GC++            C +CD      +    
Sbjct: 20  MLPLMEEFYTIQGEGFHKGTAAYFIRVGGCDV-----------GCHWCDVK----ESWNA 64

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             +       +I        K     V+TGGEPL     PL + L  R  +  +ET+G  
Sbjct: 65  DTHPPTATETII----SNAAKYSDTIVITGGEPLTWDMGPLTKGLKARNLQTHIETSGAY 120

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQ---ELKLVF---PQVNVSPENYIG-FDFERFSLQP 175
                 DWIC+SPK     + +      ELK++         + E            LQP
Sbjct: 121 PLTGVWDWICLSPKKNKLPEGRIYDEAHELKMIIFNKHDFIFAEEQAAKTNKECILYLQP 180

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +    ++   L + Y  +NPKW++S+QTHK++ I
Sbjct: 181 -EWSVRDKMVPLIVDYVMKNPKWKVSLQTHKYLNI 214


>gi|78780168|ref|YP_398280.1| putative organic radical activating protein [Prochlorococcus
           marinus str. MIT 9312]
 gi|78713667|gb|ABB50844.1| organic radical activating enzyme-like protein [Prochlorococcus
           marinus str. MIT 9312]
          Length = 225

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 66/242 (27%), Positives = 104/242 (42%), Gaps = 48/242 (19%)

Query: 1   MKL---YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI 57
           MK+     + E F +LQGEG HAG+ A F R +GC              C +CDT     
Sbjct: 1   MKMTNFLPLVEQFHSLQGEGYHAGKSAFFVRLAGC-----------EVGCSWCDTKHSWD 49

Query: 58  QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN-------KR 110
           +     +Y    +  +I+   I  E+   +CV+TGGEPL        +A+        + 
Sbjct: 50  E----NKYPSVSIEKIIDRIKIAREQGASFCVITGGEPLQHNLDKFCKAIKQMKMGKEQN 105

Query: 111 GFEIAVETNGTIEPPQGIDWICVSPKAGCDLKI---KGGQELKLVFPQVNV--------- 158
             +I +ET+G        DWI +SPK     K    K   E+K++  +            
Sbjct: 106 SMKIHIETSGVNSISGSYDWITLSPKRHSPPKNYFLKNCNEIKIIINEKEDIEFAIQIKK 165

Query: 159 ---------SPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIG 209
                      E+ +  + + F LQP      ++  +LAI +   NP W+LS+QTHK++ 
Sbjct: 166 EILKQYEFSKIEDSLKKEDKIFYLQPAWN--NKDGFSLAIDFVKNNPDWKLSLQTHKYLK 223

Query: 210 IR 211
           I+
Sbjct: 224 IK 225


>gi|123967114|ref|YP_001012195.1| putative organic radical activating protein [Prochlorococcus
           marinus str. MIT 9515]
 gi|123201480|gb|ABM73088.1| possible organic radical activating enzyme [Prochlorococcus marinus
           str. MIT 9515]
          Length = 223

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 63/238 (26%), Positives = 103/238 (43%), Gaps = 45/238 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               + E F +LQGEG H G+ A F R +GCN+            C +CDT         
Sbjct: 3   NFLPLVEKFHSLQGEGFHTGQSAFFIRLAGCNV-----------GCPWCDTKH----SWD 47

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKR-------GFEI 114
             ++ +  + ++I E     ++   + V+TGGEPL      L QA+N+          +I
Sbjct: 48  KEKFPLISIQEIINEIKRARKQGASFLVITGGEPLHHNLDNLCQAINEETSTENQSPIKI 107

Query: 115 AVETNGTIEPPQGIDWICVSPKAGCDLKI---KGGQELKLVFPQ-------VNVSPENYI 164
            +ET+G        DWI +SPK     K    K   ELK++          +++  E   
Sbjct: 108 HIETSGVSNLSGSFDWITLSPKRHQPPKTYFLKNCNELKIIINDQKDIDFAIDIKQEIMN 167

Query: 165 GFD-----------FERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            +             +++ LQP      ++  +L I +   NP+W LS+QTHK++ I+
Sbjct: 168 KYQNSSSTKNFYKLDKKYYLQPAWQ--NDDGFSLTIDFIKNNPEWNLSLQTHKYLKIK 223


>gi|170076908|ref|YP_001733546.1| radical SAM domain-containing protein [Synechococcus sp. PCC 7002]
 gi|169884577|gb|ACA98290.1| Radical SAM domain protein [Synechococcus sp. PCC 7002]
          Length = 218

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 62/218 (28%), Positives = 93/218 (42%), Gaps = 31/218 (14%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            Y I E F ++QGEG   G  A F R +GC++            C +CDT          
Sbjct: 23  TYPIVETFHSIQGEGFWCGTAAFFIRLAGCDV-----------GCPWCDTKI----SWNP 67

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
            R+    +  L E+       + +  V+TGGEPL+    PL   L + G  + +ET+G  
Sbjct: 68  KRHPQVSVGQLKEQVQTA---QPKIIVITGGEPLMHDLYPLTTGLKETGIPLHLETSGAH 124

Query: 123 EPPQGIDWICVSP---KAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERF------SL 173
                 DW+ +SP   KA          ELK+V  Q   +   +     ++        L
Sbjct: 125 PLNGHFDWLTLSPKPFKAPLPEIYDHVSELKVVIDQA--TDFQWAESQVQKIAANIPKYL 182

Query: 174 QPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           QP        + +L   Y   +P+WRL +QTHKF+G+R
Sbjct: 183 QP--QWENPASQSLIFDYILAHPEWRLGLQTHKFLGVR 218


>gi|237809236|ref|YP_002893676.1| radical activating enzyme [Tolumonas auensis DSM 9187]
 gi|237501497|gb|ACQ94090.1| radical activating enzyme [Tolumonas auensis DSM 9187]
          Length = 225

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 61/239 (25%), Positives = 86/239 (35%), Gaps = 44/239 (18%)

Query: 1   MKL--YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG-- 56
           M    Y I EIF ++QGEG  +G  A+F R  GC              C +CDT      
Sbjct: 1   MMSNHYPINEIFQSIQGEGFFSGVPAIFVRLQGC-----------KVGCSWCDTKHSWEL 49

Query: 57  ------------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                               ++     + I   +   E   R+ V+TGGEP     + L 
Sbjct: 50  DADNLIPVRQLFTDKKPKAGWSWLS-PEEILSCFSAEEYTARHVVITGGEPCEYDLMVLS 108

Query: 105 QALNKRGFEIAVETNGTIEPPQGI-DWICVSPKAGC-------DLKIKGGQELKLVFPQV 156
           Q L   G+ + +ET+GT         W+ VSPK             +    E+K      
Sbjct: 109 QTLIAHGYRVQIETSGTQPVQADDACWVTVSPKINMAGGYDVLPDVLLRANEIKHPVATA 168

Query: 157 NVSPENYIGFD-----FERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               +            +   LQP+        T LA+  C Q   WRLSVQ HK++ I
Sbjct: 169 KHIAQLDALLAGIDTSEKVICLQPISQK--SRATELAMKICIQR-NWRLSVQLHKYLDI 224


>gi|154490137|ref|ZP_02030398.1| hypothetical protein PARMER_00367 [Parabacteroides merdae ATCC
           43184]
 gi|154089029|gb|EDN88073.1| hypothetical protein PARMER_00367 [Parabacteroides merdae ATCC
           43184]
          Length = 180

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 76/208 (36%), Positives = 100/208 (48%), Gaps = 29/208 (13%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGEG H G  AVF RFSGCNL            C FCDT        +G
Sbjct: 1   MRKINEIFYSLQGEGFHTGTPAVFVRFSGCNLK-----------CSFCDTRH-----EEG 44

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              + + +   I              +LTGGEP L +D   I  L+  G  I +ETNGT 
Sbjct: 45  ILMSDEDILQAISA------FPSNVVILTGGEPSLWIDQTFIDLLHMAGKYICIETNGTN 98

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLE 182
             P+GIDW+  SPK G  L++    E+K+V+   +++   Y G       LQP       
Sbjct: 99  PLPEGIDWVTCSPK-GFPLRLTHIDEIKVVYTGQDLT--EYAGLKATWHFLQPCSCL--- 152

Query: 183 ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            NT   + Y   +P+W LS+QTHK I I
Sbjct: 153 -NTKEVVEYILHHPQWHLSLQTHKLIDI 179


>gi|312887506|ref|ZP_07747102.1| Radical SAM domain protein [Mucilaginibacter paludis DSM 18603]
 gi|311299994|gb|EFQ77067.1| Radical SAM domain protein [Mucilaginibacter paludis DSM 18603]
          Length = 207

 Score =  185 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 61/216 (28%), Positives = 93/216 (43%), Gaps = 26/216 (12%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
            L  + E F T+QGEG + G+ A F R  GC++            C +CD        + 
Sbjct: 10  TLLPLMEEFYTIQGEGYNTGKAAYFIRLGGCDV-----------GCHWCDVKESW-DASI 57

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
                 D + D         +  G+  V+TGGEPL+     L   L ++G +  +ET+G 
Sbjct: 58  HPLTPSDTIVD------NAVKYPGKAVVVTGGEPLIYNLDYLTAQLQQKGIKTFIETSGA 111

Query: 122 IEPPQGIDWICVSP---KAGCDLKIKGGQELK-LVFPQVNVSPENYIGFDF---ERFSLQ 174
                  DWIC+SP   KA          ELK +VF + + +             +  LQ
Sbjct: 112 YPLSGSWDWICLSPKKFKAPSASVAPYAHELKVIVFNKSDFAWAEQYAALVSPGCKLYLQ 171

Query: 175 PMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           P +    +E   L + Y   NP+W +S+QTHK++ I
Sbjct: 172 P-EWSKSKEMIPLIVDYVMNNPQWEISLQTHKYLNI 206


>gi|15641377|ref|NP_231009.1| hypothetical protein VC1365 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|153819362|ref|ZP_01972029.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|153821325|ref|ZP_01973992.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|227081536|ref|YP_002810087.1| hypothetical protein VCM66_1320 [Vibrio cholerae M66-2]
 gi|229505054|ref|ZP_04394564.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae BX 330286]
 gi|229511276|ref|ZP_04400755.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae B33]
 gi|229518394|ref|ZP_04407838.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae RC9]
 gi|229608058|ref|YP_002878706.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae MJ-1236]
 gi|254848487|ref|ZP_05237837.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|298498551|ref|ZP_07008358.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9655859|gb|AAF94523.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|126510107|gb|EAZ72701.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|126521143|gb|EAZ78366.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|227009424|gb|ACP05636.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|229345109|gb|EEO10083.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae RC9]
 gi|229351241|gb|EEO16182.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae B33]
 gi|229357277|gb|EEO22194.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae BX 330286]
 gi|229370713|gb|ACQ61136.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae MJ-1236]
 gi|254844192|gb|EET22606.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|297542884|gb|EFH78934.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 245

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 62/235 (26%), Positives = 91/235 (38%), Gaps = 41/235 (17%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQ---- 58
           LY I E+F  +QGEG   G  AVF R  GC +            C +CDT          
Sbjct: 24  LYRINEMFEIIQGEGVFTGVPAVFVRLQGCPV-----------GCAWCDTKQTWETLDSD 72

Query: 59  ---------GTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNK 109
                     T          A  + +++     + ++ V+TGGEP +     L QA   
Sbjct: 73  QTSFSQILLKTNDAPTWCQATAQEVVQRYQAQGYQAKHIVITGGEPCIYDLTELTQAFEA 132

Query: 110 RGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVSP 160
            G    +ET+GT E       W+ VSPK     K+           E+K  V  + ++  
Sbjct: 133 MGCRCQIETSGTYEVCATENTWVTVSPKVAMKGKLPILDSALQRANEIKHPVATEKDIDN 192

Query: 161 ENYIGFDFER-----FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            + +    +       +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 193 LDELLARAQVSAQTAIALQPISQK--PRATELCIRTCIAR-NWRLSIQTHKYLNI 244


>gi|312884429|ref|ZP_07744133.1| hypothetical protein VIBC2010_14679 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367741|gb|EFP95289.1| hypothetical protein VIBC2010_14679 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 238

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 62/237 (26%), Positives = 99/237 (41%), Gaps = 43/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           KLY + E+F T+QGEG   G  +VF R   C +            C +CDT       + 
Sbjct: 16  KLYKVNEMFETIQGEGVFTGVPSVFVRLQECPV-----------GCAWCDTKQTW-DASP 63

Query: 62  GGRYNVDQL--------------ADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
                + ++              A+ +  +++      R+ V+TGGEP +   +PL +A 
Sbjct: 64  KDERTLKEILSKTTDSPTWCRASANDVVSEYLRQGYTARHIVITGGEPCIYDLIPLTEAF 123

Query: 108 NKRGFEIAVETNGTIEPPQGID-WICVSPKAGCDLKIK-------GGQELKL-VFPQVNV 158
                +  +ET+GT E     + W+ VSPK     K+           ELK  V  Q ++
Sbjct: 124 EAINCKCQIETSGTSEVITSPNTWVTVSPKIAMKGKLPVLPSALIRANELKHPVATQKDI 183

Query: 159 SPENYI-----GFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              + +       +    +LQP+        T L I  C +   WRLS+QTHK++ I
Sbjct: 184 DRLDDLLSGVSLSEDTEIALQPISQK--PRATELCIEVCIKR-NWRLSIQTHKYLSI 237


>gi|159030634|emb|CAO88302.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 224

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 62/218 (28%), Positives = 94/218 (43%), Gaps = 31/218 (14%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            Y + E F ++QGEG   G  A F R  GC+++           C +CD      +    
Sbjct: 29  TYPVVETFHSVQGEGFWTGSNAFFLRLGGCDVY-----------CPWCDQK----ESWNA 73

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
            RY    L +L+E   +  +      V+TGGEPL+    PL +    +G  + +ET+G  
Sbjct: 74  HRYPQKSLGELVE---MAKDANPAMVVITGGEPLMHNLAPLTEEFKNQGLRVHLETSGAH 130

Query: 123 EPPQGIDWICVSP---KAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERF------SL 173
                 DW+  SP   K           ELK+V    N    ++      +        L
Sbjct: 131 PFTGVFDWVTFSPKTYKMPDPSIYARVNELKIVV--ANPEDLDWAAMQESKLSEGVIKYL 188

Query: 174 QPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           QP       E+  L  +Y  ++P+WRLS+QTHKF+G+R
Sbjct: 189 QPEWN--TAESKELVFNYVLRHPQWRLSLQTHKFLGVR 224


>gi|119944858|ref|YP_942538.1| radical SAM domain-containing protein [Psychromonas ingrahamii 37]
 gi|119863462|gb|ABM02939.1| Radical SAM domain protein [Psychromonas ingrahamii 37]
          Length = 246

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 59/234 (25%), Positives = 90/234 (38%), Gaps = 41/234 (17%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------- 56
           Y + E+F T+QGEG + G  A+F R  GC++            C +CDT           
Sbjct: 26  YKVNELFQTIQGEGFNTGVPAIFLRLQGCDV-----------GCAWCDTKHTWEINPDKQ 74

Query: 57  ------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKR 110
                    +       +  A  I  +           V+TGGEP L     L   L++ 
Sbjct: 75  TELILLTGSSNESTRWANVNAREIVAEIKRLGYSANLVVITGGEPCLADLRELTTVLHEF 134

Query: 111 GFEIAVETNGTIEP-PQGIDWICVSPKAGC-------DLKIKGGQELKLV------FPQV 156
            F+  +ET+GT         W+ +SPK             ++   E+K          Q+
Sbjct: 135 DFKTQIETSGTYPVLVAPPTWVTLSPKVNMRAGKVVLQSALERADEIKHPVGTEKDIEQL 194

Query: 157 NVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +   EN    + +   LQP+      + T L    C +   WRLSVQ HK++GI
Sbjct: 195 DALLENLKSIEDKVICLQPISQKV--KATLLCSQVCIER-NWRLSVQMHKYLGI 245


>gi|298207940|ref|YP_003716119.1| hypothetical protein CA2559_06800 [Croceibacter atlanticus
           HTCC2559]
 gi|83850581|gb|EAP88449.1| hypothetical protein CA2559_06800 [Croceibacter atlanticus
           HTCC2559]
          Length = 210

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 58/216 (26%), Positives = 92/216 (42%), Gaps = 27/216 (12%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           K+  + E F T+QGEG H G  A F R  GC++            C +CD      +   
Sbjct: 14  KMLPLMEEFYTIQGEGYHKGTAAYFIRIGGCDV-----------GCHWCDVK----ESWD 58

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
             ++       ++ E      K  +  V+TGGEPL      L Q L   G +  +ET+G 
Sbjct: 59  AEKHPPTATERIVSE----AVKYSKTIVVTGGEPLTWDMTLLTQMLKAEGAQTHIETSGA 114

Query: 122 IEPPQGIDWICVSPKA---GCDLKIKGGQELKLVF---PQVNVSPENYIGFD-FERFSLQ 174
                  DWIC+SPK          +   ELK++      +  + E     +      LQ
Sbjct: 115 YTLTGKWDWICLSPKKLKLPTKEVYEKANELKVIIFNKHDLKFAEEQAAKVNKDCILYLQ 174

Query: 175 PMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           P +    ++   L + +   NP+W++S+QTHK++ I
Sbjct: 175 P-EWSVRDKVVPLIVDFVMANPQWKVSLQTHKYLNI 209


>gi|332042673|gb|EGI78873.1| Radical SAM domain protein [Lacinutrix algicola 5H-3-7-4]
          Length = 209

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 58/216 (26%), Positives = 92/216 (42%), Gaps = 27/216 (12%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           K+  + E F T+QGEG H G  A F R  GC++            C +CD      +   
Sbjct: 13  KMLPLMEEFYTIQGEGFHKGTAAYFVRIGGCDV-----------GCHWCDVK----ESWI 57

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
              +   +   ++       ++  +  V+TGGEPL      L + L   G  I +ET+G 
Sbjct: 58  AQLHPPTETEKIVA----NAKQYSKTIVVTGGEPLTWDMTELTKQLKAEGMNIHIETSGA 113

Query: 122 IEPPQGIDWICVSPKA---GCDLKIKGGQELKLVFPQVN---VSPENYIGFD-FERFSLQ 174
            E     DWIC+SPK              ELK +    +    + E     +      LQ
Sbjct: 114 YELTGEWDWICLSPKKMKLPTQGVYDKANELKCIIYNKDDFRFAEEQAEKVNGDCILYLQ 173

Query: 175 PMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           P +    ++   + + Y  +NPKW++S+QTHK++ I
Sbjct: 174 P-EWSKRDKVVPMIVDYVMENPKWKVSLQTHKYLNI 208


>gi|172035924|ref|YP_001802425.1| hypothetical protein cce_1008 [Cyanothece sp. ATCC 51142]
 gi|171697378|gb|ACB50359.1| hypothetical protein cce_1008 [Cyanothece sp. ATCC 51142]
          Length = 213

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 63/218 (28%), Positives = 92/218 (42%), Gaps = 27/218 (12%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           +  Y I EIF +LQGEG   G  A F R +GC++            C +CD      +  
Sbjct: 16  LMTYPIVEIFHSLQGEGTWTGMSAFFIRLAGCDV-----------HCPWCDQK----ESW 60

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
               Y    +  L               V+TGGEPL+    PL +AL K G  + +ET+G
Sbjct: 61  TSKIYPQQSIKTL---AEAAKAANPAMVVITGGEPLMYDLFPLTKALKKLGLRVHLETSG 117

Query: 121 TIEPPQGIDWICVSP---KAGCDLKIKGGQELKLVF---PQVNVSPENYIGFDFERF-SL 173
                   DW+ +SP   K   +       ELK+V       + + E       +    L
Sbjct: 118 AYPFSGQFDWVTLSPKPFKVPHESIYPQVNELKVVITNQEDFHWAEEQEKKVPPQALKYL 177

Query: 174 QPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           QP       E+ +L   Y  + P+WR+S+Q HKF+G+R
Sbjct: 178 QPEWN--YPESQSLIFDYIRKAPQWRMSLQIHKFLGVR 213


>gi|326336650|ref|ZP_08202818.1| GntS protein [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325691120|gb|EGD33091.1| GntS protein [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 205

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 55/215 (25%), Positives = 96/215 (44%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + E F T+QGEG + G  A F R +GCN+            C +CD      +    
Sbjct: 10  VLPLMESFYTIQGEGFYKGTAAYFIRLAGCNV-----------GCHWCDVK----ESWDA 54

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             + +  +  ++EE +       +  ++TGGEPL+    PL + L  +G    +ET+G  
Sbjct: 55  SIHTLVPIKTMVEEAFKF----SKIAIITGGEPLMYNLDPLTELLRSKGIRTHIETSGAH 110

Query: 123 EPPQGIDWICVSPKAGC---DLKIKGGQELKLVFPQVN---VSPENYIGFDFERF-SLQP 175
                 DWIC+SPK          +   ELK++    +    + E  +    +    LQP
Sbjct: 111 PLTGVWDWICLSPKKNKRPLPPIHQKANELKMIIYNQHDFLFAEEMSVLTRTDCIRYLQP 170

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +    E+     + Y  ++P+W++S+Q HK++ I
Sbjct: 171 -EWSRREKMIPKMVEYVMEHPQWKISLQMHKYLNI 204


>gi|124024647|ref|YP_001018954.1| organic radical activating protein [Prochlorococcus marinus str.
           MIT 9303]
 gi|123964933|gb|ABM79689.1| possible organic radical activating enzyme [Prochlorococcus marinus
           str. MIT 9303]
          Length = 226

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 64/239 (26%), Positives = 92/239 (38%), Gaps = 48/239 (20%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F ++QGEG H GR A F R +GC++            C +CDT           
Sbjct: 5   LPVVETFHSIQGEGAHVGRSAFFIRLAGCDV-----------GCSWCDTKH----SWNSR 49

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKR-------GFEIAV 116
            +    +  L  E     +    + VLTGGEPL     PL +AL++           I +
Sbjct: 50  NHPQIAVEQLAVETATAAKNGAAFVVLTGGEPLQHNIAPLCEALHRATETNPDGPLPIHL 109

Query: 117 ETNGTIEPPQGIDWICVSPKAGCDLKIK---GGQELKLVFPQ----------VNVSPENY 163
           ET+G  +      WI +SPK     +        ELK+V  +             +    
Sbjct: 110 ETSGVNQLSGVPTWITLSPKRHAPPRTDLLAACHELKVVVHERGDLNFAESMAQAALAAR 169

Query: 164 IGFDFER-----------FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              D  +             LQP  G        LA  +   +P WRLS+QTHK++GIR
Sbjct: 170 KNDDASQSRLSNASKEPLLFLQP--GWATTTGQQLAFEHVQSHPHWRLSMQTHKWLGIR 226


>gi|291514643|emb|CBK63853.1| Organic radical activating enzymes [Alistipes shahii WAL 8301]
          Length = 211

 Score =  184 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 60/216 (27%), Positives = 96/216 (44%), Gaps = 26/216 (12%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           ++  + E F T+QGEG HAG+ A F R  GC++            CR+CD  +       
Sbjct: 14  RMLPLVEDFYTIQGEGFHAGKPAYFIRLGGCDV-----------GCRWCDAKYTW----N 58

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
              Y    +  +I+          +  V+TGGEPLL     L + L +RG +I +ET+G+
Sbjct: 59  PKLYPPTDVQTVIDR---AMSCPAQAIVITGGEPLLYPLGVLTETLRERGLQIFLETSGS 115

Query: 122 IEPPQGIDWICVSPK---AGCDLKIKGGQELKLVFP-QVNVSPENYIGFDF---ERFSLQ 174
                  DW+C+SPK      D   +   ELK++   + +                  LQ
Sbjct: 116 HPFSGVFDWVCLSPKRRQPPLDEAFERADELKVIVESEEDFEWAERNAARVGGKCLLFLQ 175

Query: 175 PMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           P +    E+     + Y   +P+W +S+QTHK++ I
Sbjct: 176 P-EWSVAEKVMPAIVEYAKAHPQWNISIQTHKYMHI 210


>gi|78185803|ref|YP_378237.1| organic radical activating protein [Synechococcus sp. CC9902]
 gi|78170097|gb|ABB27194.1| possible organic radical activating enzyme [Synechococcus sp.
           CC9902]
          Length = 205

 Score =  184 bits (467), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 64/215 (29%), Positives = 94/215 (43%), Gaps = 25/215 (11%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            + E F +LQGEG H GR A F R +GCN+            C +CDT            
Sbjct: 8   PVVETFHSLQGEGHHYGRSAFFIRLAGCNV-----------GCTWCDTKH----SWPMAN 52

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKR-GFEIAVETNGTIE 123
           +    +  L  +     +    + V+TGGEPL     PL  AL++  G  I +ET+G  +
Sbjct: 53  HAKQDVDALAVQATQAKDAGAAFVVITGGEPLHHNLQPLTDALDRSCGLPIHLETSGVDQ 112

Query: 124 PPQGIDWICVSPKAGCDLKI---KGGQELKLVFPQVNVSPENYIGFD----FERFSLQPM 176
                DW+ +SPK     +        ELK+V    +     +   +         +QP+
Sbjct: 113 LSGRFDWVTLSPKRHHPPQQALLSRCDELKVVVLDTDDVSFAHAMANDTSTAAHLLVQPV 172

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
                E    LAI +  Q+P+WRLS+Q HKF+ IR
Sbjct: 173 W--DSETAQELAIHHVKQHPRWRLSLQNHKFLQIR 205


>gi|305665081|ref|YP_003861368.1| hypothetical protein FB2170_02240 [Maribacter sp. HTCC2170]
 gi|88709833|gb|EAR02065.1| hypothetical protein FB2170_02240 [Maribacter sp. HTCC2170]
          Length = 210

 Score =  184 bits (467), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 57/215 (26%), Positives = 92/215 (42%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + E F T+QGEG H G  A F R  GC++            C +CD      +    
Sbjct: 15  MLPLMEEFYTIQGEGYHKGTAAYFVRVGGCDV-----------GCHWCDVK----ESWDA 59

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             +    +  ++    +  +      V+TGGEPL     PL QAL  +     +ET+G  
Sbjct: 60  ETHPPTDIKSIVVNAAVYSD----TIVVTGGEPLTWDMGPLTQALKSKNINTHIETSGAY 115

Query: 123 EPPQGIDWICVSPKAGCDL---KIKGGQELKLVF---PQVNVSPENYIGF-DFERFSLQP 175
           +     DWIC+SPK          +   ELK++      +  + E            LQP
Sbjct: 116 KLTGDWDWICLSPKKNKLPSGLIYEKAHELKVIVYNKHDLIFAEEQAAQVGKNCILYLQP 175

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +    ++   + + Y  +NPKW++S+QTHK++ I
Sbjct: 176 -EWSVRDKVVPMIVEYVMKNPKWKVSLQTHKYLNI 209


>gi|149369786|ref|ZP_01889637.1| hypothetical protein SCB49_01894 [unidentified eubacterium SCB49]
 gi|149356277|gb|EDM44833.1| hypothetical protein SCB49_01894 [unidentified eubacterium SCB49]
          Length = 209

 Score =  183 bits (466), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 57/215 (26%), Positives = 91/215 (42%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + E F T+QGEG + G  A F R  GC++            C +CD      +    
Sbjct: 14  ILPLMEEFYTIQGEGYYKGTAAYFIRIGGCDV-----------GCHWCDVK----ESWNP 58

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             +    +  + +       K  +  V+TGGEPL+    PL + L  +G    +ET+G  
Sbjct: 59  DIHPPTSIETIAD----NAAKYSKTIVITGGEPLMWDMNPLTELLKSKGVNTHIETSGAY 114

Query: 123 EPPQGIDWICVSPKA---GCDLKIKGGQELKLVFPQVN---VSPENYIGFDF-ERFSLQP 175
                 DWIC+SPK              ELK++    +    + E     +   +  LQP
Sbjct: 115 SLSGTWDWICLSPKKMKLPTPEVYAAAHELKMIIYNKDDFRFAEEQASKVNADCKLFLQP 174

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +    ++     + Y  QNPKW +S+QTHK++ I
Sbjct: 175 -EWSKRDKMVPEIVDYVMQNPKWVVSLQTHKYLNI 208


>gi|254246872|ref|ZP_04940193.1| conserved hypothetical protein [Burkholderia cenocepacia PC184]
 gi|124871648|gb|EAY63364.1| conserved hypothetical protein [Burkholderia cenocepacia PC184]
          Length = 207

 Score =  183 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 88/150 (58%), Positives = 106/150 (70%), Gaps = 2/150 (1%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y++KEIF TLQGEG +AGR AVFCRF+GCNLWSGRE+DR  A CRFCDTDFVG  G  
Sbjct: 1   MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAVCRFCDTDFVGTDGEN 60

Query: 62  GGRY-NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           GG++ +   L   I   W  GE   R+ V TGGEP+LQ+D PL+ AL+  GFEIA+ETNG
Sbjct: 61  GGKFKDAAALVATIAGLWPEGEAN-RFVVCTGGEPMLQLDQPLVDALHAAGFEIAIETNG 119

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELK 150
           ++   + IDWICVSPKA   L +  G ELK
Sbjct: 120 SLPVLESIDWICVSPKADAPLVVTKGNELK 149


>gi|166365320|ref|YP_001657593.1| hypothetical protein MAE_25790 [Microcystis aeruginosa NIES-843]
 gi|166087693|dbj|BAG02401.1| hypothetical protein MAE_25790 [Microcystis aeruginosa NIES-843]
          Length = 205

 Score =  183 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 62/218 (28%), Positives = 94/218 (43%), Gaps = 31/218 (14%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            Y + E F ++QGEG   G  A F R  GC+++           C +CD      +    
Sbjct: 10  TYPVVETFHSVQGEGFWTGSNAFFLRLGGCDVY-----------CPWCDQK----ESWNA 54

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
            RY    L +L+E   +         V+TGGEPL+    PL + L  +G  + +ET+G  
Sbjct: 55  HRYPQQSLRELVE---MAKGANPAMVVITGGEPLMHNLDPLTKELKNQGLRVHLETSGAH 111

Query: 123 EPPQGIDWICVSP---KAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERF------SL 173
                 DW+  SP   K           ELK+V    +    ++      +        L
Sbjct: 112 PFTGVFDWVTFSPKTYKMPDPSIYARVNELKIVV--AHPEDLDWASMQESKLSEGVIKYL 169

Query: 174 QPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           QP       E+  L  +Y  ++P+WRLS+QTHKF+G+R
Sbjct: 170 QPEWN--TAESKELVFNYVLRHPQWRLSLQTHKFLGVR 205


>gi|149191047|ref|ZP_01869307.1| organic radical activating enzyme [Vibrio shilonii AK1]
 gi|148835075|gb|EDL52052.1| organic radical activating enzyme [Vibrio shilonii AK1]
          Length = 226

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 66/236 (27%), Positives = 92/236 (38%), Gaps = 41/236 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             + I E+F T+QGEG   G  AVF R   CN+            C +CDT        +
Sbjct: 4   TRFKINEMFETIQGEGMFTGVPAVFIRLQICNV-----------GCSWCDTKQTWDANNE 52

Query: 62  GGR-------------YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
             R                D  A  I   + + +   ++ V+TGGEP       L +A  
Sbjct: 53  DQRSFGEIITKQGDSPTWSDVDAAEIVAMYQSQQFNAKHIVITGGEPCEYDLTALCEAFE 112

Query: 109 KRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKLVFP---QVN 157
             G    +ET+GT E     + W+ VSPK     K+           E+K        V+
Sbjct: 113 AIGCRCQIETSGTSEIRVTPVTWVTVSPKVAMKGKLPVLSSSLERADEIKHPVATQKNVD 172

Query: 158 VSPENYIGFDFE---RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              E   G + +     +LQP+        T L I  C Q   WRLSVQTHK++ I
Sbjct: 173 QLDELLQGVELKSDVVIALQPISQK--PRATELCIETCIQR-NWRLSVQTHKYLSI 225


>gi|284009093|emb|CBA76077.1| conserved hypothetical protein [Arsenophonus nasoniae]
          Length = 224

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 64/238 (26%), Positives = 91/238 (38%), Gaps = 44/238 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I +IF T+QGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MDYPINQIFQTIQGEGYFTGVAAIFVRLQGCPV-----------GCSWCDTKHTWAKNKQ 49

Query: 57  ---------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
                     + +    +       +I+  +       R+ V+TGGEP L     L   L
Sbjct: 50  QQRPLSIILAKKSDNEEWATCSSEQIID-LFEQNHYTARHIVITGGEPCLYDLTELTTNL 108

Query: 108 NKRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNV 158
            K+G++  +ET+GT         W+ VSPK       K          E+K  V  Q ++
Sbjct: 109 EKKGYQCQIETSGTHNIYCSEKTWVTVSPKVAMRGGYKILPAALNRANEIKHPVGRQRDI 168

Query: 159 SPENYI------GFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               Y+              LQP+        TNL I  C +   WRLSVQ HK++ I
Sbjct: 169 DALEYLINQLAPNHPAPHICLQPISQ--NANATNLCIETCIKR-NWRLSVQMHKYLDI 223


>gi|315126983|ref|YP_004068986.1| queC protein [Pseudoalteromonas sp. SM9913]
 gi|315015497|gb|ADT68835.1| queC protein [Pseudoalteromonas sp. SM9913]
          Length = 215

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 57/228 (25%), Positives = 88/228 (38%), Gaps = 40/228 (17%)

Query: 9   IFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------------ 56
           +F T+QGE    G  ++F R  GC +            C +CDT                
Sbjct: 1   MFETIQGEASFTGTPSIFLRLQGCPV-----------GCSWCDTKQTWDVDNVYKVSLDD 49

Query: 57  -IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIA 115
            ++      +  +  A  + E + +     ++ V+TGGEP +    P+   L+  GF   
Sbjct: 50  TVEKKADSDHWAEASAAQVLELFKSRGYTAKHVVITGGEPCMYDLNPVCNLLHDHGFSTQ 109

Query: 116 VETNGTIEP-PQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQVNVSPENYIGF- 166
           +ET+GT E       W+ VSPK             ++   E+K          E    F 
Sbjct: 110 IETSGTFEILAPAQTWVTVSPKINMRGGYKVLSSAMQRADEIKHPVAMQKHVEELEELFT 169

Query: 167 ----DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               + +   LQP+        T LAI  C     WRLS+Q HK++GI
Sbjct: 170 ATGVNPKLVYLQPISQKTS--ATKLAIDTCIAK-NWRLSIQVHKYLGI 214


>gi|228473183|ref|ZP_04057938.1| radical SAM domain protein [Capnocytophaga gingivalis ATCC 33624]
 gi|228275333|gb|EEK14125.1| radical SAM domain protein [Capnocytophaga gingivalis ATCC 33624]
          Length = 200

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 55/216 (25%), Positives = 92/216 (42%), Gaps = 27/216 (12%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
            +  + E F T+QGEG + G  A F R +GC++            C +CD        + 
Sbjct: 4   TILPLMEDFYTIQGEGFYRGTAAYFIRLAGCDV-----------GCHWCDVKESW-DASV 51

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
             R  ++++A              +  ++TGGEPL+    PL + L  +G    +ET+G 
Sbjct: 52  HPRVPIEEIAQRALA-------HSKTIIITGGEPLMYNLQPLTELLKSKGARTHIETSGA 104

Query: 122 IEPPQGIDWICVSPKAGC---DLKIKGGQELKLVFPQVN----VSPENYIGFDFERFSLQ 174
                  DWIC+SPK          +   ELK++    +        + +        LQ
Sbjct: 105 HPLTGVWDWICLSPKKNKRPLPEVHQRASELKMIIYNHHDFLFAEEMSALTQPDCIRYLQ 164

Query: 175 PMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           P +    E    L + Y  +NP+W++S+Q HK++ I
Sbjct: 165 P-EWSRRERMVPLIVDYVMENPQWKISLQMHKYLDI 199


>gi|284036696|ref|YP_003386626.1| organic radical activating enzyme [Spirosoma linguale DSM 74]
 gi|283815989|gb|ADB37827.1| organic radical activating enzyme [Spirosoma linguale DSM 74]
          Length = 216

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 62/215 (28%), Positives = 94/215 (43%), Gaps = 27/215 (12%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F T+QGEG H GR A F R  GC++            C +CD      +     
Sbjct: 20  LPVMEAFYTIQGEGAHTGRAAYFIRLGGCDV-----------GCHWCDVK----ESWDAD 64

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIE 123
            +    +  L++      +  GR  V+TGGEPL+     L +AL   GF+  +ET+G  +
Sbjct: 65  AHPKQSIDALVK---GALQYPGRLAVITGGEPLMHDLTALTEALQVAGFKTNIETSGVCQ 121

Query: 124 PPQG-IDWICVSP---KAGCDLKIKGGQELK-LVFPQVNVSPENYIGFDF---ERFSLQP 175
              G  DWIC SP   K       +   ELK +++ Q + +             +  LQ 
Sbjct: 122 TVTGSWDWICFSPKKFKKPNPAIYEKADELKVIIYNQSDFAFAESFVPYLRPDCKLFLQS 181

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             G    E     + Y   +P+W++S+QTHKF+ I
Sbjct: 182 EWG-RSNEMLPRIVDYVKDHPQWQISLQTHKFLNI 215


>gi|282878839|ref|ZP_06287606.1| radical SAM domain protein [Prevotella buccalis ATCC 35310]
 gi|281299047|gb|EFA91449.1| radical SAM domain protein [Prevotella buccalis ATCC 35310]
          Length = 199

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 78/217 (35%), Positives = 112/217 (51%), Gaps = 30/217 (13%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           + Y + EIF +LQGEG HAGR AVF RF+ CNL            C FCDT+F       
Sbjct: 6   RTYKVNEIFYSLQGEGHHAGRAAVFVRFAKCNL-----------HCWFCDTNF------- 47

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
              +       +IE           + V+TGGEP LQV   L+Q  +  G+ +++ETNGT
Sbjct: 48  -DTFTEMSAQQIIENVQQYA--PCHFVVITGGEPTLQVTPELLQLFHIHGYYVSMETNGT 104

Query: 122 IEPPQGIDWICVSPK----AGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPM- 176
              P+G+DW+  SPK       D+ IK   E+K+V+  ++  P +  G + E   +QP  
Sbjct: 105 HPIPKGVDWVTCSPKKAFIEAGDVHIKQANEIKVVYDGIH--PISTFGIESEERYVQPCD 162

Query: 177 --DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             D    +E    AI +   +P+W+LS+Q HK IGI+
Sbjct: 163 VGDELRNKEIMQQAIQFVKTHPQWKLSLQLHKLIGIQ 199


>gi|255033903|ref|YP_003084524.1| hypothetical protein Dfer_0088 [Dyadobacter fermentans DSM 18053]
 gi|254946659|gb|ACT91359.1| conserved hypothetical protein [Dyadobacter fermentans DSM 18053]
          Length = 193

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 64/211 (30%), Positives = 94/211 (44%), Gaps = 26/211 (12%)

Query: 7   KEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRYN 66
            E F TLQGEG H+GR A F R  GC++            C +CD        +   +++
Sbjct: 1   MEAFYTLQGEGQHSGRAAYFIRLGGCDV-----------GCHWCDVKESW-DASIHPKFD 48

Query: 67  VDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIEPPQ 126
           ++ + D   +        GR  V+TGGEPL+     L  AL + GF+  +ET+G      
Sbjct: 49  INAIVDGALQ------YPGRLAVITGGEPLMYNLDALTGALQEAGFKTNIETSGVYPFTG 102

Query: 127 GIDWICVSPKA---GCDLKIKGGQELKLVF---PQVNVSPENYIGF-DFERFSLQPMDGP 179
             DW+C SPK          K   ELK +       + + E+           +QP +  
Sbjct: 103 HWDWVCFSPKKFKTPHPDIYKNADELKTIIYNKSDFDFAEEHAAKVSPECTLLMQP-EWS 161

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             +    L I Y   NPKW++S+QTHKF+ I
Sbjct: 162 KQDVMLPLIIDYIKDNPKWKMSLQTHKFMNI 192


>gi|149276391|ref|ZP_01882535.1| hypothetical protein PBAL39_01687 [Pedobacter sp. BAL39]
 gi|149232911|gb|EDM38286.1| hypothetical protein PBAL39_01687 [Pedobacter sp. BAL39]
          Length = 193

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 60/211 (28%), Positives = 91/211 (43%), Gaps = 26/211 (12%)

Query: 7   KEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRYN 66
            E F T+QGEG + G+ A F R  GC++            C +CD      +      + 
Sbjct: 1   MEEFYTIQGEGFNTGKAAYFIRLGGCDV-----------GCHWCDVK----ESWDAELHP 45

Query: 67  VDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIEPPQ 126
           +    D++E+        G+  V+TGGEPL+     L + L +R     +ET+G      
Sbjct: 46  LTAADDIVEK---ADSFPGKAVVITGGEPLIYNLDYLTRKLRERNILTFIETSGAYPLSG 102

Query: 127 GIDWICVSP---KAGCDLKIKGGQELKLVFPQVN----VSPENYIGFDFERFSLQPMDGP 179
             DWIC+SP   KA          ELK++    +                +  LQP +  
Sbjct: 103 SWDWICLSPKKFKAPRPDITPFANELKVIIFNKSDFKWAEQYAETVSKNCKLYLQP-EWS 161

Query: 180 FLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             +E T + I Y   NPKW +S+QTHK++ I
Sbjct: 162 KSKEITPMIIEYVMANPKWEISLQTHKYLNI 192


>gi|163786121|ref|ZP_02180569.1| hypothetical protein FBALC1_13087 [Flavobacteriales bacterium
           ALC-1]
 gi|159877981|gb|EDP72037.1| hypothetical protein FBALC1_13087 [Flavobacteriales bacterium
           ALC-1]
          Length = 210

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 58/215 (26%), Positives = 91/215 (42%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           L  + E F T+QGEG H G  A F R  GC++            C +CD      +    
Sbjct: 15  LLPLMEEFYTIQGEGYHKGTAAYFVRIGGCDV-----------GCHWCDVK----ESWLP 59

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             +   +   ++E      +      V+TGGEPL     PL + L  +G +  +ET+G  
Sbjct: 60  ELHPATETTKIVENAIKYSD----IIVVTGGEPLTWDMGPLTEQLKAKGVQTHIETSGAY 115

Query: 123 EPPQGIDWICVSPKA---GCDLKIKGGQELKLVFPQVN---VSPENYIGFD-FERFSLQP 175
           +     DWIC+SPK      +       ELK +    +    + E     +      LQP
Sbjct: 116 KLTGQWDWICLSPKKVKLPTEEIYDEAHELKCIIYNKDDFKFAEEQAAKINKDCILYLQP 175

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +    ++     + Y   NPKW++S+QTHK++ I
Sbjct: 176 -EWSKRDKMMPQIVDYVMANPKWKVSLQTHKYLNI 209


>gi|313676966|ref|YP_004054962.1| radical sam domain protein [Marivirga tractuosa DSM 4126]
 gi|312943664|gb|ADR22854.1| Radical SAM domain protein [Marivirga tractuosa DSM 4126]
          Length = 207

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 60/214 (28%), Positives = 101/214 (47%), Gaps = 26/214 (12%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F T+QGEG H+G+ A F R  GC++            C +CD            
Sbjct: 12  LPLMESFYTIQGEGFHSGKAAYFIRLGGCDV-----------GCVWCDVK----DSWDAD 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIE 123
           ++ + ++ D++++ +   + E R  V+TGGEP +     L + L ++GF + VET+G   
Sbjct: 57  KWPLKKIDDIVDDAY---QYESRLAVITGGEPFMYDMHGLTKRLLQKGFHVNVETSGAHP 113

Query: 124 PPQGIDWICVSP---KAGCDLKIKGGQELKLVFPQVNVSPENYIGFD----FERFSLQPM 176
               +DW+C+SP   KA  +       ELK++    +         +      +  LQP 
Sbjct: 114 FTGMVDWVCLSPKKFKAPLEHWYDRADELKIIIFNKSDFKWAEEHAEKVGSDCKLMLQP- 172

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +    EE   L + Y  +NP W +S+QTHK++ I
Sbjct: 173 EWSKREEMMPLIVEYVKENPNWGISLQTHKYLQI 206


>gi|225010558|ref|ZP_03701029.1| conserved hypothetical protein [Flavobacteria bacterium MS024-3C]
 gi|225005387|gb|EEG43338.1| conserved hypothetical protein [Flavobacteria bacterium MS024-3C]
          Length = 209

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 56/214 (26%), Positives = 88/214 (41%), Gaps = 28/214 (13%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F T+QGEG H G  A F R  GC++            C +CD      +     
Sbjct: 16  LPLMEAFYTIQGEGYHKGTAAYFIRVGGCDV-----------GCHWCDVK----ESWDAE 60

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIE 123
           R+    +  +I++         +  V+TGGEPL     P+   L K G +  +ET+G   
Sbjct: 61  RHPPTAIEKIIQDASPY-----KTIVITGGEPLTWDMGPVTAGLKKVGLQTHIETSGAYT 115

Query: 124 PPQGIDWICVSPKAGC---DLKIKGGQELKLVFPQVNVSPENYIGFDF----ERFSLQPM 176
                DWIC+SPK          K   ELK++    +                   LQP 
Sbjct: 116 LTGEWDWICLSPKKNKLPLAPIYKEAHELKVIVFNKHDLEFAQEQAAQVGPNCHLYLQP- 174

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +    ++   + + +   NP W++S+QTHK++ I
Sbjct: 175 EWSVKDKVVPMIVDFVMANPAWKVSLQTHKYLNI 208


>gi|257059021|ref|YP_003136909.1| radical activating enzyme [Cyanothece sp. PCC 8802]
 gi|256589187|gb|ACV00074.1| radical activating enzyme [Cyanothece sp. PCC 8802]
          Length = 205

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 55/215 (25%), Positives = 86/215 (40%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            Y I E F ++QGEG   G  A F R +GC++            C +CD           
Sbjct: 10  TYPIVETFHSIQGEGVWTGVNAFFIRLAGCDV-----------HCPWCDQKESW-PVQPY 57

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
            + +++ L +  +             ++TGGEPL+    PL   L   G  + +ET+G+ 
Sbjct: 58  PQQSLEALGEAAKRANPA------IVIITGGEPLMHNLDPLTAQLRGLGLRVHLETSGSH 111

Query: 123 EPPQGIDWICVSPKA---GCDLKIKGGQELKLVF---PQVNVSPENYIGFDFERF-SLQP 175
                 DW+  SPK      +       ELK+V      +  +         +    LQP
Sbjct: 112 PFSGQFDWVTFSPKPFKLPHESIYPQVDELKVVITSQEDLQWAEHQAAQVPLKTIKYLQP 171

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                  E+  L   Y   +P WR+S+Q HKF+G+
Sbjct: 172 EWN--TPESQQLIFDYVLHHPDWRISLQVHKFLGV 204


>gi|88803479|ref|ZP_01119005.1| hypothetical protein PI23P_12842 [Polaribacter irgensii 23-P]
 gi|88781045|gb|EAR12224.1| hypothetical protein PI23P_12842 [Polaribacter irgensii 23-P]
          Length = 209

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 60/215 (27%), Positives = 93/215 (43%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + E F T+QGEG H G  A F R  GC++            C +CD      +    
Sbjct: 14  MLPLMEEFYTIQGEGCHTGTAAYFIRVGGCDV-----------GCHWCDVK----ESWNA 58

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             +       ++E      +K     V+TGGEPL+     + ++L K   +  +ET+G  
Sbjct: 59  DLHPPTLADTIVENV----KKHANTVVITGGEPLMWSMDYITESLQKNSIKTHIETSGAY 114

Query: 123 EPPQGIDWICVSP---KAGCDLKIKGGQELKLVFPQVN----VSPENYIGFDFERFSLQP 175
                 DW C+SP   K   D       ELK++    +       E        +  LQP
Sbjct: 115 AFSGKWDWFCLSPKKTKMPLDECYPEADELKMIIHNKSDFIFAEQEAEKVGQKCQLYLQP 174

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +    E+ T L ++Y  +NPKW++S+QTHKF+ I
Sbjct: 175 -EWSKKEKMTALIVAYVMKNPKWKISLQTHKFLNI 208


>gi|110638115|ref|YP_678324.1| organic radical activating enzyme [Cytophaga hutchinsonii ATCC
           33406]
 gi|110280796|gb|ABG58982.1| conserved hypothetical protein; possible organic radical activating
           enzyme [Cytophaga hutchinsonii ATCC 33406]
          Length = 205

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 64/216 (29%), Positives = 97/216 (44%), Gaps = 26/216 (12%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           +   + E F T+QGEG + GR A F R +GC++            C +CD      +   
Sbjct: 8   QSLPVMESFYTIQGEGHYQGRAAYFIRLAGCDV-----------GCHWCDVK----ESWD 52

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
             ++ +  +  ++ E        GR  V+TGGEPL+     L   L + GF   +ET+G 
Sbjct: 53  ASQHPMQTIEHMVAE---ASAFTGRIAVITGGEPLMHDLTNLTAQLKQEGFRNHIETSGA 109

Query: 122 IEPPQGIDWICVSP---KAGCDLKIKGGQELK-LVFPQVNVSPENYIGFDF---ERFSLQ 174
                  DWIC+SP   KA     I+   ELK +VF   ++              +  LQ
Sbjct: 110 HPLSGEWDWICLSPKKFKAPLPSVIEACDELKIIVFHSSDIEWAKTFLPKLKKGCKLFLQ 169

Query: 175 PMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           P +    EE     IS+  +NP+W +S+Q HKF+ I
Sbjct: 170 P-EWSRQEEMLPQIISFVKENPEWEISLQIHKFMNI 204


>gi|255534291|ref|YP_003094662.1| Queuosine Biosynthesis QueE Radical SAM [Flavobacteriaceae
           bacterium 3519-10]
 gi|255340487|gb|ACU06600.1| Queuosine Biosynthesis QueE Radical SAM [Flavobacteriaceae
           bacterium 3519-10]
          Length = 210

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 64/215 (29%), Positives = 90/215 (41%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + E F TLQGEG H G+ A F R  GC++            C +CD        T  
Sbjct: 15  MLPVMEHFYTLQGEGAHTGKAAYFIRLGGCDV-----------GCHWCDVKESW-DPTLH 62

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              +  Q+A+       T  K  +  VLTGGEPL+     L   L + G  I +ET+G  
Sbjct: 63  PLMSAVQIAE-------TAAKHCKTIVLTGGEPLMWNLEILTSRLKELGCTIHIETSGAY 115

Query: 123 EPPQGIDWICVSPKA---GCDLKIKGGQELKLVF---PQVNVSPENYIGFDF-ERFSLQP 175
                +DWI +SPK      D       ELK++      +  + E         R  LQ 
Sbjct: 116 PMSGHLDWITLSPKKTGLPKDQIYAKAHELKVIVFNNNDLKFAAEQAAKVSPTCRLYLQ- 174

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            +    EE       +   NP+W+ SVQTHK++ I
Sbjct: 175 SEWSKREEIYPKITDFILANPEWQASVQTHKYLNI 209


>gi|318040803|ref|ZP_07972759.1| putative organic radical activating protein [Synechococcus sp.
           CB0101]
          Length = 216

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 65/222 (29%), Positives = 88/222 (39%), Gaps = 31/222 (13%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F +LQGEG H+GR A F R  GC           S  C +CDT     Q     
Sbjct: 12  LPVVETFHSLQGEGLHSGRSAWFIRLGGC-----------SVGCSWCDTKHSWPQ----D 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIE 123
            + +  L  L +E          + V+TGGEPL     PL +AL   G  + +ET+G   
Sbjct: 57  VHPLQSLEALQQEAQSAVANGAAFVVITGGEPLEHHLAPLCEALQPFGVPLHLETSGVGA 116

Query: 124 PPQGIDWICVSPKAGCDLKIK---GGQELKLVFPQVNVSPE-----------NYIGFDFE 169
                 WI +SPK       +      ELK+V  +                         
Sbjct: 117 FTGAFAWITLSPKPHRPPTPEVLAACHELKVVVHEAADLAFAEAMAAASLNGRNNDQPAP 176

Query: 170 RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              LQP           LAI Y   +P WRLS+Q+HK++G+R
Sbjct: 177 ALLLQPGWQST--TGQQLAIDYVRSHPSWRLSLQSHKWLGVR 216


>gi|116071889|ref|ZP_01469157.1| possible organic radical activating enzyme [Synechococcus sp.
           BL107]
 gi|116065512|gb|EAU71270.1| possible organic radical activating enzyme [Synechococcus sp.
           BL107]
          Length = 205

 Score =  181 bits (459), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 64/215 (29%), Positives = 96/215 (44%), Gaps = 25/215 (11%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            + E F +LQGEG H GR A F R +GCN+            C +CDT            
Sbjct: 8   PVVETFHSLQGEGHHCGRSAFFIRLAGCNV-----------GCAWCDTKH----SWPMAS 52

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKR-GFEIAVETNGTIE 123
           +    +  L  +     +    + V+TGGEPL     PL  AL++  G  I +ET+G  +
Sbjct: 53  HAKQDVDGLARQARQAKDAGAAFVVITGGEPLHHNLQPLTDALDRICGLPIHLETSGVDQ 112

Query: 124 PPQGIDWICVSPKAGCDLKI---KGGQELKLVFPQVNVSPENYIGFD----FERFSLQPM 176
                DW+ +SPK     +        ELK+V    +     +   +         +QP+
Sbjct: 113 LSGRFDWVTLSPKRHRPPQQALLSRCDELKVVVLDTDDVSFAHAMANDTSTATHLLVQPV 172

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
                E   +LAI +  Q+P+WRLS+Q+HKF+ IR
Sbjct: 173 W--DSETAQDLAIHHVQQHPRWRLSLQSHKFLQIR 205


>gi|300775377|ref|ZP_07085239.1| anaerobic ribonucleoside-triphosphate reductase small subunit
           [Chryseobacterium gleum ATCC 35910]
 gi|300506117|gb|EFK37253.1| anaerobic ribonucleoside-triphosphate reductase small subunit
           [Chryseobacterium gleum ATCC 35910]
          Length = 209

 Score =  180 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 57/216 (26%), Positives = 90/216 (41%), Gaps = 27/216 (12%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           K+  + E F TLQGEG H G+ A F R  GC++            C +CD          
Sbjct: 13  KMLPVMEHFYTLQGEGAHTGKAAYFIRLGGCDV-----------GCHWCDVKESW-DPEL 60

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
               N +++A+             +  VLTGGEPL+     L   L + G  I +ET+G 
Sbjct: 61  HPLMNAEEIAETAAR-------HCKTIVLTGGEPLMWNLDILTSKLKELGCTIHIETSGA 113

Query: 122 IEPPQGIDWICVSPKA---GCDLKIKGGQELKLVF---PQVNVSPENYIGF-DFERFSLQ 174
                 +DWI +SPK      +   +   ELK++         + E      +  +  LQ
Sbjct: 114 YPMSGHLDWITLSPKKTGLPKEEIYQKANELKVIIFNHHDFTFAQEQAAKVSENCKLYLQ 173

Query: 175 PMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             +     +       +  ++P+W+ SVQTHK++ I
Sbjct: 174 -SEWSKRNDMYPKITDFILEHPEWQASVQTHKYLNI 208


>gi|256819499|ref|YP_003140778.1| Radical SAM domain-containing protein [Capnocytophaga ochracea DSM
           7271]
 gi|256581082|gb|ACU92217.1| Radical SAM domain protein [Capnocytophaga ochracea DSM 7271]
          Length = 210

 Score =  180 bits (458), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 56/216 (25%), Positives = 88/216 (40%), Gaps = 27/216 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           L  + E F TLQGEG + G  A F R  GC++            C +CD      +  + 
Sbjct: 15  LLPLMEAFYTLQGEGFYKGTAAYFIRLGGCDV-----------GCHWCDVK----ESWQA 59

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             + +  +  ++ E         +  ++TGGEPL+     L + L   G    +ET+G  
Sbjct: 60  EAHPLVPVDTIVAEAL----AHSKTIIITGGEPLMWNLTLLTEKLRAGGARTHIETSGAH 115

Query: 123 EPPQGIDWICVSP---KAGCDLKIKGGQELKLVF---PQVNVSPENYIGF-DFERFSLQP 175
                 DWIC+SP   K      ++   ELK+V         + E            LQP
Sbjct: 116 PLSGSWDWICLSPKKIKRPVGDVLQKANELKMVIYNNHDFIFAEEMAAQVSPECLLYLQP 175

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            +     E     + Y   +P+W+ S+Q HK++ IR
Sbjct: 176 -EWSKRAEVMPKIVDYVMAHPQWKASLQMHKYLDIR 210


>gi|315224929|ref|ZP_07866748.1| anaerobic ribonucleoside-triphosphate reductase small subunit
           [Capnocytophaga ochracea F0287]
 gi|314945042|gb|EFS97072.1| anaerobic ribonucleoside-triphosphate reductase small subunit
           [Capnocytophaga ochracea F0287]
          Length = 210

 Score =  180 bits (458), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 56/216 (25%), Positives = 88/216 (40%), Gaps = 27/216 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           L  + E F TLQGEG + G  A F R  GC++            C +CD      +  + 
Sbjct: 15  LLPLMEAFYTLQGEGFYKGTAAYFIRLGGCDV-----------GCHWCDVK----ESWQA 59

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             + +  +  ++ E         +  ++TGGEPL+     L + L   G    +ET+G  
Sbjct: 60  EAHPLVPVDTIVAEAL----AHSKTIIITGGEPLMWNLTLLTEKLRAGGARTHIETSGAH 115

Query: 123 EPPQGIDWICVSP---KAGCDLKIKGGQELKLVF---PQVNVSPENYIGF-DFERFSLQP 175
                 DWIC+SP   K      ++   ELK+V         + E            LQP
Sbjct: 116 PLSGTWDWICLSPKKIKRPVGDVLQKANELKMVIYNNHDFIFAEEIAAQVSPECLLYLQP 175

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            +     E     + Y   +P+W+ S+Q HK++ IR
Sbjct: 176 -EWSKRAEVMPKIVDYVMAHPQWKASLQMHKYLDIR 210


>gi|88809463|ref|ZP_01124971.1| possible organic radical activating enzyme [Synechococcus sp. WH
           7805]
 gi|88786682|gb|EAR17841.1| possible organic radical activating enzyme [Synechococcus sp. WH
           7805]
          Length = 208

 Score =  180 bits (458), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 63/215 (29%), Positives = 95/215 (44%), Gaps = 24/215 (11%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F +LQGEG HAGR A F R +GC              C +CDT           
Sbjct: 11  LPVVETFHSLQGEGLHAGRSAFFIRLAGC-----------RVGCSWCDTKH----SWPAD 55

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNK-RGFEIAVETNGTI 122
            + +  +  L  E          + V+TGGEPL      L QAL   R   + +ET+G  
Sbjct: 56  SHPLRPIDSLATEAAAAASDGAAFVVITGGEPLHHNLDALAQALRSLRSLPLHLETSGVD 115

Query: 123 EPPQGIDWICVSPKAGCDLKI---KGGQELKLVFPQ-VNVSPENYIGFDFER--FSLQPM 176
                 DWI +SPK     +    +   ELK+V  +  ++   + +     +  + LQP 
Sbjct: 116 PLSGDPDWITLSPKRHAPPRAELLRRCHELKVVVHEPADLLFADVVAAQAPQATWLLQP- 174

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            G    E   LA+    ++ +WRLS+Q+HK++G+R
Sbjct: 175 -GWESAEGQQLALDAARRDGRWRLSLQSHKWLGVR 208


>gi|77360060|ref|YP_339635.1| queC protein [Pseudoalteromonas haloplanktis TAC125]
 gi|76874971|emb|CAI86192.1| queC protein [Pseudoalteromonas haloplanktis TAC125]
          Length = 215

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 60/228 (26%), Positives = 90/228 (39%), Gaps = 40/228 (17%)

Query: 9   IFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---------QG 59
           +F T+QGE  + G  ++F R  GC +            C +CDT                
Sbjct: 1   MFETIQGEASYTGTPSIFLRLQGCPV-----------GCSWCDTKQTWDVDNVYKVSLDE 49

Query: 60  TKGGRYNVDQLADL----IEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIA 115
           T   + + D  A      I   + +     ++ V+TGGEP +    P+   L++ GF   
Sbjct: 50  TVEKKADSDHWAQASAANILALFQSRGYTAKHVVITGGEPCMYDLNPVCNLLHENGFSTQ 109

Query: 116 VETNGTIEP-PQGIDWICVSPKAGCD-------LKIKGGQELKLVFPQVNVSPENYIGF- 166
           +ET+GT E       W+ VSPK             ++   E+K          E    F 
Sbjct: 110 IETSGTFEILAPAQTWVTVSPKINMRGGFEVLTTAMQRANEIKHPVAMQKHVEELEELFV 169

Query: 167 ----DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               + +   LQP+     E  T LAI  C     WRLS+Q HK++GI
Sbjct: 170 KTGVNPKLVYLQPISQK--ESATKLAIKTCIAK-NWRLSIQVHKYLGI 214


>gi|116074183|ref|ZP_01471445.1| possible organic radical activating enzyme [Synechococcus sp.
           RS9916]
 gi|116069488|gb|EAU75240.1| possible organic radical activating enzyme [Synechococcus sp.
           RS9916]
          Length = 202

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 67/215 (31%), Positives = 98/215 (45%), Gaps = 24/215 (11%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F +LQGEG HAGR A F R +GCN+            C +CDT     Q +   
Sbjct: 5   LPVVETFHSLQGEGLHAGRSAFFIRLAGCNV-----------GCSWCDTKHSWPQSS--- 50

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRG-FEIAVETNGTI 122
            + +  +  L  E    G+    + V+TGGEPL      L  A+       I +ET+G  
Sbjct: 51  -HPLQSVDSLAAEAAAAGQAGAAFVVITGGEPLHHNLDGLTGAIRTACTLPIHIETSGVD 109

Query: 123 EPPQGIDWICVSPKAGCDLKI---KGGQELKLVFPQVN---VSPENYIGFDFERFSLQPM 176
                 DWI +SPK     +    +   ELK+V  + N    +           + LQP 
Sbjct: 110 PLSGTPDWITLSPKRHSPPRAEVLRACHELKVVVHEPNDLLFAEVAASQAPQASWLLQP- 168

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            G   E+   LAI+Y   +P+WRLS+Q+HK++ +R
Sbjct: 169 -GWQSEKGQQLAINYAQHHPRWRLSLQSHKWLQVR 202


>gi|313157136|gb|EFR56566.1| radical SAM domain protein [Alistipes sp. HGB5]
          Length = 211

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 62/216 (28%), Positives = 97/216 (44%), Gaps = 26/216 (12%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           +L  + E F T+QGEG HAG+ A F R  GC++            CR+CD  +       
Sbjct: 14  RLLPLVEDFYTIQGEGFHAGKPAYFIRLGGCDV-----------GCRWCDAKYTW----N 58

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
              Y    +  +I+          +  V+TGGEPLL     L + L+++G +I +ET+GT
Sbjct: 59  PKLYPPTDVRTVIDRALAC---PAQAIVITGGEPLLYPLGVLTETLHEKGLQIFLETSGT 115

Query: 122 IEPPQGIDWICVSPK---AGCDLKIKGGQELKLVFP-QVNVSPENYIGFD---FERFSLQ 174
                  DW+C+SPK      D  ++   ELK++   + +                  LQ
Sbjct: 116 HPFSGYFDWVCLSPKRQQPPLDEALERAHELKVIVESESDFEWAERNAARVRPECMLYLQ 175

Query: 175 PMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           P +    E      + Y   +PKW +S+QTHK++ I
Sbjct: 176 P-EWSVAERVMPAMVEYAKAHPKWNISIQTHKYMHI 210


>gi|258621538|ref|ZP_05716571.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258586156|gb|EEW10872.1| conserved hypothetical protein [Vibrio mimicus VM573]
          Length = 216

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 61/230 (26%), Positives = 90/230 (39%), Gaps = 43/230 (18%)

Query: 9   IFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI----------- 57
           +F T+QGEG   G  AVF R  GC +            C +CDT                
Sbjct: 1   MFETIQGEGVFTGVPAVFVRLQGCPV-----------GCAWCDTKQTWETLESDQTSFPQ 49

Query: 58  ---QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEI 114
              + +    +      D+IE     G  + ++ V+TGGEP +     L QA    G + 
Sbjct: 50  ILLKTSDAPTWCQASAQDVIERYRAQG-YQAKHIVITGGEPCIYDLTELTQAFEAIGCQC 108

Query: 115 AVETNGTIEPPQGI-DWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVSPENYIG 165
            +ET+GT E       W+ VSPK     K+           E+K  V  + ++   + + 
Sbjct: 109 QIETSGTYEILATPTTWVTVSPKVAMKGKLPILDSALQRANEIKHPVATENDIDKLDELL 168

Query: 166 FDF-----ERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                      +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 169 VRASVDAKTVIALQPISQK--PRATELCIRTCIAR-NWRLSIQTHKYLNI 215


>gi|262192386|ref|ZP_06050539.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae CT
           5369-93]
 gi|262031739|gb|EEY50324.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae CT
           5369-93]
          Length = 216

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 57/230 (24%), Positives = 89/230 (38%), Gaps = 43/230 (18%)

Query: 9   IFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI----------- 57
           +F T+QGEG   G  AVF R  GC +            C +CDT                
Sbjct: 1   MFETIQGEGVFTGVPAVFVRLQGCPV-----------GCAWCDTKQTWETLDSDQTSFSQ 49

Query: 58  ---QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEI 114
              + +    +      ++++        + ++ V+TGGEP +     L QA    G   
Sbjct: 50  ILLKTSDAPTWCQASAQEVVQRY-QAQGYQAKHIVITGGEPCIYDLTELTQAFEAMGCRC 108

Query: 115 AVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVSPENYIG 165
            +ET+GT E       W+ VSPK     K+           E+K  V  + ++   + + 
Sbjct: 109 QIETSGTYEVCATENTWVTVSPKVAMKGKLPILDSALQRANEIKHPVATEKDIDNLDELL 168

Query: 166 FDFER-----FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              +       +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 169 ARAQVSAQTAIALQPISQK--PRATELCIRTCIAR-NWRLSIQTHKYLNI 215


>gi|148982371|ref|ZP_01816736.1| organic radical activating enzyme [Vibrionales bacterium SWAT-3]
 gi|145960507|gb|EDK25873.1| organic radical activating enzyme [Vibrionales bacterium SWAT-3]
          Length = 216

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 63/230 (27%), Positives = 92/230 (40%), Gaps = 43/230 (18%)

Query: 9   IFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------------ 56
           +F T+QGEG   G  AVF R   C +            C +CDT                
Sbjct: 1   MFETIQGEGVFTGVPAVFVRLQICPV-----------GCSWCDTKQTWEALPEDETSLGD 49

Query: 57  --IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEI 114
             ++      ++      ++ E    G    ++ V+TGGEP +   VPL +A  K G   
Sbjct: 50  IMVKTEDSPTWSSIDAQGIVNEYIKQG-YTAKHIVITGGEPCIYDLVPLTEAFEKHGCRC 108

Query: 115 AVETNGTIEPPQGID-WICVSPKAGCDLKIK-------GGQELKLV------FPQVNVSP 160
            +ET+GT E     D W+ VSPK     K++          E+K          Q++   
Sbjct: 109 QIETSGTSEVKATPDTWVTVSPKVAMKAKLEILDSALQRANEIKHPVGTSKDIEQLDGLL 168

Query: 161 ENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           E     D    +LQP+        T L I  C +   WRLS+QTHK++ I
Sbjct: 169 ERAEVSDDTVIALQPISQKD--RATKLCIDTCIER-NWRLSIQTHKYLSI 215


>gi|84387075|ref|ZP_00990098.1| Organic radical activating enzyme [Vibrio splendidus 12B01]
 gi|84378150|gb|EAP95010.1| Organic radical activating enzyme [Vibrio splendidus 12B01]
          Length = 216

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 61/230 (26%), Positives = 91/230 (39%), Gaps = 43/230 (18%)

Query: 9   IFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------------ 56
           +F T+QGEG   G  AVF R   C +            C +CDT                
Sbjct: 1   MFETIQGEGVFTGVPAVFVRLQICPV-----------GCSWCDTKQTWEALPEDETSLGD 49

Query: 57  --IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEI 114
             ++      ++      ++ E    G    ++ V+TGGEP +   VPL +A  + G   
Sbjct: 50  IMVKTEDSPTWSAIDAQGIVNEYIKQG-YTAKHIVITGGEPCIYDLVPLTEAFEQHGCRC 108

Query: 115 AVETNGTIEPPQGID-WICVSPKAGCDLKIK-------GGQELKLV------FPQVNVSP 160
            +ET+GT E     D W+ VSPK     K+           E+K          Q++   
Sbjct: 109 QIETSGTSEVKATPDTWVTVSPKVAMKAKLDILDSALVRANEIKHPVGTGKDIEQLDALI 168

Query: 161 ENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                 +    +LQP+     E  T L I  C +   WRLS+QTHK++ I
Sbjct: 169 ARADVPENTVIALQPISQK--ERATQLCIDTCIER-NWRLSIQTHKYLSI 215


>gi|86145928|ref|ZP_01064256.1| Organic radical activating enzyme [Vibrio sp. MED222]
 gi|85836383|gb|EAQ54513.1| Organic radical activating enzyme [Vibrio sp. MED222]
          Length = 216

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 62/230 (26%), Positives = 91/230 (39%), Gaps = 43/230 (18%)

Query: 9   IFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------------ 56
           +F T+QGEG   G  AVF R   C +            C +CDT                
Sbjct: 1   MFETIQGEGVFTGVPAVFVRLQICPV-----------GCSWCDTKQTWEALPEDETSLGD 49

Query: 57  --IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEI 114
             ++      +       ++ E    G    ++ V+TGGEP +   VPL +A  + G   
Sbjct: 50  IMVKTEDSPTWTAIDAQGIVNEYIKQG-YTAKHIVITGGEPCIYDLVPLTEAFEQHGCRC 108

Query: 115 AVETNGTIEPPQGID-WICVSPKAGCDLKIK-------GGQELKLV------FPQVNVSP 160
            +ET+GT E     D W+ VSPK     K+           E+K          Q++V  
Sbjct: 109 QIETSGTSEVKATPDTWVTVSPKVAMKAKLDILDSALVRANEIKHPVGTGKDIEQLDVLI 168

Query: 161 ENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                 +    +LQP+     E  T L I  C +   WRLS+QTHK++ I
Sbjct: 169 ARADVPENTVIALQPISQK--ERATQLCIDTCIER-NWRLSIQTHKYLSI 215


>gi|325954686|ref|YP_004238346.1| radical SAM protein [Weeksella virosa DSM 16922]
 gi|323437304|gb|ADX67768.1| Radical SAM domain protein [Weeksella virosa DSM 16922]
          Length = 215

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 61/216 (28%), Positives = 97/216 (44%), Gaps = 27/216 (12%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           +L  + E F TLQGEG +AG  A F R  GC++            C +CD      +   
Sbjct: 19  RLLPVMEHFYTLQGEGAYAGVAAYFIRLGGCDV-----------GCHWCDVK----ESWD 63

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
              + +  +A L +E         +  ++TGGEPL+     L   L+K G  I +ET+G 
Sbjct: 64  AEIHPLTDIATLAKEAAAI----CKTIIITGGEPLMWDLTFLTSELHKHGANIHIETSGA 119

Query: 122 IEPPQGIDWICVSPKA---GCDLKIKGGQELKLVFPQVN---VSPENYIGF-DFERFSLQ 174
                 IDW+ +SPK      +   +   ELK++    +    + E      D     LQ
Sbjct: 120 YPLTGEIDWVTLSPKKTKLPVESIYQQANELKMIIYNQHDFTFAEEQAAKVKDNCLLYLQ 179

Query: 175 PMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            ++    +  +   + +  QNPKWR++VQTHK++ I
Sbjct: 180 -VEWSKRDSMSPKLVEFIKQNPKWRITVQTHKYLDI 214


>gi|258627553|ref|ZP_05722330.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258580135|gb|EEW05107.1| conserved hypothetical protein [Vibrio mimicus VM603]
          Length = 216

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 61/230 (26%), Positives = 91/230 (39%), Gaps = 43/230 (18%)

Query: 9   IFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI----------- 57
           +F T+QGEG   G  AVF R  GC +            C +CDT                
Sbjct: 1   MFETIQGEGVFTGVPAVFVRLQGCPV-----------GCAWCDTKQTWETLESDQTSFPQ 49

Query: 58  ---QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEI 114
              + +    +      D+IE     G  + ++ V+TGGEP +     L QA    G + 
Sbjct: 50  ILLKTSDAPTWCQASAQDVIERYRAQG-YQAKHIVITGGEPCIYDLTELTQAFEAIGCQC 108

Query: 115 AVETNGTIEPPQGI-DWICVSPKAGCDLK-------IKGGQELKL-VFPQVNVSPENYIG 165
            +ET+GT E       W+ VSPK     K       ++   E+K  V  + ++   + + 
Sbjct: 109 QIETSGTYEILATPTTWVTVSPKVAMKGKLLILDSALQRANEIKHPVATEKDIDNLDELL 168

Query: 166 FDF-----ERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                      +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 169 VRASVDTKTVIALQPISQK--PRATELCIRTCIAR-NWRLSIQTHKYLNI 215


>gi|218245972|ref|YP_002371343.1| hypothetical protein PCC8801_1116 [Cyanothece sp. PCC 8801]
 gi|218166450|gb|ACK65187.1| conserved hypothetical protein [Cyanothece sp. PCC 8801]
          Length = 205

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 55/215 (25%), Positives = 86/215 (40%), Gaps = 27/215 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            Y I E F ++QGEG   G  A F R +GC++            C +CD           
Sbjct: 10  TYPIVETFHSIQGEGVWMGVNAFFIRLAGCDV-----------HCPWCDQKESW-PVQPY 57

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
            + +++ L +  +             ++TGGEPL+    PL   L   G  + +ET+G+ 
Sbjct: 58  PQQSLEALGEAAKRANPA------IVIITGGEPLMHNLDPLTAQLRGLGLRVHLETSGSH 111

Query: 123 EPPQGIDWICVSPKA---GCDLKIKGGQELKLVF---PQVNVSPENYIGFDFERF-SLQP 175
                 DW+  SPK      +       ELK+V      +  +         +    LQP
Sbjct: 112 PFSGQFDWVTFSPKPFKLPHESIYPQVDELKVVITSQEDLQWAEHQAAQVPLKTIKYLQP 171

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                  E+  L   Y   +P WR+S+Q HKF+G+
Sbjct: 172 EWN--TPESQQLIFDYVLHHPDWRISLQVHKFLGV 204


>gi|262169329|ref|ZP_06037021.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae RC27]
 gi|262022142|gb|EEY40851.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae RC27]
 gi|327484035|gb|AEA78442.1| Queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae LMA3894-4]
          Length = 216

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 59/229 (25%), Positives = 88/229 (38%), Gaps = 41/229 (17%)

Query: 9   IFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQ---------- 58
           +F T+QGEG   G  AVF R  GC +            C +CDT                
Sbjct: 1   MFETIQGEGVFTGVPAVFVRLQGCPV-----------GCAWCDTKQTWETLDSDQTSFSQ 49

Query: 59  ---GTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIA 115
               T          A  + +++     + ++ V+TGGEP +     L QA    G    
Sbjct: 50  ILLKTNDAPTWCQATAQEVVQRYQAQGYQAKHIVITGGEPCIYDLTELTQAFEAMGCRCQ 109

Query: 116 VETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVSPENYIGF 166
           +ET+GT E       W+ VSPK     K+           E+K  V  + ++   + +  
Sbjct: 110 IETSGTYEVCATENTWVTVSPKVAMKGKLPILDSALQRANEIKHPVATEKDIDNLDELLA 169

Query: 167 DFER-----FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             +       +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 170 RAQVSAQTAIALQPISQK--PRATELCIRTCIAR-NWRLSIQTHKYLNI 215


>gi|123969432|ref|YP_001010290.1| putative organic radical activating protein [Prochlorococcus
           marinus str. AS9601]
 gi|123199542|gb|ABM71183.1| possible organic radical activating enzyme [Prochlorococcus marinus
           str. AS9601]
          Length = 225

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 66/241 (27%), Positives = 99/241 (41%), Gaps = 48/241 (19%)

Query: 1   MKL---YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI 57
           MK+     + E F +LQGEG HAG+ A F R +GC              C +CDT     
Sbjct: 1   MKMTNFLPLVEQFHSLQGEGYHAGKSAFFVRLAGC-----------KVGCSWCDTK---- 45

Query: 58  QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNK-------R 110
                 ++    +  +I+   I  +K   +CV+TGGEPL        +A+ K       +
Sbjct: 46  NSWDEKKHPSISIEKIIDRIKIARKKGASFCVITGGEPLQHNLDNFCKAIKKMTMGEEQK 105

Query: 111 GFEIAVETNGTIEPPQGIDWICVSPKAGCDLKIKGGQEL--------------------K 150
             +I +ET+G        DWI +SPK     K    +                      K
Sbjct: 106 PIKIHIETSGVNSISGSYDWITLSPKRHSPPKNYFLKNCNEIKIIINEIEDIEFAIQIKK 165

Query: 151 LVFPQVNVSP-ENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIG 209
               Q  +S  E+ +  + + F LQP          +LAI +   NP W+LS+QTHK++ 
Sbjct: 166 ETLKQHQLSKGEDGLKKEDKIFYLQPAWN--NANGFSLAIDFVKNNPDWKLSLQTHKYLK 223

Query: 210 I 210
           I
Sbjct: 224 I 224


>gi|282859352|ref|ZP_06268460.1| radical SAM domain protein [Prevotella bivia JCVIHMP010]
 gi|282587837|gb|EFB93034.1| radical SAM domain protein [Prevotella bivia JCVIHMP010]
          Length = 194

 Score =  179 bits (454), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 80/214 (37%), Positives = 105/214 (49%), Gaps = 28/214 (13%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            I EIF ++QGEG +AG  A+F RF+ CNL            C FCDTDFV        R
Sbjct: 2   KINEIFYSIQGEGFYAGTPAIFVRFAQCNLN-----------CAFCDTDFV--------R 42

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIEP 124
           +      +++ E    G     + +LTGGEP LQV   L   L++ G  I +ETNGT   
Sbjct: 43  FTEMTEEEIVAEVCRIGN-PATHVILTGGEPSLQVTASLCDKLHEAGKVIHIETNGTHAV 101

Query: 125 PQGIDWICVSPK----AGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
            +GID+I  SPK       +L ++   ELK+VF   N     Y     + + LQP D   
Sbjct: 102 AEGIDFITCSPKLEYCKHAELCVQRIDELKVVFTGKN-DMALYENIQAQHYFLQPCDVGN 160

Query: 181 LEEN---TNLAISYCFQNPKWRLSVQTHKFIGIR 211
             EN       + YC  NPKW +SVQ HK + IR
Sbjct: 161 DAENGRIIAATVGYCKANPKWNISVQIHKVLAIR 194


>gi|87123419|ref|ZP_01079270.1| possible organic radical activating enzyme [Synechococcus sp.
           RS9917]
 gi|86169139|gb|EAQ70395.1| possible organic radical activating enzyme [Synechococcus sp.
           RS9917]
          Length = 202

 Score =  178 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 61/216 (28%), Positives = 91/216 (42%), Gaps = 24/216 (11%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              + E F +LQGEG HAGR A F R  GC++            C +CDT          
Sbjct: 4   TLPVVETFHSLQGEGLHAGRSAFFIRLGGCDV-----------GCSWCDTKH----SWPA 48

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKR-GFEIAVETNGT 121
             +    +  L             + VLTGGEPL      L  A+ +     + +ET+G 
Sbjct: 49  EAHPKRSVDSLAAATAEAAHAGAAFVVLTGGEPLHHQLDALTAAIRRICSLPVHLETSGV 108

Query: 122 IEPPQGIDWICVSPKAGCDLKIK---GGQELKLVFPQ-VNVSPENYIGFDFER--FSLQP 175
                  DW+ +SPK     + +      ELK+V  +  ++     +     +  + LQP
Sbjct: 109 DPLSGAPDWVTLSPKRHRPPRAEVLQACDELKVVVHEPADLLFAEVVATQAPQATWLLQP 168

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             G   E    LA      NP+WRLS+Q+HK++G+R
Sbjct: 169 --GWSSEAGQELATDMVRGNPRWRLSLQSHKWLGVR 202


>gi|228469718|ref|ZP_04054686.1| organic radical activating enzyme [Porphyromonas uenonis 60-3]
 gi|228308737|gb|EEK17463.1| organic radical activating enzyme [Porphyromonas uenonis 60-3]
          Length = 201

 Score =  178 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 67/223 (30%), Positives = 100/223 (44%), Gaps = 34/223 (15%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M+   + EIF +LQGEGG  GR  +F R SGCNL            C +CDTDF G    
Sbjct: 1   MQSLPVNEIFYSLQGEGGQMGRAMLFVRLSGCNL-----------ACDYCDTDFAG---- 45

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
                 V ++   +E          R  + TGGEP L +    I   +++G+  ++ETNG
Sbjct: 46  -HRLMTVAEILAKLE------SYPCRDILWTGGEPTLALREEHIAFFHEQGYRQSIETNG 98

Query: 121 TIEPPQGIDWICVSPKAG---------CDLKIKGGQELKLVFP-QVNVSPENYIGFDFER 170
           T   P+G+D++  SPKA           D    G  E++        + P         R
Sbjct: 99  TRPVPRGLDYVTCSPKAEAISGLRERFVDNYPDGIDEVRWPLQLGAPLPPPIEQLVQARR 158

Query: 171 FSLQPMD--GPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           + + P++  G  +       + +   +P+WRLSVQ HK +G R
Sbjct: 159 YYVSPVEETGVEMSAVVARCMDFVLAHPEWRLSVQLHKLLGFR 201


>gi|213963236|ref|ZP_03391493.1| radical SAM domain protein [Capnocytophaga sputigena Capno]
 gi|213954098|gb|EEB65423.1| radical SAM domain protein [Capnocytophaga sputigena Capno]
          Length = 210

 Score =  178 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 52/216 (24%), Positives = 88/216 (40%), Gaps = 27/216 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + E F +LQGEG + G  A F R  GC++            C +CD      +    
Sbjct: 15  ILPLMEAFYSLQGEGFYKGTAAYFIRLGGCDV-----------GCHWCDVK----ESWAA 59

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
             + +  +  ++ +         +  ++TGGEPL+     L Q L   G    +ET+G  
Sbjct: 60  EAHPLVPVDTIVTDAL----AHSKTMIITGGEPLMWNLDLLTQKLRAAGARTHIETSGAH 115

Query: 123 EPPQGIDWICVSP---KAGCDLKIKGGQELKLV-FPQVNVSPENYIGFDF---ERFSLQP 175
                 DWIC+SP   K      ++   ELK+V +   +      +           LQP
Sbjct: 116 PLSGTFDWICLSPKKIKRPVGDVLQKANELKMVIYNNNDFLFAEEMAAQVSPDCLLYLQP 175

Query: 176 MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            +     +     + Y   +P+W+ S+Q HK++ IR
Sbjct: 176 -EWSKRNKVIPKIVDYVMAHPQWKASLQMHKYLDIR 210


>gi|313206128|ref|YP_004045305.1| radical sam domain protein [Riemerella anatipestifer DSM 15868]
 gi|312445444|gb|ADQ81799.1| Radical SAM domain protein [Riemerella anatipestifer DSM 15868]
 gi|315022935|gb|EFT35958.1| Queuosine Biosynthesis QueE Radical SAM [Riemerella anatipestifer
           RA-YM]
          Length = 209

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 60/213 (28%), Positives = 90/213 (42%), Gaps = 27/213 (12%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            + E F T+QGEG + G+ A F R  GC++            C +CD             
Sbjct: 16  PVMEHFYTIQGEGAYTGKAAYFIRLGGCDV-----------GCHWCDVKESW-DPNLHPL 63

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIEP 124
            + +++A +            +  VLTGGEPL+     L + L   G  I +ET+G  E 
Sbjct: 64  MDAEEVAQIAA-------NHSKTIVLTGGEPLMWNLEILTKKLKDLGCTIHIETSGAYEI 116

Query: 125 PQGIDWICVSPKA---GCDLKIKGGQELKLVF---PQVNVSPENYIGF-DFERFSLQPMD 177
              IDW+C+SPK      +       ELK++         + E         +F LQ  +
Sbjct: 117 SGHIDWVCLSPKKTGLPKESIYAKANELKVIIFNNHDFKFAEEQASKVSQNCKFYLQ-SE 175

Query: 178 GPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               +E       Y  +NPKW+ SVQTHK++ I
Sbjct: 176 WSKRDEMYPKITDYILENPKWQASVQTHKYLNI 208


>gi|91224504|ref|ZP_01259766.1| hypothetical protein V12G01_17742 [Vibrio alginolyticus 12G01]
 gi|91190846|gb|EAS77113.1| hypothetical protein V12G01_17742 [Vibrio alginolyticus 12G01]
          Length = 216

 Score =  178 bits (452), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 60/230 (26%), Positives = 88/230 (38%), Gaps = 43/230 (18%)

Query: 9   IFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------------ 56
           +F T+QGEG   G  AVF R   C +            C +CDT                
Sbjct: 1   MFETIQGEGVFTGVPAVFVRLQECPV-----------GCSWCDTKQTWYADENDQRQIGD 49

Query: 57  --IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEI 114
             ++      + V    +++E+    G    ++ V+TGGEP +    PL +A    G + 
Sbjct: 50  ILVKTEDSPTWCVASAENIVEQYQQQG-FNAKHIVITGGEPCIYDLRPLTKAFEDMGCQC 108

Query: 115 AVETNGTIEPPQ-GIDWICVSPKAGCDLKIK-------GGQELKLV------FPQVNVSP 160
            +ET+GT E       W+ VSPK     K+           E+K           ++   
Sbjct: 109 QIETSGTSEVITSENTWVTVSPKVAMKGKLPVLNSALERANEIKHPVGTQKDIDHLDDLL 168

Query: 161 ENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            N         +LQP+        T L I  C     WRLSVQTHK++ I
Sbjct: 169 ANANVAAETIIALQPISQK--PRATQLCIDTCIAR-NWRLSVQTHKYLSI 215


>gi|238791241|ref|ZP_04634880.1| hypothetical protein yinte0001_29930 [Yersinia intermedia ATCC
           29909]
 gi|238729374|gb|EEQ20889.1| hypothetical protein yinte0001_29930 [Yersinia intermedia ATCC
           29909]
          Length = 216

 Score =  178 bits (452), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 61/233 (26%), Positives = 88/233 (37%), Gaps = 49/233 (21%)

Query: 9   IFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI----------- 57
           +F TLQGEG   G  A+F R  GC +            C +CDT                
Sbjct: 1   MFQTLQGEGYFTGVPAIFVRLQGCPV-----------GCSWCDTKHTWEKEADREVDMQR 49

Query: 58  ------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRG 111
                 +    G  +  QL D+  +Q        R+ V+TGGEP +    PL   L + G
Sbjct: 50  IMVKTAESDAWGEASAQQLLDIFSQQG----YTARHVVITGGEPAIYDLFPLTSLLEQAG 105

Query: 112 FEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLV------FPQVN 157
           +   +ET+GT +       W+ VSPK             ++   E+K           + 
Sbjct: 106 YSCQIETSGTHDVRCSATTWVTVSPKVNMRGGLKVLPQALQRADEIKHPVGRMRDIEALE 165

Query: 158 VSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           V             +LQP+      + T L I  C     WRLS+QTHK++ I
Sbjct: 166 VLLATLDDDKKRIIALQPISQKD--DATKLCIETCIAK-NWRLSMQTHKYLNI 215


>gi|167754369|ref|ZP_02426496.1| hypothetical protein ALIPUT_02663 [Alistipes putredinis DSM 17216]
 gi|167658994|gb|EDS03124.1| hypothetical protein ALIPUT_02663 [Alistipes putredinis DSM 17216]
          Length = 194

 Score =  178 bits (451), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 67/217 (30%), Positives = 106/217 (48%), Gaps = 34/217 (15%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            + EIF ++QGEG + G  A+F R +GCNL           +C FCDT+           
Sbjct: 2   RVNEIFYSIQGEGRYTGTPAIFIRLAGCNL-----------RCDFCDTEH-----QPYQD 45

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVETNGTIE 123
              +++   I       +    + V+TGGEP+LQ+    + +  N  G  + VETNGTI 
Sbjct: 46  LTEEEIMRQI------ADFPTSHVVITGGEPMLQITQSLIHRLRNGAGKFVQVETNGTIP 99

Query: 124 PPQ--GIDWICVSPK----AGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMD 177
                 +DWI  SPK       +L+++   ELK+V+   +++  +  G + + + LQP D
Sbjct: 100 IKCYLPVDWITCSPKFDFCPHAELRLQRIDELKVVYQGQDMTAYD--GIEAKEYYLQPCD 157

Query: 178 GPF---LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
                   EN    I+Y   +PKW+LS+QT K + +R
Sbjct: 158 FKDEARNAENLAATINYIKSHPKWKLSLQTQKILSVR 194


>gi|148240798|ref|YP_001226185.1| organic radical activating protein [Synechococcus sp. WH 7803]
 gi|147849337|emb|CAK24888.1| Organic radical activating enzyme [Synechococcus sp. WH 7803]
          Length = 208

 Score =  178 bits (451), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 64/215 (29%), Positives = 94/215 (43%), Gaps = 24/215 (11%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F +LQGEG HAGR A F R +GC           S  C +CDT           
Sbjct: 11  LPVVETFHSLQGEGLHAGRSAFFIRLAGC-----------SVGCSWCDTKH----SWPAE 55

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKR-GFEIAVETNGTI 122
            +    L  +  E          + V+TGGEPL      L Q L K  G  + +ET+G  
Sbjct: 56  SHPARTLHSIATEAAAAASDGAAFVVITGGEPLHHNLDALAQTLRKICGLPLHLETSGVD 115

Query: 123 EPPQGIDWICVSPKAGCDLKIK---GGQELKLVFPQ-VNVSPENYIGFDFER--FSLQPM 176
                 DWI +SPK     + +      ELK+V  +  ++     +     +  + LQP 
Sbjct: 116 PLSGNPDWITLSPKRHAPPRAELLSRCHELKVVVHEPADLLFAEVLSAQAPQAAWLLQP- 174

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            G    E   LA+    ++ +WRLS+Q+HK++G+R
Sbjct: 175 -GWESVEGQQLALDAARRDGRWRLSLQSHKWLGVR 208


>gi|159904363|ref|YP_001551707.1| putative organic radical activating protein [Prochlorococcus
           marinus str. MIT 9211]
 gi|159889539|gb|ABX09753.1| possible organic radical activating enzyme [Prochlorococcus marinus
           str. MIT 9211]
          Length = 226

 Score =  178 bits (451), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 96/240 (40%), Gaps = 48/240 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               + E F ++QGEG HAGR A F R + CN+            C +CDT     +   
Sbjct: 3   TTLPVVESFHSIQGEGAHAGRSAFFIRLAQCNV-----------GCEWCDTK----ESWS 47

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN-------KRGFEI 114
              +    +  L++E  I   K   + V+TGGEPL     PL  A+             I
Sbjct: 48  SISHPKKTIDSLVQETTIAKSKGASFLVITGGEPLHHNLNPLCNAIKNNINSCGDNAIPI 107

Query: 115 AVETNGTIEPPQGIDWICVSPKAGCDLKI---KGGQELKLVFP-QVNVSPENYIGFDFER 170
            +ET+G        DWI +SPK     K    +  QE+K++   + ++     +      
Sbjct: 108 HLETSGVHHMSGAPDWITLSPKRHFPPKEELLEACQEIKVIIHSKEDILFAEEMAHRSIH 167

Query: 171 --------------------FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                                 LQP  G        LAI Y  +NP+WRLS+QTHK++ I
Sbjct: 168 AKKNAYKSRVSTKQSLIKPLLFLQPGWGH--SMGQKLAIEYVIKNPQWRLSLQTHKWLAI 225


>gi|91070512|gb|ABE11419.1| putative organic radical activating enzyme [uncultured
           Prochlorococcus marinus clone HOT0M-3E5]
          Length = 225

 Score =  178 bits (451), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 63/241 (26%), Positives = 97/241 (40%), Gaps = 48/241 (19%)

Query: 1   MKL---YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI 57
           MK+     + E F +LQGEG HAG+ A F R +GC              C +CDT     
Sbjct: 1   MKMTNFLPLVEQFHSLQGEGYHAGKSAFFIRLAGC-----------KVGCSWCDTK---- 45

Query: 58  QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNK-------R 110
                 ++    +  +I+   I  +K   +CV+TGGEPL        +A+ K       +
Sbjct: 46  NSWDEKKHPSISIEKIIDRIKIARKKGASFCVITGGEPLQHNLDNFCKAIKKMTMGEEQK 105

Query: 111 GFEIAVETNGTIEPPQGIDWICVSPKAGCDLKIK---------------------GGQEL 149
             +I +ET+G        DWI +SPK     K                          + 
Sbjct: 106 PMKIHIETSGVNSISGSYDWITLSPKRHSPPKNYFLKNCNEIKIIINEIEDIEFAIQIKN 165

Query: 150 KLVFPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIG 209
           + +        E+ +  + + F LQP          +LAI +   NP W+LS+QTHK++ 
Sbjct: 166 ETLKQYQISKSEDGLKKEDKIFYLQPAWN--NANGFSLAIDFVKNNPDWKLSLQTHKYLK 223

Query: 210 I 210
           I
Sbjct: 224 I 224


>gi|332177919|gb|AEE13609.1| Radical SAM domain protein [Porphyromonas asaccharolytica DSM
           20707]
          Length = 201

 Score =  177 bits (450), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 66/223 (29%), Positives = 102/223 (45%), Gaps = 34/223 (15%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M+   + EIF +LQGEGG  GR  +F R SGCNL            C +CDTDF G    
Sbjct: 1   MQPLPVNEIFYSLQGEGGQMGRAMLFVRLSGCNLT-----------CDYCDTDFAG---- 45

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
               + +   ++++ +    G    R  + TGGEP L +    I   ++ G+  ++ETNG
Sbjct: 46  ----HQLMTASEILAQL---GSYPCRDILWTGGEPTLALREEHIAFFHEHGYRQSIETNG 98

Query: 121 TIEPPQGIDWICVSPKAG---------CDLKIKGGQELKLVFP-QVNVSPENYIGFDFER 170
           T   PQG+D++  SPK            D    G  E++        + P      +  R
Sbjct: 99  TRPMPQGLDYVTCSPKPEAISGLRERFVDNYPDGIDEVRWPLQLGAPLPPPIEQLAEARR 158

Query: 171 FSLQPMD--GPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           + + P++  G  +       + +   +P+WRLSVQ HK +G R
Sbjct: 159 YYVSPVEETGVEMSAVVARCMDFVLAHPEWRLSVQLHKLLGFR 201


>gi|260778537|ref|ZP_05887429.1| queuosine Biosynthesis QueE Radical SAM [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260604701|gb|EEX30996.1| queuosine Biosynthesis QueE Radical SAM [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 216

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 61/229 (26%), Positives = 88/229 (38%), Gaps = 41/229 (17%)

Query: 9   IFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRYNVD 68
           +F T+QGEG   G  +VF R   C +            C +CDT        +  R   +
Sbjct: 1   MFETIQGEGVFTGVPSVFVRLQICPV-----------GCAWCDTKQTWDATPQDERPLAE 49

Query: 69  QLADL-------------IEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIA 115
            LA               I EQ+     + ++ V+TGGEP +    PL +A    G    
Sbjct: 50  VLAKTEDSPTWCSVSGGDIIEQYRQQGYQAKHIVITGGEPCIYDLRPLTEAFEAIGCRCQ 109

Query: 116 VETNGTIEPPQ-GIDWICVSPKAGCDLKIK-------GGQELKLV------FPQVNVSPE 161
           +ET+GT         W+ VSPK     K+           E+K          Q++   E
Sbjct: 110 IETSGTSPILASENTWVTVSPKVAMKGKLPVLDCALLRANEIKHPVATDKDIEQLDALIE 169

Query: 162 NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                +    +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 170 RAGVPESTTIALQPISQK--PRATQLCIDTCIAR-NWRLSIQTHKYLSI 215


>gi|313886424|ref|ZP_07820143.1| radical SAM domain protein [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|312924105|gb|EFR34895.1| radical SAM domain protein [Porphyromonas asaccharolytica
           PR426713P-I]
          Length = 201

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 66/223 (29%), Positives = 102/223 (45%), Gaps = 34/223 (15%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M+   + EIF +LQGEGG  GR  +F R SGCNL            C +CDTDF G    
Sbjct: 1   MQPLPVNEIFYSLQGEGGQMGRAMLFVRLSGCNLT-----------CDYCDTDFAG---- 45

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
               + +   ++++ +    G    R  + TGGEP L +    I   ++ G+  ++ETNG
Sbjct: 46  ----HQLMTASEILAQL---GSYPCRDILWTGGEPTLALREEHIAFFHEHGYRQSIETNG 98

Query: 121 TIEPPQGIDWICVSPKAG---------CDLKIKGGQELKLVFP-QVNVSPENYIGFDFER 170
           T   PQG+D++  SPK            D    G  E++        + P      +  R
Sbjct: 99  TRPVPQGLDYVTCSPKPEAISGLRERFVDNYPDGIDEVRWPLQLGAPLPPPIEQLVEARR 158

Query: 171 FSLQPMD--GPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           + + P++  G  +       + +   +P+WRLSVQ HK +G R
Sbjct: 159 YYVSPVEETGVEMSAVVARCMDFVLAHPEWRLSVQLHKLLGFR 201


>gi|229497033|ref|ZP_04390738.1| NrdG protein [Porphyromonas endodontalis ATCC 35406]
 gi|229316135|gb|EEN82063.1| NrdG protein [Porphyromonas endodontalis ATCC 35406]
          Length = 212

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 64/219 (29%), Positives = 90/219 (41%), Gaps = 33/219 (15%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + EIF +LQGEG   G   VF R S CNL           +C +CDTDF         
Sbjct: 16  LPVNEIFYSLQGEGAQVGLPMVFIRLSSCNL-----------RCSYCDTDFSS------- 57

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIE 123
            +    L  ++ E            + TGGEP L +   ++   +++G+  ++ETNGT  
Sbjct: 58  -FTPMSLEAIVAEL---ASFPTHNILWTGGEPTLHLTEEVVGFFHQKGYRQSIETNGTRP 113

Query: 124 PPQGIDWICVSPKAGCDLK-----IKGGQELKLVF-PQVNVSPENYIGFDFERFSLQPMD 177
            P+GID+I  S K             G  E +  F     + P          + L P+ 
Sbjct: 114 VPRGIDYITCSAKPESFPHLWENFPHGVDEWRFPFGASAPLPPAIESLPPARTYCLSPIY 173

Query: 178 GPFL-----EENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            P              I Y  Q+P WRLS+Q HK IGI+
Sbjct: 174 EPGEAILQPPHALEECIEYIKQHPTWRLSIQLHKIIGIQ 212


>gi|126697219|ref|YP_001092105.1| putative organic radical activating protein [Prochlorococcus
           marinus str. MIT 9301]
 gi|126544262|gb|ABO18504.1| possible organic radical activating enzyme [Prochlorococcus marinus
           str. MIT 9301]
          Length = 223

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 66/237 (27%), Positives = 96/237 (40%), Gaps = 45/237 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               + E F +LQGEG HAG+ A F R +GC              C +CDT         
Sbjct: 3   NFLPLVEQFHSLQGEGYHAGKSAFFVRLAGC-----------KVGCSWCDTK----NSWD 47

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNK-------RGFEI 114
             +Y    +  +I+   I  EK   +CV+TGGEPL        +A+ K       +  +I
Sbjct: 48  EKKYPSISIEKIIDRIKIAREKGASFCVITGGEPLQHNLDNFCKAIKKMTMGEELKPMKI 107

Query: 115 AVETNGTIEPPQGIDWICVSPKAGCDLKIKGGQEL--------------------KLVFP 154
            +ET+G        DWI +SPK     K    +                      K    
Sbjct: 108 HIETSGVNSISGSYDWITLSPKRHSPPKSYFLKNCNEIKIIINEIEDIEFAIQIKKETLK 167

Query: 155 QVNVSP-ENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           Q + S  E+ +  + + F LQP          +LAI +   NP W+LS+QTHK++ I
Sbjct: 168 QYHPSKSEDGLKKEDKIFYLQPAWN--NANGFSLAIDFVKNNPDWKLSLQTHKYLKI 222


>gi|260435246|ref|ZP_05789216.1| organic radical activating enzyme [Synechococcus sp. WH 8109]
 gi|260413120|gb|EEX06416.1| organic radical activating enzyme [Synechococcus sp. WH 8109]
          Length = 205

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 69/219 (31%), Positives = 100/219 (45%), Gaps = 27/219 (12%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           +   + E F +LQGEG HAGR A F R +GC           +  C +CDT         
Sbjct: 5   QRLPVVETFHSLQGEGRHAGRSAFFIRLAGC-----------TVGCSWCDTKH----SWP 49

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKR-GFEIAVETNG 120
              +    +  L     +  E    + V+TGGEPL     PL QAL+ R G  + +ET+G
Sbjct: 50  SQGHAEQPIGALASAAQMAAEAGASFVVITGGEPLHHNLQPLTQALDARCGLPLHLETSG 109

Query: 121 TIEPPQGIDWICVSPKAGCDLKIK---GGQELKLVFPQVN-----VSPENYIGFDFERFS 172
                   DWI +SPK     + +      ELK+V           +  +    D ER  
Sbjct: 110 VDPLTGRFDWITLSPKRHRPPRQELLQACHELKVVVHGPEDISFAAAMASQCEDDTERL- 168

Query: 173 LQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           LQP     + E   LA+ +  ++P+WRLS+Q+HK++GIR
Sbjct: 169 LQPGWESSIGE--ELALDHVRKHPQWRLSLQSHKWLGIR 205


>gi|148243542|ref|YP_001228699.1| organic radical activating protein [Synechococcus sp. RCC307]
 gi|147851852|emb|CAK29346.1| Organic radical activating enzyme [Synechococcus sp. RCC307]
          Length = 202

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 63/219 (28%), Positives = 89/219 (40%), Gaps = 25/219 (11%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M    + E F +LQGEG HAGR A F R  GC           +  C +CDT     Q  
Sbjct: 1   MSSLPVVETFHSLQGEGLHAGRSAFFIRLGGC-----------TVGCSWCDTKHSWPQTA 49

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL--NKRGFEIAVET 118
               +   +   L  E     ++   + V+TGGEPL        QAL          +ET
Sbjct: 50  ----HPALETQALAAEAAEAQQQGAAFVVITGGEPLHHNLDGFCQALAEMAPTLPRHLET 105

Query: 119 NGTIEPPQGIDWICVSPKAGCDLKIK---GGQELKLVFP---QVNVSPENYIGFDFERFS 172
           +G         WI +SPKA      +      ELK V      +  +           + 
Sbjct: 106 SGVDPLSGSFSWITLSPKAHKPPTQELLACCDELKAVVHGPEDLAFAEAMAAQAPQAHWL 165

Query: 173 LQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           LQP  G    +   LA+ +   +P WRLS+Q+HK++G+R
Sbjct: 166 LQP--GWDSPQGQQLAVEFVRNHPLWRLSLQSHKWLGVR 202


>gi|87300560|ref|ZP_01083402.1| possible organic radical activating enzyme [Synechococcus sp. WH
           5701]
 gi|87284431|gb|EAQ76383.1| possible organic radical activating enzyme [Synechococcus sp. WH
           5701]
          Length = 218

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 63/228 (27%), Positives = 97/228 (42%), Gaps = 37/228 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F +LQGEG HAGR A F R +GC           S  C +CDT           
Sbjct: 8   LPVVETFHSLQGEGVHAGRSAFFIRLAGC-----------SVGCSWCDTKH----SWPAD 52

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNK------RGFEIAVE 117
            + + +  DL     +   +   + V+TGGEPL     PL +AL +          + +E
Sbjct: 53  AHPLCRFQDLAASAALAAAEGAAFVVITGGEPLHHNLDPLCEALRQGSGAGPSPLPLHLE 112

Query: 118 TNGTIEPPQGIDWICVSPKAGCDLKIK---GGQELKLVFPQ-VNVSPENYIGF------- 166
           T+G        +WI +SPK       +      ELK+V  +  +++    +         
Sbjct: 113 TSGVDPLSGRFEWITLSPKRHRPPTAELLAACHELKVVIHEIADLAFAETMAAAVRSACP 172

Query: 167 ---DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
                 +  LQP  G        LA+ +  +NP WRLS+Q+HK++G+R
Sbjct: 173 VKGALPQLLLQPGWGS--AAGQELAVQHVRRNPAWRLSLQSHKWLGVR 218


>gi|78214102|ref|YP_382881.1| organic radical activating protein [Synechococcus sp. CC9605]
 gi|78198561|gb|ABB36326.1| possible organic radical activating enzyme [Synechococcus sp.
           CC9605]
          Length = 205

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 69/217 (31%), Positives = 98/217 (45%), Gaps = 27/217 (12%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F +LQGEG HAGR A F R +GC           +  C +CDT           
Sbjct: 7   LPVVETFHSLQGEGHHAGRSAFFIRLAGC-----------TVGCPWCDTKH----SWPSK 51

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKR-GFEIAVETNGTI 122
            +    +  L +   + GE    + V+TGGEPL     PL QAL+ R G  + +ET+G  
Sbjct: 52  GHPEQPIDALADAAQMAGEVGAGFVVITGGEPLHHDLQPLTQALDARCGLPLHLETSGVD 111

Query: 123 EPPQGIDWICVSPKAGCDLKIK---GGQELKLVFPQVN-----VSPENYIGFDFERFSLQ 174
                 DWI +SPK     + +      ELK+V           +  +    D ER  LQ
Sbjct: 112 PISGRFDWITLSPKRHRPPRQELLQACHELKVVVHGPEDISFAAAMASQCENDTERL-LQ 170

Query: 175 PMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           P  G        LA+ +  Q+ +WRLS+Q+HK++ IR
Sbjct: 171 P--GWECSIGEALAVEHVRQHSRWRLSMQSHKWLRIR 205


>gi|157414296|ref|YP_001485162.1| putative organic radical activating protein [Prochlorococcus
           marinus str. MIT 9215]
 gi|157388871|gb|ABV51576.1| possible organic radical activating enzyme [Prochlorococcus marinus
           str. MIT 9215]
          Length = 223

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 99/240 (41%), Gaps = 46/240 (19%)

Query: 1   MKLY-SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M  Y  I E F +LQGEG HAG+ A F R +GC              C +CDT       
Sbjct: 1   MTNYLPIVEQFHSLQGEGYHAGKSAFFVRLAGC-----------KVGCSWCDTK----NS 45

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNK-------RGF 112
               +Y    +  +I+   I  +K   +CV+TGGEPL        +A+ K          
Sbjct: 46  WDEKKYPSISIKKIIDRIKIARDKGASFCVITGGEPLQHNLDNFCKAIKKMTMREEQNSM 105

Query: 113 EIAVETNGTIEPPQGIDWICVSPKAGCDLKIKGGQEL--------------------KLV 152
           +I +ET+G        DW+ +SPK     K    ++                     K  
Sbjct: 106 KIHIETSGVNSISGSYDWMTLSPKRHSPPKNYFLKKCNEIKIIINDIKDIEFAIQIKKET 165

Query: 153 FPQVNVSP-ENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             Q  +S  E+ +  + + F LQP          +LAI +   NP W+LS+QTHK++ I+
Sbjct: 166 LKQYQLSKSEDGLKKEDKIFYLQPAWN--NANGLSLAIDFVKNNPDWKLSLQTHKYLKIK 223


>gi|124026869|ref|YP_001015984.1| putative organic radical activating protein [Prochlorococcus
           marinus str. NATL1A]
 gi|123961937|gb|ABM76720.1| possible organic radical activating enzyme [Prochlorococcus marinus
           str. NATL1A]
          Length = 213

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 67/225 (29%), Positives = 95/225 (42%), Gaps = 35/225 (15%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F +LQGEG HAGR A F R + C              C +CDT           
Sbjct: 5   LPVVECFHSLQGEGEHAGRSAYFIRLASC-----------KVGCPWCDTK----DSWNSE 49

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN-------KRGFEIAV 116
            +    L DL  +     E+   + V+TGGEPL      L + +        K+   I +
Sbjct: 50  LHPQQSLIDLSTQTAKAQEEGAAFVVITGGEPLHHNLDDLCKEIRKSTLNLEKKSIPIHL 109

Query: 117 ETNGTIEPPQGIDWICVSPKAGCDLKIKG---GQELKLVFPQVNV-----SPENYIGFDF 168
           ET+G        DWI +SPK     ++      QELK+V           +  + I  + 
Sbjct: 110 ETSGVDMLSGKPDWITLSPKRHSPPRLDNLLSCQELKVVIQNAEDLVFAKTMADSIKNNG 169

Query: 169 E---RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +   +  LQ   G   EE   LAI +   NP WRLS+QTHK++G+
Sbjct: 170 KIKPQLFLQ--AGWENEEGQTLAIKFVKNNPDWRLSMQTHKWLGV 212


>gi|262195340|ref|YP_003266549.1| radical SAM protein [Haliangium ochraceum DSM 14365]
 gi|262078687|gb|ACY14656.1| Radical SAM domain protein [Haliangium ochraceum DSM 14365]
          Length = 211

 Score =  175 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 73/219 (33%), Positives = 101/219 (46%), Gaps = 29/219 (13%)

Query: 4   YSIKEIF-LTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           Y +KEIF  TLQGEG HAGR  VF RF+GCNL            C +CDTDF        
Sbjct: 9   YRVKEIFGPTLQGEGTHAGRACVFLRFAGCNLQ-----------CSWCDTDFS---PEGA 54

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
            R   D++ + +    +      R  ++TGGEP LQ D  L  AL   GF + +E+NGT 
Sbjct: 55  ERLRADEITERLLALDV---HGARTVIVTGGEPALQWDQELADALRAAGFRVHMESNGTR 111

Query: 123 EPPQGIDWICVSPKAGCDLKIK--------GGQELKLVFPQV---NVSPENYIGFDFERF 171
            P   +DW+ VSPK       +           E KLV       +        ++    
Sbjct: 112 PPRAPVDWLTVSPKVQFHGPREALFASAEAAVSECKLVVDDSVSHDTLAALEHHYEGADL 171

Query: 172 SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            LQP      E++    ++   + P+WRLS+Q HK +G+
Sbjct: 172 LLQPCMDADYEQHLARTLTLIGERPRWRLSLQLHKIVGV 210


>gi|72383130|ref|YP_292485.1| putative organic radical activating protein [Prochlorococcus
           marinus str. NATL2A]
 gi|72002980|gb|AAZ58782.1| possible organic radical activating enzyme [Prochlorococcus marinus
           str. NATL2A]
          Length = 213

 Score =  175 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 67/225 (29%), Positives = 95/225 (42%), Gaps = 35/225 (15%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F +LQGEG HAGR A F R + C              C +CDT           
Sbjct: 5   LPVVECFHSLQGEGEHAGRSAYFIRLASC-----------KVGCPWCDTK----DSWNSE 49

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN-------KRGFEIAV 116
            +    L DL  +     E+   + V+TGGEPL      L + +        K+   I +
Sbjct: 50  LHPQQSLIDLSTQTAKAQEEGAAFVVITGGEPLHHNLDDLCKEIRKSTLNLEKKSIPIHL 109

Query: 117 ETNGTIEPPQGIDWICVSPKAGCDLKIKG---GQELKLVFPQVNV-----SPENYIGFDF 168
           ET+G        DWI +SPK     ++      QELK+V           +  + I  + 
Sbjct: 110 ETSGVDMLSGKPDWITLSPKRHSPPRLDNLLSCQELKVVIQNAEDLLFAKTMADSIKNNG 169

Query: 169 E---RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +   +  LQ   G   EE   LAI +   NP WRLS+QTHK++G+
Sbjct: 170 KIKPQLFLQ--AGWENEEGQTLAIKFVKNNPDWRLSMQTHKWLGV 212


>gi|113953027|ref|YP_732046.1| organic radical activating protein [Synechococcus sp. CC9311]
 gi|113880378|gb|ABI45336.1| possible organic radical activating enzyme [Synechococcus sp.
           CC9311]
          Length = 202

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 63/215 (29%), Positives = 98/215 (45%), Gaps = 24/215 (11%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F +LQGEG H GR A F R +GC++            CR+CDT       +   
Sbjct: 5   LPVVETFHSLQGEGLHTGRSAFFIRLAGCDV-----------GCRWCDTKHSWPADSHPK 53

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFE-IAVETNGTI 122
           R     + DL  E     E    + V+TGGEPL      L  A+     + + +ET+G  
Sbjct: 54  RL----VKDLAIEATSAAETGAAFVVITGGEPLHHNLDELTAAIRSGCSQPVHLETSGVD 109

Query: 123 EPPQGIDWICVSPKAGCDLKI---KGGQELKLVFPQ-VNVSPENYIGFDFER--FSLQPM 176
                 DWI +SPK     +    +   ELK+V  +  ++     +     +  + LQP 
Sbjct: 110 RLSGAPDWITLSPKRHKPPRQDVVQACHELKVVVHEPADLLFAEVVAAQAPQANWLLQP- 168

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            G   +E   LA+    ++ +WRLS+Q+HK++G+R
Sbjct: 169 -GWDCKEGLQLAVGKVQKDQRWRLSMQSHKWLGVR 202


>gi|255745752|ref|ZP_05419700.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholera CIRS 101]
 gi|262158970|ref|ZP_06030082.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae INDRE
           91/1]
 gi|255736827|gb|EET92224.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholera CIRS 101]
 gi|262029155|gb|EEY47807.1| queuosine Biosynthesis QueE Radical SAM [Vibrio cholerae INDRE
           91/1]
          Length = 216

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 58/229 (25%), Positives = 87/229 (37%), Gaps = 41/229 (17%)

Query: 9   IFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQ---------- 58
           +F  +QGEG   G  AVF R  GC +            C +CDT                
Sbjct: 1   MFEIIQGEGVFTGVPAVFVRLQGCPV-----------GCAWCDTKQTWETLDSDQTSFSQ 49

Query: 59  ---GTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIA 115
               T          A  + +++     + ++ V+TGGEP +     L QA    G    
Sbjct: 50  ILLKTNDAPTWCQATAQEVVQRYQAQGYQAKHIVITGGEPCIYDLTELTQAFEAMGCRCQ 109

Query: 116 VETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVSPENYIGF 166
           +ET+GT E       W+ VSPK     K+           E+K  V  + ++   + +  
Sbjct: 110 IETSGTYEVCATENTWVTVSPKVAMKGKLPILDSALQRANEIKHPVATEKDIDNLDELLA 169

Query: 167 DFER-----FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             +       +LQP+        T L I  C     WRLS+QTHK++ I
Sbjct: 170 RAQVSAQTAIALQPISQK--PRATELCIRTCIAR-NWRLSIQTHKYLNI 215


>gi|33862246|ref|NP_893807.1| putative organic radical activating protein [Prochlorococcus
           marinus subsp. pastoris str. CCMP1986]
 gi|33634464|emb|CAE20149.1| possible organic radical activating enzyme [Prochlorococcus marinus
           subsp. pastoris str. CCMP1986]
          Length = 223

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 64/238 (26%), Positives = 101/238 (42%), Gaps = 45/238 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               + E F +LQGEG H G+ A F R +GC           S  C +CDT         
Sbjct: 3   NFLPLVEKFHSLQGEGFHTGQSAFFIRLAGC-----------SVGCSWCDTKH----SWD 47

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNK-------RGFEI 114
             +Y +  +  +I+E     +K   + V+TGGEPL      L QA+NK          +I
Sbjct: 48  KEKYPLIPIKKIIDEIKKARKKGASFLVITGGEPLHHNLDNLCQAINKETSEKDQNPIKI 107

Query: 115 AVETNGTIEPPQGIDWICVSPKAGCDLKI---KGGQELKLVFPQ-------VNVSPENYI 164
            +ET+G  +     DWI +SPK     K    +   ELK++          +++  E   
Sbjct: 108 HIETSGVNKMSGNYDWITLSPKRHLPPKTYFLENFNELKIIINDKKDIDFAIDIKQEIMN 167

Query: 165 GFD-----------FERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            +             +++ +QP          +L I +   NP+W LS+QTHK++ I+
Sbjct: 168 KYQNLSSKDNFYKLDKKYYVQPAW--ENARGFSLTIDFVKNNPEWNLSLQTHKYLKIK 223


>gi|163800817|ref|ZP_02194717.1| aconitate hydratase [Vibrio sp. AND4]
 gi|159175166|gb|EDP59963.1| aconitate hydratase [Vibrio sp. AND4]
          Length = 216

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 60/230 (26%), Positives = 88/230 (38%), Gaps = 43/230 (18%)

Query: 9   IFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------------ 56
           +F T+QGEG   G  AVF R   C +            C +CDT                
Sbjct: 1   MFETIQGEGVFTGVPAVFVRLQECPV-----------GCSWCDTKQTWYAKEEDQRQIGD 49

Query: 57  --IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEI 114
             ++      +      D++ E    G    ++ V+TGGEP +     L  A  +   + 
Sbjct: 50  ILVKTEDSPTWCFASAQDIVVEYKKQG-FNAKHIVITGGEPCIYDLRELTAAFEEMDCQC 108

Query: 115 AVETNGTIEPPQ-GIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVSPENYIG 165
            +ET+GT E       W+ VSPK     K+           E+K  V  Q ++   + + 
Sbjct: 109 QIETSGTSEVVASESTWVTVSPKVAMKGKLPILKSALGRANEIKHPVGTQKDIDQLDVLL 168

Query: 166 FDFE-----RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              E       +LQP+        T L I  C     WRLSVQTHK++ I
Sbjct: 169 ASAEVGESTVIALQPISQK--PRATQLCIDTCIAR-NWRLSVQTHKYLSI 215


>gi|33241303|ref|NP_876245.1| putative organic radical activating protein [Prochlorococcus
           marinus subsp. marinus str. CCMP1375]
 gi|33238833|gb|AAQ00898.1| Radical activating enzyme [Prochlorococcus marinus subsp. marinus
           str. CCMP1375]
          Length = 225

 Score =  174 bits (441), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 66/241 (27%), Positives = 93/241 (38%), Gaps = 48/241 (19%)

Query: 1   MKL-YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M     I E F +LQGEG H G+ A F R  GC              C +CDT     + 
Sbjct: 1   MSTCLPIVERFHSLQGEGLHFGKSAFFIRLGGC-----------KVGCPWCDTK----ES 45

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNK-------RGF 112
                +    + +L +E  I   +     V+TGGEPL      L + +            
Sbjct: 46  WSIATHQEATVEELSKEAAIAQSQGAAILVITGGEPLHHNLNALCKTIQDFTSHNSRETM 105

Query: 113 EIAVETNGTIEPPQGIDWICVSPKAGCDLKI---KGGQELKLVFPQVNVSP--------- 160
            I +ET+G  E    I+WI +SPK     K    +   E+K+V  Q              
Sbjct: 106 PIHLETSGVDEITGLINWITLSPKRHALPKKSLLRACDEIKVVIHQKEDLLFAEEMANQS 165

Query: 161 -----------ENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIG 209
                      +           LQP  G   +E T L I Y   +P+WRLS+QTHK++G
Sbjct: 166 IKERQISKKTSDENHKISQPHLFLQP--GWNSKEGTQLTIEYIKSHPQWRLSLQTHKWLG 223

Query: 210 I 210
           +
Sbjct: 224 V 224


>gi|254526725|ref|ZP_05138777.1| radical activating enzyme [Prochlorococcus marinus str. MIT 9202]
 gi|221538149|gb|EEE40602.1| radical activating enzyme [Prochlorococcus marinus str. MIT 9202]
          Length = 227

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 65/238 (27%), Positives = 96/238 (40%), Gaps = 45/238 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               I E F +LQGEG HAG+ A F R +GC              C +CDT         
Sbjct: 7   NFLPIVEQFHSLQGEGYHAGKSAFFVRLAGC-----------KVGCSWCDTK----NSWD 51

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNK-------RGFEI 114
             +Y    +  +I+   I  +K   +CV+TGGEPL        +A+ K          +I
Sbjct: 52  EKKYPSISIKKIIDRIKIARDKGASFCVITGGEPLQHNLDNFCKAIKKMTMREEQNSMKI 111

Query: 115 AVETNGTIEPPQGIDWICVSPKAGCDLKIKGGQEL--------------------KLVFP 154
            +ET+G        DW+ +SPK     K    +                      K    
Sbjct: 112 HIETSGVNSISGSYDWMTLSPKRHSPPKNYFLKNCNEIKIIINDIKDIEFAIQIKKETLK 171

Query: 155 QVNVSP-ENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           Q  +S  E+ +  + + F LQP          +LAI +   NP W+LS+QTHK++ I+
Sbjct: 172 QYQLSKSEDGLKREDKIFYLQPAWN--NSNGLSLAIDFVKNNPDWKLSLQTHKYLKIK 227


>gi|16330304|ref|NP_441032.1| hypothetical protein sll2011 [Synechocystis sp. PCC 6803]
 gi|1652793|dbj|BAA17712.1| sll2011 [Synechocystis sp. PCC 6803]
          Length = 208

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 59/217 (27%), Positives = 92/217 (42%), Gaps = 31/217 (14%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I E F +LQGEG  AG  A F R  GC++            C +CD      +     
Sbjct: 14  YPIAETFHSLQGEGAWAGGNAFFIRLGGCDV-----------HCPWCDQK----ETWPTQ 58

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIE 123
            +    + +L+++          + V+TGGEPL+    PL + L  +G  + +ET+G   
Sbjct: 59  HHPRQTVTELVQQAVTAK---PSFVVITGGEPLMHDLQPLCKTLKNQGLRLHLETSGAYP 115

Query: 124 PPQGIDWICVSPKA---GCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQP----- 175
                DWI +SPK              ELK++  Q     E++   + E   + P     
Sbjct: 116 LTGQFDWITLSPKPYKLPQAAIYPLANELKVIISQ----DEDFDWAEMEARKISPGTPLY 171

Query: 176 -MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
                  E       +Y   + +WRLS+QTHK++G+R
Sbjct: 172 LQAEWETEAMNEKIFAYILTHSQWRLSLQTHKYLGVR 208


>gi|149910796|ref|ZP_01899430.1| radical activating enzyme [Moritella sp. PE36]
 gi|149806130|gb|EDM66110.1| radical activating enzyme [Moritella sp. PE36]
          Length = 222

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 60/239 (25%), Positives = 90/239 (37%), Gaps = 48/239 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y + EIF T+QGEG   G   +F R  GC++            C +CDT         
Sbjct: 1   MQYPVNEIFETVQGEGHFTGYPVIFIRLQGCDV-----------GCSWCDTKQTWTVDPE 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                               +   +   +I++         ++ V++GGEP     V L 
Sbjct: 50  MQVSQQTVNKACDDKPHWANFTAQEFITMIQK----NGFVAKHIVISGGEPCQYDLVELT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPK-------AGCDLKIKGGQELKLVFPQV 156
             L + G+   +ET+GT E       W+ VSPK             ++   E+K V    
Sbjct: 106 SELEQAGYFCQIETSGTSEVRATDSTWVTVSPKIQMKGQLPVLQSALRRANEIKHVIAME 165

Query: 157 NVSPE-----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               E       I    +   LQP+     +  T+LAI  C +   W+LSVQ HK+I I
Sbjct: 166 KHIEELDALIADIDTSDKIMCLQPISQ--QKRATDLAIKLCIER-NWKLSVQMHKYIFI 221


>gi|254431688|ref|ZP_05045391.1| radical SAM [Cyanobium sp. PCC 7001]
 gi|197626141|gb|EDY38700.1| radical SAM [Cyanobium sp. PCC 7001]
          Length = 209

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 60/218 (27%), Positives = 89/218 (40%), Gaps = 27/218 (12%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F +LQGEG H G+ A F R +GC              C +CDT           
Sbjct: 9   LPVVEAFHSLQGEGLHTGQSAFFIRLAGC-----------RVGCSWCDTKH----SWPMA 53

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIE 123
            +    L+ L +      +    + V+TGGEPL      L   L   G  + +ET+G   
Sbjct: 54  GHAEWSLSGLADAALAARQAGAGFVVITGGEPLHHDLTALCALLRSHGLRLHLETSGVEP 113

Query: 124 PPQGIDWICVSPKAGCDLK---IKGGQELKLVFPQVN-----VSPENYIGFDFER--FSL 173
               +DWI +SPK     +   I+   ELK+V    +     ++               L
Sbjct: 114 LRGQVDWIVLSPKRHQPPRDDLIRLCNELKVVVHSHDDLDFALAMARQANASGNHPALLL 173

Query: 174 QPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           QP  G    E   LA+ +   +  WRLS+Q+HK++ IR
Sbjct: 174 QP--GWESTEGQRLALDFVRSHADWRLSLQSHKWLAIR 209


>gi|317968277|ref|ZP_07969667.1| organic radical activating protein [Synechococcus sp. CB0205]
          Length = 209

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 63/215 (29%), Positives = 89/215 (41%), Gaps = 24/215 (11%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + E F +LQGEG HAGR A F R  GC              C +CDT           
Sbjct: 12  LPVVETFHSLQGEGLHAGRSAFFIRLGGC-----------RVGCSWCDTKH----SWPAE 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKR-GFEIAVETNGTI 122
            +    L +L             + VLTGGEPL      L  A+ +     I +ET+G  
Sbjct: 57  VHPQQSLEELALACAEAASAGAAFVVLTGGEPLHHNLDALSAAIRQHCSLPIHLETSGVD 116

Query: 123 EPPQGIDWICVSPKAGCDLKIK---GGQELKLVFPQVN---VSPENYIGFDFERFSLQPM 176
                 DWI +SPK     + +      ELK+V  +      +  +        + LQP 
Sbjct: 117 PLTGSPDWISLSPKRHQPPRAELLQRCDELKVVVHEAADLLFAEVSASQAPQATWLLQP- 175

Query: 177 DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            G    E   LA+ +    P+WRLS+Q+HK++G+R
Sbjct: 176 -GWDCREGQALALEFVQSQPRWRLSLQSHKWLGVR 209


>gi|261749286|ref|YP_003256971.1| hypothetical protein BPLAN_199 [Blattabacterium sp. (Periplaneta
           americana) str. BPLAN]
 gi|261497378|gb|ACX83828.1| conserved hypothetical protein [Blattabacterium sp. (Periplaneta
           americana) str. BPLAN]
          Length = 204

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 66/216 (30%), Positives = 98/216 (45%), Gaps = 29/216 (13%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           + +KE F ++QGEG  +G  A F RF GCN            QC +CDT     +  K  
Sbjct: 8   FPVKETFYSIQGEGFFSGIAAYFIRFEGCN-----------IQCDWCDTK-SSWKIEKKD 55

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIE 123
              V ++ + I E       + +  V+TGGEP++    PL   L K+G+ I VET+G+  
Sbjct: 56  FLTVHKIINNINE-------KVKTIVITGGEPMMWNLTPLTSLLKKKGYRIHVETSGSYP 108

Query: 124 -PPQGIDWICVSP---KAGCDLKIKGGQELKLVFPQVNV-----SPENYIGFDFERFSLQ 174
              + IDWI +SP   K       K   ELK++    +          Y+        LQ
Sbjct: 109 IHEKDIDWITISPKKKKRPLKENYKKMNELKIIICNESDFSFAEEQAFYVKKSNCVLCLQ 168

Query: 175 PMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           P +     +     ISY   +PKW++S+Q HK + I
Sbjct: 169 P-EWKNNIKILPKIISYIKNHPKWKISLQIHKILNI 203


>gi|156974667|ref|YP_001445574.1| hypothetical protein VIBHAR_02385 [Vibrio harveyi ATCC BAA-1116]
 gi|156526261|gb|ABU71347.1| hypothetical protein VIBHAR_02385 [Vibrio harveyi ATCC BAA-1116]
          Length = 216

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 60/230 (26%), Positives = 88/230 (38%), Gaps = 43/230 (18%)

Query: 9   IFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------------ 56
           +F T+QGEG   G  AVF R   C +            C +CDT                
Sbjct: 1   MFETIQGEGIFTGVPAVFVRLQECPV-----------GCSWCDTKQTWYAEEKDQRQIGD 49

Query: 57  --IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEI 114
             ++      +      D++ E    G    ++ V+TGGEP +     L  A  +   + 
Sbjct: 50  ILVKTEDSPTWCFASAEDIVAEYKKQG-FNAKHVVITGGEPCIYDLRALTAAFEEMDCQC 108

Query: 115 AVETNGTIEPPQ-GIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVSPENYIG 165
            +ET+GT E       W+ VSPK     K+           E+K  V  Q ++   + + 
Sbjct: 109 QIETSGTSEVVTSESTWVTVSPKVAMKGKLPVLKSALERANEIKHPVGTQKDIDQLDVLL 168

Query: 166 FDFE-----RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              E       +LQP+        T L I  C     WRLSVQTHK++ I
Sbjct: 169 ASAEIGEKTVIALQPISQK--PRATQLCIDTCVAR-NWRLSVQTHKYLSI 215


>gi|254506224|ref|ZP_05118367.1| organic radical activating enzyme [Vibrio parahaemolyticus 16]
 gi|219550704|gb|EED27686.1| organic radical activating enzyme [Vibrio parahaemolyticus 16]
          Length = 216

 Score =  171 bits (434), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 59/230 (25%), Positives = 92/230 (40%), Gaps = 43/230 (18%)

Query: 9   IFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRYNVD 68
           +F T+QGEG   G  +VF R   C +            C +CDT       T     +  
Sbjct: 1   MFETIQGEGVFTGVPSVFVRLQECPV-----------GCAWCDTKQTW-DATPQDETSFS 48

Query: 69  QLADL--------------IEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEI 114
           ++                 I +++   E   ++ V+TGGEP +    PL +A    G + 
Sbjct: 49  EIMKKTQDSPTWCQSSAQGIVDEYRNQEYTAKHIVITGGEPCIYDLTPLTEAFEAIGCQC 108

Query: 115 AVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKL-VFPQVNVSPENYIG 165
            +ET+GT E       W+ VSPK     K+           E+K  V  Q ++   + + 
Sbjct: 109 QIETSGTSEVRATDNTWVTVSPKVAMKGKLPVLDSALVRANEIKHPVATQKDIDQLDELL 168

Query: 166 FDFE-----RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
              +       +LQP+        T L I  C +   WRLS+QTHK++ I
Sbjct: 169 ERAKVPETTVVALQPISQK--PRATQLCIDVCVKR-NWRLSIQTHKYLSI 215


>gi|323497330|ref|ZP_08102348.1| organic radical activating enzyme [Vibrio sinaloensis DSM 21326]
 gi|323317413|gb|EGA70406.1| organic radical activating enzyme [Vibrio sinaloensis DSM 21326]
          Length = 216

 Score =  171 bits (433), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 56/230 (24%), Positives = 89/230 (38%), Gaps = 43/230 (18%)

Query: 9   IFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------------ 56
           +F T+QGEG + G  +VF R   C +            C +CDT                
Sbjct: 1   MFETIQGEGVYTGVPSVFVRLQECPV-----------GCAWCDTKQTWEALPEDETSFDR 49

Query: 57  --IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEI 114
             ++      +       ++ +  + G    ++ V+TGGEP +    PL +A    G + 
Sbjct: 50  IMVKTQDSPTWCSTSAEGIVNQYRVQG-YTAKHIVITGGEPCVYDLRPLTEAFEAIGCQC 108

Query: 115 AVETNGTIEP-PQGIDWICVSPKAGCDLKIK-------GGQELKLV------FPQVNVSP 160
            +ET+GT E       W+ VSPK     K+           E+K          Q++   
Sbjct: 109 QIETSGTSEVLTSDNTWVTVSPKVAMKGKLPVLDSALLRADEIKHPVATEKDIDQLDELI 168

Query: 161 ENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +          +LQP+        T L I  C +   WRLS+QTHK++ I
Sbjct: 169 KRAQVPKQTTIALQPISQK--PRATQLCIDVCVKR-NWRLSIQTHKYLSI 215


>gi|262341203|ref|YP_003284058.1| radical SAM domain-containing protein [Blattabacterium sp.
           (Blattella germanica) str. Bge]
 gi|262272540|gb|ACY40448.1| radical SAM domain-containing protein [Blattabacterium sp.
           (Blattella germanica) str. Bge]
          Length = 201

 Score =  171 bits (433), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 67/219 (30%), Positives = 99/219 (45%), Gaps = 28/219 (12%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M  + IKE F ++QGEG + G  A F RF GCN            +C +CDT     +  
Sbjct: 1   MISFPIKESFYSIQGEGFYYGMAAFFIRFEGCN-----------IKCDWCDTK----ESW 45

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
           K  + +   + ++I           +  V+TGGEP++     L + L K+G+ I VET+G
Sbjct: 46  KIKKKDFIPIHEIINHI---SNYTVKNIVITGGEPMMWNLYHLTKILKKKGYRIHVETSG 102

Query: 121 TIEPPQG-IDWICVSPKA---GCDLKIKGGQELKLVFPQVNV-----SPENYIGFDFERF 171
           T    +  +DWI VSPK      +   K   ELK++               ++       
Sbjct: 103 TYPIEEKYMDWITVSPKKIKLPLEENYKKTNELKIIISNEKDFLFAEEQAIHVKTTNCFL 162

Query: 172 SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
            LQP    F+       ISY  +NPKWR+S+Q HK + I
Sbjct: 163 FLQPEWTNFV-TIFPKIISYIKENPKWRISLQIHKMLNI 200


>gi|21672674|ref|NP_660741.1| hypothetical protein BUsg401 [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
 gi|25091592|sp|Q8K9D9|Y401_BUCAP RecName: Full=Uncharacterized protein BUsg_401
 gi|21623312|gb|AAM67952.1| hypothetical 25.0 kDa protein [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 219

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 58/234 (24%), Positives = 93/234 (39%), Gaps = 39/234 (16%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG----- 56
             Y I EIF T+QGEG + G  ++F R  GC +            C++CDT +       
Sbjct: 1   MYYPINEIFQTIQGEGYYTGTPSIFIRLQGCPV-----------HCKWCDTKYTWKCNNE 49

Query: 57  ---------IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL 107
                    ++     +++   + ++        +   ++ V+TGGEP L   + + + L
Sbjct: 50  DQISYEKIIMKKKSNRKWSYMNVKEI-ILIIKIKKWTAKHIVITGGEPCLYNLLEITKEL 108

Query: 108 NKRGFEIAVETNGTIEPPQG-IDWICVSPKAGCDLKIK---GGQELKLV------FPQVN 157
            K  ++  +ET+GT         WI +SPK              E+K           +N
Sbjct: 109 EKEDYKCQIETSGTELIKCSLNTWITLSPKINKKTLKTSILRSNEIKYPVLKKEDLFYLN 168

Query: 158 VSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              +           LQP+     EE  N+ I  C     WRLSVQ HK++ IR
Sbjct: 169 SILKKIKNKKHNLIFLQPISQ--NEEALNICIKTCIIK-NWRLSVQIHKYLKIR 219


>gi|220926065|ref|YP_002501367.1| radical SAM domain-containing protein [Methylobacterium nodulans
           ORS 2060]
 gi|219950672|gb|ACL61064.1| Radical SAM domain protein [Methylobacterium nodulans ORS 2060]
          Length = 230

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 67/245 (27%), Positives = 94/245 (38%), Gaps = 49/245 (20%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M ++++ EIF T QGE    G  +VF R  GC +            C FCDT        
Sbjct: 1   MTVFAVNEIFETFQGEAAFTGTPSVFVRLQGCPV-----------GCAFCDTKMTWHVRP 49

Query: 61  KGG---------RYNVDQLADLIEE--QWITGEKEGRYCVLTGGEPLLQVDVPLIQALNK 109
           +             +    A L +E    + GE   R+ V TGGEP L     + + L  
Sbjct: 50  EHEIEVGAMIAKTEDAPTWARLHDEDLAMLVGEFRARHVVFTGGEPALYDLTEVSRRLID 109

Query: 110 RGFEIAVETNGTI-EPPQGIDWICVSPKAGCDLKIK-------GGQELKLVFPQVNVSPE 161
           +G  + +ET+GT         W+ VSPK      +K          E+K+         E
Sbjct: 110 QGRTVQLETSGTALIRIDPHAWVTVSPKIDMPGGLKVLPAAVARANEIKMPI-GKPADIE 168

Query: 162 NYIGFDFER---------------FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHK 206
               F  E                  LQP+     E+ T L +     N  WRLS+QTHK
Sbjct: 169 KLQAFLAEHPAVGVAYTGSGPALLIWLQPLSQS--EKATALCMEAAAAN-GWRLSLQTHK 225

Query: 207 FIGIR 211
           F+G+R
Sbjct: 226 FVGVR 230


>gi|121533882|ref|ZP_01665708.1| Radical SAM domain protein [Thermosinus carboxydivorans Nor1]
 gi|121307393|gb|EAX48309.1| Radical SAM domain protein [Thermosinus carboxydivorans Nor1]
          Length = 196

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 70/218 (32%), Positives = 94/218 (43%), Gaps = 31/218 (14%)

Query: 1   MK--LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQ 58
           MK   Y + EIF ++QGEG H G  A F R +GCNL           +CR+CDT      
Sbjct: 1   MKAIKYPVVEIFTSIQGEGTHMGLPAAFIRLAGCNL-----------RCRWCDTVHAF-D 48

Query: 59  GTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVET 118
                    D++A  +  Q +         V+TGGEP L    PL+ AL+ RG  +A+ET
Sbjct: 49  PANATYLTPDEIATGLAPQLV---------VITGGEPTLHDLGPLVAALHARGKYVAIET 99

Query: 119 NGTIEPPQGI--DWICVSPKAGC-DLKIKGGQELKLVFPQVNVSPENYIGFDFE-RFSLQ 174
           NGT   P+    DW+  SPK     L      ELK V                  R  LQ
Sbjct: 100 NGTNPIPEKWGIDWVTASPKPNSGYLLACQADELKYVVDDEFTLDCVADDAVPPGRIFLQ 159

Query: 175 PMDGPFLEENTNLAISYCFQNPK--WRLSVQTHKFIGI 210
                   E+   A +   +NP+   RL +Q HK +G+
Sbjct: 160 VES--ARPESAKKAFALVMENPERGLRLGIQLHKILGV 195


>gi|313203030|ref|YP_004041687.1| radical sam domain protein [Paludibacter propionicigenes WB4]
 gi|312442346|gb|ADQ78702.1| Radical SAM domain protein [Paludibacter propionicigenes WB4]
          Length = 209

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 64/218 (29%), Positives = 97/218 (44%), Gaps = 28/218 (12%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           L ++ EIF ++QGEG +AGR AVF R S CN             C +CDTD+      KG
Sbjct: 9   LLNVVEIFHSIQGEGANAGRSAVFVRLSNCN-----------KNCWYCDTDWS-----KG 52

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
              +V Q+   + +     +      + TGGEP LQ+   +    +   +   +ETNGT 
Sbjct: 53  ETMSVSQILAEVNKFVGKKDYPNNLIIWTGGEPTLQLTDEI--LSHFSEYYNCIETNGTN 110

Query: 123 EPPQGIDWICVSPK---AGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDG- 178
             P  I +I  SPK          K   E +      +V P+       + + + P+   
Sbjct: 111 PVPSLIKYISCSPKVKPEVLRKNFKHVNEFRYPIGDGDVLPDIAELPAADNYIVSPIFLG 170

Query: 179 ------PFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                   ++EN   AI +  +NP+WRLS+Q HK + I
Sbjct: 171 EAKKRFEQVDENVKYAIDFVKKNPRWRLSLQLHKLLNI 208


>gi|34540794|ref|NP_905273.1| hypothetical protein PG1057 [Porphyromonas gingivalis W83]
 gi|34397108|gb|AAQ66172.1| conserved hypothetical protein [Porphyromonas gingivalis W83]
          Length = 197

 Score =  168 bits (425), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 68/216 (31%), Positives = 99/216 (45%), Gaps = 33/216 (15%)

Query: 6   IKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRY 65
           + EIF +LQGEG + GR AVF R +GCNL            C +CDTDF      +G + 
Sbjct: 3   VNEIFHSLQGEGANTGRAAVFVRLAGCNL-----------ACPYCDTDFA-----QGKKM 46

Query: 66  NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIEPP 125
           +++++A  IE          R+ + TGGEP LQ+        ++ G+  A+ETNGT   P
Sbjct: 47  SLEEIARSIE------HYPTRFLIWTGGEPTLQLTEEATAYFHRLGYFQAIETNGTRPVP 100

Query: 126 QGIDWICVSPKAGCDLKIK-----GGQELKLVF-PQVNVSPENYIGFDFERFSLQPMD-- 177
           +GID+I  SPK G   K+K     G  E +        + P        + + + P+   
Sbjct: 101 KGIDYISCSPKTGAIGKLKENFPDGVGEFRFPLGSDTPLPPPIDELPTAQHYLVSPIFAG 160

Query: 178 ---GPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                         + +    P WRLS+Q HK I I
Sbjct: 161 DDAMEPDPSAITRCVEFVKAFPAWRLSIQMHKLIHI 196


>gi|268680497|ref|YP_003304928.1| radical SAM protein [Sulfurospirillum deleyianum DSM 6946]
 gi|268618528|gb|ACZ12893.1| Radical SAM domain protein [Sulfurospirillum deleyianum DSM 6946]
          Length = 192

 Score =  167 bits (424), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 54/211 (25%), Positives = 90/211 (42%), Gaps = 23/211 (10%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + E+F ++QGEG   G  ++F R  GCNL            C FCD     +     
Sbjct: 1   MLKVVEMFYSIQGEGTQVGVPSIFIRLYGCNLS-----------CSFCD---EELHKGAY 46

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT- 121
              + D + + I+             ++TGGEP +      I  L    + ++VETNG  
Sbjct: 47  EELSFDAVLERIKA------YPSMNVIITGGEPSIYDLNGFIDFLQAHMYAVSVETNGYN 100

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF- 180
                  +WI  SPK    +   G  E+K +  + +   +      ++   +QP +    
Sbjct: 101 FSNIASANWITYSPKDWNHIAKHGYDEVKFIVSKDSDVSKLLDFKSYKPLFIQPQNNAHT 160

Query: 181 -LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             +EN    I++   NP++ LSVQ HKF+G+
Sbjct: 161 PNQENLAFCIAFVKANPRFILSVQLHKFLGV 191


>gi|94676807|ref|YP_588675.1| hypothetical protein BCI_0220 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|94219957|gb|ABF14116.1| conserved hypothetical protein [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 223

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 59/236 (25%), Positives = 84/236 (35%), Gaps = 41/236 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y I  I  TLQGEG  +G  A+F R  GC              C +CDT +   +   
Sbjct: 1   MQYPINSICQTLQGEGYFSGIPAIFIRLQGC-----------MVGCNWCDTKYTWHKNKI 49

Query: 62  GGRYNVDQL-------------ADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                 D +              + I    +      ++ V+TGGEP +   +PL   L 
Sbjct: 50  EQGIAKDIMLKKANSSVWSNLSEEDILALIVQQSWIAKHVVITGGEPCMYDLLPLTYLLE 109

Query: 109 KRGFEIAVETNGTIE-PPQGIDWICVSPKAGCDLKIK-------GGQELKLVFPQVNVSP 160
           +  F   +ET+GT         W+ VSPK      ++          E+K V  +     
Sbjct: 110 QYKFSCQIETSGTQSIKCTSNTWVTVSPKINKHYDVQILAQALSRSNEIKHVVSRQRDIK 169

Query: 161 ENYIGF------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                             LQP+    L   T L I  C     WRLS+Q HK++ I
Sbjct: 170 YLDELLLTLKDSKQRVICLQPLSQKKL--ATKLCIDTCIMR-NWRLSMQIHKYLNI 222


>gi|212702071|ref|ZP_03310199.1| hypothetical protein DESPIG_00073 [Desulfovibrio piger ATCC 29098]
 gi|212674512|gb|EEB34995.1| hypothetical protein DESPIG_00073 [Desulfovibrio piger ATCC 29098]
          Length = 225

 Score =  165 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 63/245 (25%), Positives = 89/245 (36%), Gaps = 54/245 (22%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI--- 57
           M+  ++ E F+TLQGE   AG  AVF RF GC +            C +CDT +      
Sbjct: 1   MRTLAVNEFFVTLQGEASFAGTPAVFVRFQGCPV-----------ACPWCDTQYAARLDG 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                         G        + L   I E         R+ VLTGGEP       L 
Sbjct: 50  ATLDFAAVRAKQGPGAGYADVEPEALLAAIREAGP------RHVVLTGGEPCRHDLTELT 103

Query: 105 QALNKRGFEIAVETNGTIEPPQG-IDWICVSPK-------AGCDLKIKGGQELKLVFPQV 156
             L   GF + +ET+GT+        W+ +SPK              +   E+K      
Sbjct: 104 SRLVTEGFRVQIETSGTMPIRCHADVWVTLSPKLDMPGGLEVRQDAWERAGEIKFPVDTA 163

Query: 157 NVSPENYIGFDFER----------FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHK 206
                        R            LQP+     +E T L +   F + +WR+SVQ HK
Sbjct: 164 ADLARFEQALAVARQAASRPLTELVWLQPVSQ--GKEATRLCVEAAFAH-QWRVSVQVHK 220

Query: 207 FIGIR 211
           ++ +R
Sbjct: 221 YLDLR 225


>gi|187251045|ref|YP_001875527.1| putative 6- pyruvoyltetrahydropterin 2-reductase [Elusimicrobium
           minutum Pei191]
 gi|186971205|gb|ACC98190.1| Putative 6- pyruvoyltetrahydropterin 2-reductase [Elusimicrobium
           minutum Pei191]
          Length = 195

 Score =  164 bits (416), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 62/213 (29%), Positives = 97/213 (45%), Gaps = 30/213 (14%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           + + EIF +LQGEG + G  AVF R SGC              C FCDTDF      +  
Sbjct: 6   FKLTEIFYSLQGEGMYTGTAAVFVRLSGC-----------LMGCSFCDTDF-----KENF 49

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT-I 122
               +++   ++      +   +  ++TGGEP  Q    LI++L + G ++ +ETNG+  
Sbjct: 50  VMTSEEIIKEVK------KYPSKIVIITGGEPAEQDICALIKSLKQAGLKVHIETNGSIY 103

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGF-----DFERFSLQPMD 177
              QG+D + VSPK   D  +     +  +    +    +   +     +     LQP  
Sbjct: 104 FDAQGVDNLTVSPKTYVDPNMLKSAHVIKIVVGQDTDISDLKKYFNYASEGRLIYLQPES 163

Query: 178 GPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               +EN +L +    +NP  RLS+QTHKF  I
Sbjct: 164 NK--QENIDLCVKLIKENPFLRLSLQTHKFAKI 194


>gi|152979671|ref|YP_001345300.1| radical SAM domain-containing protein [Actinobacillus succinogenes
           130Z]
 gi|150841394|gb|ABR75365.1| Radical SAM domain protein [Actinobacillus succinogenes 130Z]
          Length = 208

 Score =  161 bits (407), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 65/222 (29%), Positives = 98/222 (44%), Gaps = 39/222 (17%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  A+F RF  CNL            C +CDT +         
Sbjct: 10  YPIVEIFESLQGEGANTGMPAIFIRFGKCNL-----------ACPWCDTPY--------N 50

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNGTI 122
            +     + +I++         +  ++TGGEP +Q     L++ L + G+ +A+ETNG  
Sbjct: 51  EFAALTFSQIIQK---VRSFSAKNIIITGGEPTIQPRLSLLLEQLKQEGYFLAIETNGLK 107

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGF--------DFERFSLQ 174
             P  ID+I VSPK G   +    + +        V+ EN + F            + L 
Sbjct: 108 TVPSQIDYIAVSPK-GLYWEKYHSRCISFAHEVRIVADENVLKFCAFIEDKIKANHYYLS 166

Query: 175 PMDGPFLEENTNLAISYC------FQNPKWRLSVQTHKFIGI 210
           P +    + N    ++           PKW+LS+QTHK IGI
Sbjct: 167 PCET-DGKMNLYETVTLLGQLNQRANRPKWQLSLQTHKLIGI 207


>gi|223041979|ref|ZP_03612163.1| hypothetical protein AM202_0574 [Actinobacillus minor 202]
 gi|223017236|gb|EEF15664.1| hypothetical protein AM202_0574 [Actinobacillus minor 202]
          Length = 206

 Score =  160 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 64/222 (28%), Positives = 104/222 (46%), Gaps = 37/222 (16%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            Y I EIF +LQGEG + G  ++F RF  CNL            C +CDT +        
Sbjct: 7   TYPIVEIFESLQGEGFNTGMPSIFIRFGKCNLT-----------CSWCDTPYHQFDSW-- 53

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGT 121
               + Q+ + +E        + +  ++TGGEP +Q ++ + +  L +RG+ +A+ETNG 
Sbjct: 54  ---TLPQILEKVE------GYQAKNIIITGGEPTIQPNLTVLLDELKRRGYFLAIETNGL 104

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVS--PENYIGFDFERFSLQ 174
            + P  ID+I  SPK     K +        E+++V  +  ++   +       ER+ L 
Sbjct: 105 KDIPSQIDYIATSPKRLYAEKYQRRCIPFAHEVRIVADENVIAFCEQIEAQISAERYYLS 164

Query: 175 PMDGPFLEENTNLAISYC------FQNPKWRLSVQTHKFIGI 210
           P +    + N    I+           PKW+LS+QTHK +GI
Sbjct: 165 PCE-VEGKMNLLETITQIGLLNQRKNKPKWQLSIQTHKIVGI 205


>gi|258593846|emb|CBE70187.1| Radical SAM domain protein [NC10 bacterium 'Dutch sediment']
          Length = 214

 Score =  160 bits (406), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 55/228 (24%), Positives = 91/228 (39%), Gaps = 42/228 (18%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M    + EIF ++QGE  +AGR  VF R +GCNL           +CR+CDT +   +  
Sbjct: 1   MMSLRVNEIFYSIQGESTYAGRPCVFVRLTGCNL-----------RCRWCDTTYAFHE-- 47

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETN 119
            G + +++Q+ + +         +     +TGGEPLLQ    PLI  L   G+E+ +ET 
Sbjct: 48  -GEQRSIEQVLEQV------RGYKCPLVEITGGEPLLQEAVHPLIDRLLLEGYEVLIETG 100

Query: 120 GTIEPPQGIDWIC-----VSPKAGCDLKI--------KGGQELKLV------FPQVNVSP 160
           G++   +    +       +P +G D               ++K V      +       
Sbjct: 101 GSLSIDRLDRRVVKILDLKAPGSGMDPHNNLENLRHLDRKDQIKFVVADRRDYEWARRVM 160

Query: 161 ENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
             +   +       P+ G        LA          RL +Q HK++
Sbjct: 161 AEHALAEKAHVLFSPVLGELHPR--ELAEWILTDRLNVRLQIQLHKYL 206


>gi|188995161|ref|YP_001929413.1| hypothetical protein PGN_1297 [Porphyromonas gingivalis ATCC 33277]
 gi|188594841|dbj|BAG33816.1| conserved hypothetical protein [Porphyromonas gingivalis ATCC
           33277]
          Length = 197

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 67/216 (31%), Positives = 97/216 (44%), Gaps = 33/216 (15%)

Query: 6   IKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRY 65
           I EIF +LQGEG + GR AVF R +GCNL            C +CDTDF      +G + 
Sbjct: 3   INEIFHSLQGEGANTGRAAVFVRLAGCNL-----------ACPYCDTDFA-----QGKKM 46

Query: 66  NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIEPP 125
           +++++A  IE          R+ + TGGEP LQ+        ++ G+  A+ETNGT   P
Sbjct: 47  SLEEIARSIE------HYPTRFLIWTGGEPTLQLTEEATAYFHRLGYYQAIETNGTRLVP 100

Query: 126 QGIDWICVSPKAGCDLKIK-----GGQELKLVF-PQVNVSPENYIGFDFERFSLQPMD-- 177
           +GID+I  SPK     K+K     G  E +        + P        + + + P+   
Sbjct: 101 KGIDYISCSPKPEAIGKLKENFPDGVGEFRFPLGSDTPLPPPIDELPTAQHYLVSPIFAG 160

Query: 178 ---GPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                         + +    P W LS+Q HK I I
Sbjct: 161 DDAMEPDPSAITRCVEFVKAFPAWCLSIQMHKLIHI 196


>gi|325291195|ref|YP_004267376.1| Radical SAM domain protein [Syntrophobotulus glycolicus DSM 8271]
 gi|324966596|gb|ADY57375.1| Radical SAM domain protein [Syntrophobotulus glycolicus DSM 8271]
          Length = 203

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 63/221 (28%), Positives = 92/221 (41%), Gaps = 36/221 (16%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           K Y + EIF ++QGEG   G  A F R   CNL           +C +CD+        K
Sbjct: 8   KEYPVHEIFDSIQGEGYWTGAAASFVRLQQCNL-----------RCAWCDSKGTWEG--K 54

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
             +   D++   +  + +         +LTGGEPLL     L+++L   G ++ +ETNGT
Sbjct: 55  PEKMTADEILAAVHSERV---------ILTGGEPLLHDLTALLESLKAAGKKVHIETNGT 105

Query: 122 IEPPQGID---WICVSPKA-----GCDLKIKGGQELKLVFPQVNVSPENYIGFDFE---R 170
               +      WI VSPK                E K V  + + S +     +F     
Sbjct: 106 QPWKESYPQEAWITVSPKKESGYLVQPSIKSKANEYKFVVDE-DFSADILAQLEFNSCPN 164

Query: 171 FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
             L P +     E    A+S   Q P  RL++Q HK IG+R
Sbjct: 165 IFLSPEN--VRSEMIKKALSIVAQYPFCRLTLQLHKLIGVR 203


>gi|261867762|ref|YP_003255684.1| NrdG protein [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261413094|gb|ACX82465.1| NrdG protein [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 209

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 67/224 (29%), Positives = 101/224 (45%), Gaps = 37/224 (16%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M  Y+I EIF +LQGEG + G   +F RF  CNL            C +CDT++   +  
Sbjct: 8   MPSYNIVEIFESLQGEGFNTGMPCIFVRFGKCNL-----------ACPWCDTNYNQFE-- 54

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETN 119
              R  + Q+ + +           +  ++TGGEP +  ++ + ++ +   G+ +A+ETN
Sbjct: 55  ---RMTLAQVMEEV------RSFSSKNIIITGGEPTIVPNIEILLEQMKSEGYFLAIETN 105

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPEN--------YIGFDFERF 171
           G    P  ID+I  SPK     K +  + +        V+ EN              ER+
Sbjct: 106 GLKPIPPQIDYIATSPKRLYPHKYER-RCIDFAHEVRIVADENVMAFCELIEDKIRAERY 164

Query: 172 SLQPMDG----PFLEENTNL-AISYCFQNPKWRLSVQTHKFIGI 210
            L P +       LE  T L  ++     PKW LSVQTHK IGI
Sbjct: 165 YLSPCEINGKMNLLETITQLGQLNQRVNRPKWLLSVQTHKLIGI 208


>gi|240949106|ref|ZP_04753454.1| hypothetical protein AM305_01574 [Actinobacillus minor NM305]
 gi|240296501|gb|EER47133.1| hypothetical protein AM305_01574 [Actinobacillus minor NM305]
          Length = 206

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 64/222 (28%), Positives = 105/222 (47%), Gaps = 37/222 (16%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            Y I EIF +LQGEG + G  ++F RF  CNL            C +CDT +        
Sbjct: 7   TYPIVEIFESLQGEGFNTGMPSIFIRFGKCNLT-----------CSWCDTPYHQFDSW-- 53

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGT 121
               + Q+ + +E        + +  ++TGGEP +Q ++ + +  L +RG+ +A+ETNG 
Sbjct: 54  ---TLTQILEKVE------GYQAKNIIITGGEPTIQPNLTVLLDELKQRGYFLAIETNGL 104

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVS--PENYIGFDFERFSLQ 174
            + P  ID+I  SPK     K +        E+++V  +  ++   +     + ER+ L 
Sbjct: 105 KDIPTQIDYIATSPKRLYAKKYQRRCIPFAHEVRIVADENVIAFCEQIETQINAERYYLS 164

Query: 175 PMDGPFLEENTNLAISYC------FQNPKWRLSVQTHKFIGI 210
           P +    + N    I+           PKW+LS+QTHK +GI
Sbjct: 165 PCE-VEGKMNLLETITQIGLLNQRKNKPKWQLSIQTHKIVGI 205


>gi|293390438|ref|ZP_06634772.1| NrdG protein [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290950972|gb|EFE01091.1| NrdG protein [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 224

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 67/224 (29%), Positives = 101/224 (45%), Gaps = 37/224 (16%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M  Y+I EIF +LQGEG + G   +F RF  CNL            C +CDT++   +  
Sbjct: 23  MPSYNIVEIFESLQGEGFNTGMPCIFVRFGKCNLT-----------CPWCDTNYNQFE-- 69

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETN 119
              R  + Q+ + +           +  ++TGGEP +  ++ + ++ +   G+ +A+ETN
Sbjct: 70  ---RMTLAQVMEEV------RSFSSKNIIITGGEPTIVPNIEILLEQMKSEGYFLAIETN 120

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPEN--------YIGFDFERF 171
           G    P  ID+I  SPK     K +  + +        V+ EN              ER+
Sbjct: 121 GLKPIPPQIDYIATSPKRLYPNKYER-RCIDFAHEVRIVADENVMAFCELIEDKIRAERY 179

Query: 172 SLQPMDG----PFLEENTNL-AISYCFQNPKWRLSVQTHKFIGI 210
            L P +       LE  T L  ++     PKW LSVQTHK IGI
Sbjct: 180 YLSPCEINGKMNLLETITQLGQLNQRVNRPKWLLSVQTHKLIGI 223


>gi|52425912|ref|YP_089049.1| NrdG protein [Mannheimia succiniciproducens MBEL55E]
 gi|52307964|gb|AAU38464.1| NrdG protein [Mannheimia succiniciproducens MBEL55E]
          Length = 224

 Score =  158 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 70/222 (31%), Positives = 102/222 (45%), Gaps = 37/222 (16%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            Y I EIF +LQGEG + G   +F RF  CNL            C +CDTD+        
Sbjct: 25  RYPIVEIFESLQGEGFNTGMPCIFVRFGKCNL-----------ACPWCDTDY-------- 65

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKR-GFEIAVETNGT 121
            R+    L  ++E+         +  ++TGGEP +Q ++ L+ A  KR G+ +A+ETNG 
Sbjct: 66  ERFEYRTLQQIVEK---VRSFSAKNIIITGGEPTIQPNISLLLAQFKRDGYFLAIETNGL 122

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGG-----QELKLVF--PQVNVSPENYIGFDFERFSLQ 174
              P  ID+I  SPKA    K +        E+++V      N   +       ER+ L 
Sbjct: 123 RAVPPQIDYISASPKAMYAEKYRRRCIDFAHEVRIVMDADAENFCQQIEQKIRAERYYLS 182

Query: 175 PMDGPFLEENTNLAISYCFQ------NPKWRLSVQTHKFIGI 210
           P +    + N    I+   +       PKW+LS+QTHK  GI
Sbjct: 183 PCEIE-GKMNLLETIALLGKLNQRPNKPKWQLSIQTHKLAGI 223


>gi|186474664|ref|YP_001863635.1| hypothetical protein Bphy_7690 [Burkholderia phymatum STM815]
 gi|184198623|gb|ACC76585.1| conserved hypothetical protein [Burkholderia phymatum STM815]
          Length = 235

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 58/234 (24%), Positives = 85/234 (36%), Gaps = 40/234 (17%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG------- 56
           Y + EIF +LQGEG   G  +VF R  GC +            C +CD+           
Sbjct: 16  YPVNEIFESLQGEGNFTGTPSVFVRLQGCPV-----------GCAWCDSKHTWQVMPERE 64

Query: 57  -----IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRG 111
                +    G   +     D+     I    +  + V+TGGEP +    PLI  L    
Sbjct: 65  ISVGAMGEKTGRPCDSYAWCDVPTLANIVRAADAEHVVITGGEPCMYDLRPLIAKLQAWH 124

Query: 112 FEIAVETNGTI-EPPQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQVNVSPENY 163
             + VET+GT         ++  SPK G        D  ++   E+K    +        
Sbjct: 125 HRVQVETSGTYVPLVTPSTFVTTSPKYGMPSGRPVLDEALERANEIKYPVGKQRDIDIVL 184

Query: 164 IGFDF------ERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              D           LQP+        T + +        WR+S+QT+KFI IR
Sbjct: 185 ERLDPIQRARGTPIWLQPLS--LSSRATGICMK-AAHRYGWRVSLQTNKFINIR 235


>gi|165976520|ref|YP_001652113.1| organic radical activating enzyme [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|165876621|gb|ABY69669.1| organic radical activating enzyme [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
          Length = 210

 Score =  158 bits (399), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 62/223 (27%), Positives = 102/223 (45%), Gaps = 36/223 (16%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             + I EIF +LQGEG + G   +F R   CNL            C +CDT++      +
Sbjct: 9   TAFPIVEIFESLQGEGFNTGLPCIFVRLGKCNL-----------ACPWCDTNY-----NE 52

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQ-VDVPLIQALNKRGFEIAVETNG 120
             ++++ ++ + ++          ++ ++TGGEP +      L+      G+ +A+ETNG
Sbjct: 53  YEKWSLAKILERVK------SYSAKHIIITGGEPTMYANLSVLLDVFKAEGYWLAIETNG 106

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNV---SPENYIGFDFERFS 172
               P+ ID+I  SPK     K          E+++V  + +V     +       E + 
Sbjct: 107 LKAVPKQIDYIATSPKLMYQEKYLRECISFANEVRIVVDKGDVQSFCEQIETQITAEHYY 166

Query: 173 LQPM--DGP--FLEENTNL-AISYCFQNPKWRLSVQTHKFIGI 210
           L P   DG    LE  T L  ++     PKW+LS+QTHK +GI
Sbjct: 167 LSPCEVDGKMNLLETITQLGILNQRAYKPKWQLSLQTHKLVGI 209


>gi|32035298|ref|ZP_00135305.1| COG0602: Organic radical activating enzymes [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208571|ref|YP_001053796.1| hypothetical protein APL_1099 [Actinobacillus pleuropneumoniae L20]
 gi|190150424|ref|YP_001968949.1| hypothetical protein APP7_1155 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303253329|ref|ZP_07339478.1| organic radical activating enzyme [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307246015|ref|ZP_07528097.1| hypothetical protein appser1_12160 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307248119|ref|ZP_07530147.1| hypothetical protein appser2_11000 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307250350|ref|ZP_07532299.1| hypothetical protein appser4_11310 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307254996|ref|ZP_07536814.1| hypothetical protein appser9_12300 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307259432|ref|ZP_07541157.1| hypothetical protein appser11_12290 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307263767|ref|ZP_07545373.1| hypothetical protein appser13_11780 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|126097363|gb|ABN74191.1| hypothetical protein APL_1099 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|189915555|gb|ACE61807.1| hypothetical protein APP7_1155 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302648011|gb|EFL78218.1| organic radical activating enzyme [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306852950|gb|EFM85173.1| hypothetical protein appser1_12160 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306855296|gb|EFM87471.1| hypothetical protein appser2_11000 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306857625|gb|EFM89732.1| hypothetical protein appser4_11310 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306861869|gb|EFM93845.1| hypothetical protein appser9_12300 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306866368|gb|EFM98231.1| hypothetical protein appser11_12290 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306870888|gb|EFN02626.1| hypothetical protein appser13_11780 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 210

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 63/223 (28%), Positives = 101/223 (45%), Gaps = 36/223 (16%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             + I EIF +LQGEG + G   +F R   CNL            C +CDT++      +
Sbjct: 9   TAFPIVEIFESLQGEGFNTGLPCIFVRLGKCNL-----------ACPWCDTNY-----NE 52

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQ-VDVPLIQALNKRGFEIAVETNG 120
             +++V ++ + ++          +  ++TGGEP +      L+      G+ +A+ETNG
Sbjct: 53  YEKWSVAKILERVK------SYSAKNIIITGGEPTMYANLSVLLDVFKAEGYWLAIETNG 106

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNV---SPENYIGFDFERFS 172
               P+ ID+I  SPK     K          E+++V  + +V     +       E + 
Sbjct: 107 LKAVPKQIDYIATSPKLMYQEKYLRECISFANEVRIVVDKGDVQSFCEQIETQITAEHYY 166

Query: 173 LQPM--DGP--FLEENTNL-AISYCFQNPKWRLSVQTHKFIGI 210
           L P   DG    LE  T L  ++     PKW+LS+QTHK +GI
Sbjct: 167 LSPCEVDGKMNLLETITQLGILNQRAYKPKWQLSLQTHKLVGI 209


>gi|307257150|ref|ZP_07538922.1| hypothetical protein appser10_11500 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306864312|gb|EFM96223.1| hypothetical protein appser10_11500 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 210

 Score =  155 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 63/223 (28%), Positives = 101/223 (45%), Gaps = 36/223 (16%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             + I EIF +LQGEG + G   +F R   CNL            C +CDT++      +
Sbjct: 9   TAFPIVEIFESLQGEGFNTGLPCIFVRLGKCNL-----------ACPWCDTNY-----NE 52

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQ-VDVPLIQALNKRGFEIAVETNG 120
             +++V ++ + ++          +  ++TGGEP +      L+      G+ +A+ETNG
Sbjct: 53  YEKWSVAKILERVK------SYSAKNIIITGGEPTMYANLSVLLDVFKAEGYWLAIETNG 106

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNV---SPENYIGFDFERFS 172
               P+ ID+I  SPK     K          E+++V  + +V     +       E + 
Sbjct: 107 LKAVPKQIDYIATSPKLMYQEKYLRECISFANEVRIVMDKGDVQSFCEQIETQITAEHYY 166

Query: 173 LQPM--DGP--FLEENTNL-AISYCFQNPKWRLSVQTHKFIGI 210
           L P   DG    LE  T L  ++     PKW+LS+QTHK +GI
Sbjct: 167 LSPCEVDGKMNLLETITQLGILNQRAYKPKWQLSLQTHKLVGI 209


>gi|303250156|ref|ZP_07336358.1| organic radical activating enzyme [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307252734|ref|ZP_07534625.1| hypothetical protein appser6_12480 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|302651219|gb|EFL81373.1| organic radical activating enzyme [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306859766|gb|EFM91788.1| hypothetical protein appser6_12480 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 210

 Score =  155 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 63/223 (28%), Positives = 101/223 (45%), Gaps = 36/223 (16%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             + I EIF +LQGEG + G   +F R   CNL            C +CDT++      +
Sbjct: 9   TAFPIVEIFESLQGEGFNTGLPCIFVRLGKCNL-----------ACPWCDTNY-----NE 52

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQ-VDVPLIQALNKRGFEIAVETNG 120
             +++V ++ + ++          +  ++TGGEP +      L+      G+ +A+ETNG
Sbjct: 53  YEKWSVAKILERVK------SYSAKNIIITGGEPTMYANLSVLLDVFKAEGYWLAIETNG 106

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNV---SPENYIGFDFERFS 172
               P+ ID+I  SPK     K          E+++V  + +V     +       E + 
Sbjct: 107 LKAVPKQIDYIATSPKLMYQEKYLRECISFANEVRIVMDKGDVQSFCEQIETQITAEHYY 166

Query: 173 LQPM--DGP--FLEENTNL-AISYCFQNPKWRLSVQTHKFIGI 210
           L P   DG    LE  T L  ++     PKW+LS+QTHK +GI
Sbjct: 167 LSPCEVDGKMNLLETITQLGILNQRAYKPKWQLSLQTHKLVGI 209


>gi|307261578|ref|ZP_07543246.1| hypothetical protein appser12_11390 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306868701|gb|EFN00510.1| hypothetical protein appser12_11390 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 210

 Score =  155 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 62/223 (27%), Positives = 101/223 (45%), Gaps = 36/223 (16%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             + I EIF +LQGEG + G   +F R   CNL            C +CDT++      +
Sbjct: 9   TAFPIVEIFESLQGEGFNTGLPCIFVRLGKCNL-----------ACPWCDTNY-----NE 52

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQ-VDVPLIQALNKRGFEIAVETNG 120
             ++++ ++ + ++          +  ++TGGEP +      L+      G+ +A+ETNG
Sbjct: 53  YEKWSLAKILERVK------SYSAKNIIITGGEPTMYANLSVLLDVFKAEGYWLAIETNG 106

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNV---SPENYIGFDFERFS 172
               P+ ID+I  SPK     K          E+++V  + +V     +       E + 
Sbjct: 107 LKAVPKQIDYIATSPKLMYQEKYLRECISFANEVRIVVDKGDVQSFCEQIETQITAEHYY 166

Query: 173 LQPM--DGP--FLEENTNL-AISYCFQNPKWRLSVQTHKFIGI 210
           L P   DG    LE  T L  ++     PKW+LS+QTHK +GI
Sbjct: 167 LSPCEVDGKMNLLETITQLGILNQRAYKPKWQLSLQTHKLVGI 209


>gi|292490344|ref|YP_003525783.1| radical SAM protein [Nitrosococcus halophilus Nc4]
 gi|291578939|gb|ADE13396.1| Radical SAM domain protein [Nitrosococcus halophilus Nc4]
          Length = 213

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 51/228 (22%), Positives = 85/228 (37%), Gaps = 42/228 (18%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           MK   I EIF +LQGE    G   VF R +GC L           +C +CDT++      
Sbjct: 1   MKRLRITEIFHSLQGESRSVGWPTVFVRLTGCPL-----------RCHYCDTEYAF---Q 46

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETN 119
            G    +D++   + E         R+  +TGGEPL Q   + L+  L   G+E+++ET+
Sbjct: 47  GGTWMELDEILATVAE------FGARHVTVTGGEPLAQPACLELLTQLCDVGYEVSLETS 100

Query: 120 GTIEPPQGIDWICVSPKAGCD-------------LKIKGGQELKLVFPQVNV------SP 160
           G ++       +                        +    ++KLV    +       + 
Sbjct: 101 GALDISAVDPRVVKVMDLKTPGSGEEARNSTTNLDYLSSQDQVKLVLCDRHDYEWARTAL 160

Query: 161 ENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           E +   +       P         T+LA          R+ +Q HK++
Sbjct: 161 ERHRLAERCEVLFSPSYEQLSP--TDLAEWILEDRLPVRMQIQLHKYL 206


>gi|284050732|ref|ZP_06380942.1| hypothetical protein AplaP_04589 [Arthrospira platensis str.
           Paraca]
 gi|291570892|dbj|BAI93164.1| possible organic radical activating enzyme [Arthrospira platensis
           NIES-39]
          Length = 204

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 62/224 (27%), Positives = 92/224 (41%), Gaps = 33/224 (14%)

Query: 1   MKLYSIKEIFL-TLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M    + E F  T+QGEG  AG    F R +GC +            C +CDT +    G
Sbjct: 1   MITIPVHETFQQTIQGEGYWAGTPVDFIRLAGCPV-----------GCPWCDTGYA--DG 47

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVET 118
            KG   NV     L+ E            V++GGEP +   +P L++ L   G ++++ET
Sbjct: 48  GKGLPRNVRSFDQLLAELV------SPRVVISGGEPFIYPQLPDLVRVLEDSGRQVSIET 101

Query: 119 NG-TIEPPQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQVNVSPENYIGFDFE- 169
           +G   +    + WI +SPK              +   E+KLV    +             
Sbjct: 102 SGAFWQDVSDLCWITLSPKEHISPGYPVVSPMWRRASEIKLVIDVGDELEFYGCRLAENS 161

Query: 170 --RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
                LQP     +E    L +    Q P +RLSVQ HK+IG++
Sbjct: 162 TIPVFLQPQWT-DIERTLPLVLEKLKQFPGYRLSVQLHKYIGVQ 204


>gi|219871538|ref|YP_002475913.1| anaerobic ribonucleotide reductase activating protein NrdG
           [Haemophilus parasuis SH0165]
 gi|219691742|gb|ACL32965.1| anaerobic ribonucleotide reductase activating protein NrdG
           [Haemophilus parasuis SH0165]
          Length = 204

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 66/220 (30%), Positives = 97/220 (44%), Gaps = 35/220 (15%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF TLQGEG + G  ++F RF  CNL            C +CDT++         
Sbjct: 6   YRIVEIFETLQGEGFNTGMPSIFIRFGKCNL-----------ACPWCDTNY--------N 46

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
           +Y    LAD+++   +      +  ++TGGEP +Q D+   +  L   G+ IA+ETNG  
Sbjct: 47  QYETKTLADIMQ---VVKGFSAKNIIITGGEPTIQPDLTYLLDTLKAEGYFIAIETNGLK 103

Query: 123 EPPQGIDWICVSPKA-----GCDLKIKGGQELKLVFPQVNVSPENYIG--FDFERFSLQP 175
             P  ID+I  SPK           I    E+++V     ++    I      ER+ L P
Sbjct: 104 PVPPQIDYIATSPKRLYQKNYLKHHIPFANEVRIVVDGDVLAFCEQIESTIKAERYYLSP 163

Query: 176 MDGPFLEENTNLAISYCF-----QNPKWRLSVQTHKFIGI 210
            +   +                   P+W+LS+QTHK  GI
Sbjct: 164 CEENGVMNMLETITQLGKLNQRPNKPRWQLSIQTHKMAGI 203


>gi|319945214|ref|ZP_08019476.1| anaerobic ribonucleoside-triphosphate reductase small subunit
           [Lautropia mirabilis ATCC 51599]
 gi|319741784|gb|EFV94209.1| anaerobic ribonucleoside-triphosphate reductase small subunit
           [Lautropia mirabilis ATCC 51599]
          Length = 244

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 70/221 (31%), Positives = 99/221 (44%), Gaps = 37/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF TLQGEG + G  +VF RF  CNL            C +CDTD+         
Sbjct: 46  YRIVEIFETLQGEGFNTGMPSVFIRFGKCNL-----------ACPWCDTDY--------N 86

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVETNGTI 122
           R+    L D++ +         R  ++TGGEP +Q  +  L+ +L   G  +A+ETNG  
Sbjct: 87  RFGTMTLGDILAK---VRTFSARNVIITGGEPTIQPHLERLLDSLKAEGHFLAIETNGLK 143

Query: 123 EPPQGIDWICVSPK-----AGCDLKIKGGQELKLVFPQ--VNVSPENYIGFDFERFSLQP 175
             P  ID+I  SPK     A     IK   E+++V      +   +       +R+ L P
Sbjct: 144 PVPPQIDYIATSPKRLYQQAYQKRHIKFAHEVRIVVDGDVRDFCAQIEDSIQADRYYLSP 203

Query: 176 MDGPFLEENTNLAISYCFQ------NPKWRLSVQTHKFIGI 210
            +      N    I+   Q       P+W+LS+QTHK  GI
Sbjct: 204 CE-VDGRMNMLETITQLGQLNQRPGRPRWQLSIQTHKLAGI 243


>gi|329119485|ref|ZP_08248170.1| radical SAM domain protein [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464418|gb|EGF10718.1| radical SAM domain protein [Neisseria bacilliformis ATCC BAA-1200]
          Length = 212

 Score =  154 bits (390), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 65/221 (29%), Positives = 97/221 (43%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  A+F R   CNL            C +CDTD++        
Sbjct: 13  YRIVEIFESLQGEGWNTGMPAIFVRLGKCNL-----------ACSWCDTDYL-------- 53

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNGTI 122
           ++++  L+++            R  ++TGGEP +Q     L+ AL   G+ + +ETNG  
Sbjct: 54  KFSMMPLSEI---LGRLKNYTARNIIITGGEPTIQPHLNTLLDALKNAGYRLCIETNGLN 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVS--PENYIGFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     +S            R+ L P
Sbjct: 111 PAPPQIDYVAASPKACYAAKYEKSCIAAADEVRIVADGDVISFCEALEQKIRARRYYLSP 170

Query: 176 MDGPFLEE--NTNLAISYCFQNP----KWRLSVQTHKFIGI 210
            +        +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQNGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 211


>gi|322514966|ref|ZP_08067979.1| anaerobic ribonucleoside-triphosphate reductase small subunit
           [Actinobacillus ureae ATCC 25976]
 gi|322119074|gb|EFX91234.1| anaerobic ribonucleoside-triphosphate reductase small subunit
           [Actinobacillus ureae ATCC 25976]
          Length = 210

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 64/220 (29%), Positives = 100/220 (45%), Gaps = 36/220 (16%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            I EIF +LQGEG + G   +F R   CNL            C +CDT++      +  +
Sbjct: 12  PIVEIFESLQGEGFNTGLPCIFVRLGKCNL-----------ACPWCDTNY-----NEYEK 55

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQ-VDVPLIQALNKRGFEIAVETNGTIE 123
           +NV ++ + ++          +  ++TGGEP +      L+      G+ +A+ETNG   
Sbjct: 56  WNVAKILERVK------SYSAKNIIITGGEPTMYANLSVLLDVFKVEGYWLAIETNGLKA 109

Query: 124 PPQGIDWICVSPKAGCDLKI-----KGGQELKLVFPQVNV---SPENYIGFDFERFSLQP 175
            P+ ID+I  SPK     K          E+++V  + +V     +       E + L P
Sbjct: 110 VPKQIDYIATSPKLMYQEKYLRECIPFANEVRIVMDKGDVQGFCEQIETQITAEHYYLSP 169

Query: 176 M--DGP--FLEENTNL-AISYCFQNPKWRLSVQTHKFIGI 210
              DG    LE  T L  ++     PKW+LS+QTHK +GI
Sbjct: 170 CEVDGKMNLLETITQLGILNQRANKPKWQLSLQTHKLVGI 209


>gi|251792175|ref|YP_003006895.1| NrdG protein [Aggregatibacter aphrophilus NJ8700]
 gi|247533562|gb|ACS96808.1| NrdG protein [Aggregatibacter aphrophilus NJ8700]
          Length = 209

 Score =  154 bits (389), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 65/220 (29%), Positives = 99/220 (45%), Gaps = 35/220 (15%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y+I EIF +LQGEG + G  ++F RF  CNL            C +CDT++   +     
Sbjct: 11  YNIVEIFESLQGEGFNTGMPSIFVRFGKCNL-----------ACPWCDTNYNQFE----- 54

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVETNGTI 122
           R  + Q+ + +           +  ++TGGEP +  ++  L+  +   G+ +A+ETNG  
Sbjct: 55  RMTLAQIMEEV------RSFSAKNIIITGGEPTIVPNIELLLNQMKSEGYFLAIETNGLK 108

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQV--NVSPENYIGFDFERFSLQP 175
             P  ID+I  SPK     K +        E+++V      +            R+ L P
Sbjct: 109 PIPTQIDYIATSPKRLYQHKYEQRCIEFADEVRIVADGDVSDFCALIEENIQATRYYLSP 168

Query: 176 MDG----PFLEENTNL-AISYCFQNPKWRLSVQTHKFIGI 210
            +       LE  T L  ++     PKW LSVQTHK IGI
Sbjct: 169 CEINGKMNLLETITQLGLLNQRPNKPKWLLSVQTHKLIGI 208


>gi|261492302|ref|ZP_05988864.1| NrdG protein [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261495367|ref|ZP_05991816.1| NrdG protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261308970|gb|EEY10224.1| NrdG protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261311985|gb|EEY13126.1| NrdG protein [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 208

 Score =  154 bits (389), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 63/221 (28%), Positives = 98/221 (44%), Gaps = 35/221 (15%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            + I EIF +LQGEG + G  A+F RF  CNL            C +CDT++   +    
Sbjct: 9   RFPIVEIFESLQGEGFNTGMPAIFVRFGKCNLT-----------CPWCDTNYNQFE---- 53

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVETNGT 121
            ++ +  +   +           +  ++TGGEP +Q ++  L++   K G+ +A+ETNG 
Sbjct: 54  -QWTLSDILAKV------RSYSAKNVIITGGEPTIQPNLSLLLEQFKKEGYFLAIETNGL 106

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQ--VNVSPENYIGFDFERFSLQ 174
            E P  ID+I  SPK     K +        E+++V          +       E + L 
Sbjct: 107 KEVPAQIDYIATSPKRMYQEKYQRRCIEFANEVRIVVDGEVQGFCEQIESQIKAEHYYLS 166

Query: 175 PM--DGPFLEENTNLAISYCFQNPK---WRLSVQTHKFIGI 210
           P   +G      T   I    Q P    W+LS+QTHK +GI
Sbjct: 167 PCEVEGKMNLLETITQIGLLNQRPNKPKWQLSIQTHKIVGI 207


>gi|145627830|ref|ZP_01783631.1| predicted methyltransferase [Haemophilus influenzae 22.1-21]
 gi|144979605|gb|EDJ89264.1| predicted methyltransferase [Haemophilus influenzae 22.1-21]
          Length = 217

 Score =  154 bits (389), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 61/221 (27%), Positives = 97/221 (43%), Gaps = 37/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           ++I EIF +LQGEG + G  +VF RF  CNL            C +CDT +         
Sbjct: 19  FNIVEIFESLQGEGFNTGMPSVFVRFGKCNLD-----------CPWCDTPY-----NNFK 62

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
           R++V Q+ + +           +  ++TGGEP +   +   ++     G+ +A+ETNG  
Sbjct: 63  RWSVSQILEKV------RSFSSKNIIITGGEPTIVPKIEYLLEQFKSDGYFLAIETNGLK 116

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQ--VNVSPENYIGFDFERFSLQP 175
             P  ID+I  SPK+    K +        E+++V      +           + + L P
Sbjct: 117 AIPAQIDYIATSPKSLYAHKYEKRCIPFANEVRIVMDSNMPSFCELIEQKIKAKNYYLSP 176

Query: 176 MDGPFLEENTNLAISYC------FQNPKWRLSVQTHKFIGI 210
            +    + N    I+           PKW+LS+QTHK IGI
Sbjct: 177 CEI-DGKMNLLETITLLGQLNQRSNKPKWQLSLQTHKLIGI 216


>gi|209525918|ref|ZP_03274452.1| Radical SAM domain protein [Arthrospira maxima CS-328]
 gi|209493595|gb|EDZ93916.1| Radical SAM domain protein [Arthrospira maxima CS-328]
          Length = 204

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 58/223 (26%), Positives = 97/223 (43%), Gaps = 33/223 (14%)

Query: 1   MKLYSIKEIFL-TLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M    + E F  T+QGEG  AG    F R +GC +            C +CDT +    G
Sbjct: 1   MITIPVHETFQQTIQGEGYWAGTPVDFIRLAGCPV-----------GCPWCDTGYA--DG 47

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVET 118
            KG   N+    +L+ E            V++GGEP +   +P L++ L + G ++++ET
Sbjct: 48  GKGLPRNMRSFDELLAELV------SPRVVISGGEPFIYPQLPDLVRVLEETGRQVSIET 101

Query: 119 NG-TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFER------- 170
           +G   +    + WI +SPK     +     ++     ++ +  +     +F R       
Sbjct: 102 SGAFWQDVSDLCWITLSPKEHISPRYPVVSQMWRRASEIKLVIDVGDELEFYRSRLAENS 161

Query: 171 ---FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                LQP     ++    L ++   Q P +RLSVQ HK+IG+
Sbjct: 162 TIPVFLQPQ-WTDIDRTLPLVLAKLKQFPGYRLSVQLHKYIGV 203


>gi|301169927|emb|CBW29531.1| predicted organic radical activating enzyme [Haemophilus influenzae
           10810]
          Length = 209

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 61/221 (27%), Positives = 97/221 (43%), Gaps = 37/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           ++I EIF +LQGEG + G  +VF RF  CNL            C +CDT +         
Sbjct: 11  FNIVEIFESLQGEGFNTGMPSVFVRFGKCNLD-----------CPWCDTPY-----NNFK 54

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
           R++V Q+ + +           +  ++TGGEP +   +   ++     G+ +A+ETNG  
Sbjct: 55  RWSVSQILEKV------RSFSSKNIIITGGEPTIVPKIEYLLEQFKSDGYFLAIETNGLK 108

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQ--VNVSPENYIGFDFERFSLQP 175
             P  ID+I  SPK+    K +        E+++V      +           + + L P
Sbjct: 109 AIPAQIDYISTSPKSLYAHKYEKRCIPFANEVRIVMDSNMPSFCELIEQKIKAKNYYLSP 168

Query: 176 MDGPFLEENTNLAISYC------FQNPKWRLSVQTHKFIGI 210
            +    + N    I+           PKW+LS+QTHK IGI
Sbjct: 169 CEI-DGKMNLLETITLLGQLNQRSNKPKWQLSLQTHKLIGI 208


>gi|330431519|gb|AEC16578.1| molybdenum cofactor biosynthesis protein A [Gallibacterium anatis
           UMN179]
          Length = 203

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 63/228 (27%), Positives = 102/228 (44%), Gaps = 44/228 (19%)

Query: 1   MKL-YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+  Y+I EIF +LQGEG + G  AVF RF  CNL            C +CDTD+     
Sbjct: 1   MQTEYAIVEIFESLQGEGFNTGMPAVFIRFGKCNL-----------ACPWCDTDY----- 44

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVET 118
                +++  L  + ++         +  ++TGGEP +Q ++   +      G+ +++ET
Sbjct: 45  ---QTFSLMTLQQIADQ---VTAFSAKNIIITGGEPTIQPNLEKLLSYFKTLGYFLSIET 98

Query: 119 NGTIEPPQGIDWICVSPKAGCDLKIK-----GGQELKLVFPQVNVS---PENYIGFDFER 170
           NG    P  ID+I  SPK     K +        E+++V    N+     E     + + 
Sbjct: 99  NGLKPVPPQIDYIATSPKRLYRHKYQQRCITHADEVRIVNDDENILSFCREIAKKIEAKH 158

Query: 171 FSLQPMDGPFLEENTNLAISYCFQ--------NPKWRLSVQTHKFIGI 210
           + L P +    E N    +    +        + KW+LS+QTHK +GI
Sbjct: 159 YFLSPCEQQ-GEMNL---LDTIRKLGQLNENTDIKWQLSIQTHKLVGI 202


>gi|15602049|ref|NP_245121.1| hypothetical protein PM0184 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720404|gb|AAK02268.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 209

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 64/222 (28%), Positives = 99/222 (44%), Gaps = 37/222 (16%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            Y+I EIF +LQGEG + G  ++F RF  CNL            C +CDT +        
Sbjct: 10  KYAIVEIFESLQGEGFNTGMPSIFVRFGKCNL-----------ACPWCDTPY-------- 50

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLL-QVDVPLIQALNKRGFEIAVETNGT 121
            +Y    L+ ++++         +  ++TGGEP +      L+ AL   G+ +A+ETNG 
Sbjct: 51  NQYTTWTLSKIVQK---VRSFSAKNIIITGGEPTIVPKIGVLLDALKAEGYFLAIETNGL 107

Query: 122 IEPPQGIDWICVSPKAGCDLKI-----KGGQELKLVFPQVNVS--PENYIGFDFERFSLQ 174
              P  ID+I  SPK     K          E+++V  +  ++   +       + + L 
Sbjct: 108 KSIPNQIDYIATSPKRLYQHKYQQKCIPFAHEVRIVADENVIAFCEQIEQQIRADHYYLS 167

Query: 175 PMDGPFLEENTNLAISYC------FQNPKWRLSVQTHKFIGI 210
           P +    E N    I+           PKW+LS+QTHK IGI
Sbjct: 168 PCE-VNGEMNLLETITQIGRLNQRVNKPKWQLSIQTHKLIGI 208


>gi|145639292|ref|ZP_01794898.1| predicted methyltransferase [Haemophilus influenzae PittII]
 gi|145271595|gb|EDK11506.1| predicted methyltransferase [Haemophilus influenzae PittII]
 gi|309751168|gb|ADO81152.1| Probable 7-cyano-7-deazaguanine (preQ0) synthesis protein QueE
           [Haemophilus influenzae R2866]
          Length = 211

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 61/221 (27%), Positives = 97/221 (43%), Gaps = 37/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           ++I EIF +LQGEG + G  +VF RF  CNL            C +CDT +         
Sbjct: 13  FNIVEIFESLQGEGFNTGMPSVFVRFGKCNLD-----------CPWCDTPY-----NNFK 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
           R++V Q+ + +           +  ++TGGEP +   +   ++     G+ +A+ETNG  
Sbjct: 57  RWSVSQILEKV------RSFSSKNIIITGGEPTIVPKIEYLLEQFKSDGYFLAIETNGLK 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQ--VNVSPENYIGFDFERFSLQP 175
             P  ID+I  SPK+    K +        E+++V      +           + + L P
Sbjct: 111 AIPAQIDYIATSPKSLYAHKYEKRCIPFANEVRIVMDSNMPSFCELIEQKIKAKNYYLSP 170

Query: 176 MDGPFLEENTNLAISYC------FQNPKWRLSVQTHKFIGI 210
            +    + N    I+           PKW+LS+QTHK IGI
Sbjct: 171 CEI-DGKMNLLETITLLGQLNQRSNKPKWQLSLQTHKLIGI 210


>gi|319776568|ref|YP_004139056.1| methyltransferase [Haemophilus influenzae F3047]
 gi|317451159|emb|CBY87392.1| Predicted methyltransferase [Haemophilus influenzae F3047]
          Length = 209

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 61/221 (27%), Positives = 98/221 (44%), Gaps = 37/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           ++I EIF +LQGEG + G  +VF RF  CNL            C +CDT +         
Sbjct: 11  FNIVEIFESLQGEGFNTGMPSVFVRFGKCNLD-----------CPWCDTPY-----NNFK 54

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
           R++V Q+ + +           +  ++TGGEP +  ++   ++     G+ +A+ETNG  
Sbjct: 55  RWSVSQILEKV------RSFSSKNIIITGGEPTIVPEIEYLLEQFKSDGYFLAIETNGLK 108

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQ--VNVSPENYIGFDFERFSLQP 175
             P  ID+I  SPK+    K +        E+++V      +           + + L P
Sbjct: 109 AIPAQIDYIATSPKSLYAHKYEKRCIPFANEVRIVMDSNMPSFCELIEQKIKAKNYYLSP 168

Query: 176 MDGPFLEENTNLAISYC------FQNPKWRLSVQTHKFIGI 210
            +    + N    I+           PKW+LS+QTHK IGI
Sbjct: 169 CEI-DGKMNLLETITLLGQLNQRSNKPKWQLSLQTHKLIGI 208


>gi|72536298|gb|AAZ73210.1| hypothetical protein [Escherichia coli]
          Length = 202

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 56/219 (25%), Positives = 81/219 (36%), Gaps = 49/219 (22%)

Query: 23  VAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI-----------------QGTKGGRY 65
            A+F R  GC +            C +CDT                      +  K G  
Sbjct: 1   PAIFIRLQGCPV-----------GCDWCDTKHTWEKLEDREVSLFSILAKTKESDKWGAA 49

Query: 66  NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIE-P 124
           + + L  +I  Q        R+ V+TGGEP +   +PL   L K GF   +ET+GT E  
Sbjct: 50  SSEDLLAVIGRQG----YTARHVVITGGEPCIHDLLPLTDLLEKNGFSCQIETSGTHEVR 105

Query: 125 PQGIDWICVSPKAGC-------DLKIKGGQELKLV------FPQVNVSPENYIGFDFERF 171
                W+ VSPK             ++   E+K           ++              
Sbjct: 106 CTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVGRVRDIEALDELLATLTDDKPRVI 165

Query: 172 SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           +LQP+     E+ T L I  C     WRLS+QTHK++ I
Sbjct: 166 ALQPISQK--EDATRLCIDTCIAR-NWRLSMQTHKYLNI 201


>gi|145631238|ref|ZP_01787011.1| predicted organic radical activating enzyme [Haemophilus influenzae
           R3021]
 gi|144983165|gb|EDJ90660.1| predicted organic radical activating enzyme [Haemophilus influenzae
           R3021]
          Length = 211

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 61/221 (27%), Positives = 97/221 (43%), Gaps = 37/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           ++I EIF +LQGEG + G  +VF RF  CNL            C +CDT +         
Sbjct: 13  FNIVEIFESLQGEGFNTGMPSVFVRFGKCNLD-----------CPWCDTPY-----NNFK 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
           R++V Q+ + +           +  ++TGGEP +   +   ++     G+ +A+ETNG  
Sbjct: 57  RWSVSQILEKV------RSFSSKNIIITGGEPTIVPKIEYLLEQFKSDGYFLAIETNGLK 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQ--VNVSPENYIGFDFERFSLQP 175
             P  ID+I  SPK+    K +        E+++V      +           + + L P
Sbjct: 111 AIPAQIDYIATSPKSLYAHKYEKRCIPFANEVRIVMDSNMPSFCELIEQKIKAKNYYLSP 170

Query: 176 MDGPFLEENTNLAISYC------FQNPKWRLSVQTHKFIGI 210
            +    + N    I+           PKW+LS+QTHK IGI
Sbjct: 171 CEI-DGKMNLLETITLLGQLNQRSNKPKWQLSLQTHKLIGI 210


>gi|145633081|ref|ZP_01788813.1| predicted methyltransferase [Haemophilus influenzae 3655]
 gi|145637058|ref|ZP_01792721.1| predicted methyltransferase [Haemophilus influenzae PittHH]
 gi|319897344|ref|YP_004135540.1| methyltransferase [Haemophilus influenzae F3031]
 gi|144986307|gb|EDJ92886.1| predicted methyltransferase [Haemophilus influenzae 3655]
 gi|145269712|gb|EDK09652.1| predicted methyltransferase [Haemophilus influenzae PittHH]
 gi|317432849|emb|CBY81214.1| Predicted methyltransferase [Haemophilus influenzae F3031]
          Length = 209

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 61/221 (27%), Positives = 97/221 (43%), Gaps = 37/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           ++I EIF +LQGEG + G  +VF RF  CNL            C +CDT +         
Sbjct: 11  FNIVEIFESLQGEGFNTGMPSVFVRFGKCNLD-----------CPWCDTPY-----NNFK 54

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
           R++V Q+ + +           +  ++TGGEP +   +   ++     G+ +A+ETNG  
Sbjct: 55  RWSVSQILEKV------RSFSSKNIIITGGEPTIVPKIEYLLEQFKSDGYFLAIETNGLK 108

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQ--VNVSPENYIGFDFERFSLQP 175
             P  ID+I  SPK+    K +        E+++V      +           + + L P
Sbjct: 109 AIPAQIDYIATSPKSLYAHKYEKRCIPFANEVRIVMDSNMPSFCELIEQKIKAKNYYLSP 168

Query: 176 MDGPFLEENTNLAISYC------FQNPKWRLSVQTHKFIGI 210
            +    + N    I+           PKW+LS+QTHK IGI
Sbjct: 169 CEI-DGKMNLLETITLLGQLNQRSNKPKWQLSLQTHKLIGI 208


>gi|16273111|ref|NP_439345.1| hypothetical protein HI1189 [Haemophilus influenzae Rd KW20]
 gi|68249735|ref|YP_248847.1| organic radical activating protein [Haemophilus influenzae
           86-028NP]
 gi|148826202|ref|YP_001290955.1| organic radical activating protein [Haemophilus influenzae PittEE]
 gi|229844856|ref|ZP_04464994.1| predicted organic radical activating enzyme [Haemophilus influenzae
           6P18H1]
 gi|229846220|ref|ZP_04466332.1| predicted organic radical activating enzyme [Haemophilus influenzae
           7P49H1]
 gi|260581110|ref|ZP_05848931.1| organic radical activating protein [Haemophilus influenzae RdAW]
 gi|260582119|ref|ZP_05849913.1| organic radical activating protein [Haemophilus influenzae NT127]
 gi|329124080|ref|ZP_08252627.1| anaerobic ribonucleoside-triphosphate reductase activating protein
           [Haemophilus aegyptius ATCC 11116]
 gi|1723816|sp|P45097|Y1189_HAEIN RecName: Full=7-carboxy-7-deazaguanine synthase homolog
 gi|1574116|gb|AAC22842.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|68057934|gb|AAX88187.1| predicted organic radical activating enzyme [Haemophilus influenzae
           86-028NP]
 gi|148716362|gb|ABQ98572.1| predicted organic radical activating enzyme [Haemophilus influenzae
           PittEE]
 gi|229811224|gb|EEP46941.1| predicted organic radical activating enzyme [Haemophilus influenzae
           7P49H1]
 gi|229812237|gb|EEP47928.1| predicted organic radical activating enzyme [Haemophilus influenzae
           6P18H1]
 gi|260092239|gb|EEW76181.1| organic radical activating protein [Haemophilus influenzae RdAW]
 gi|260094751|gb|EEW78645.1| organic radical activating protein [Haemophilus influenzae NT127]
 gi|309973347|gb|ADO96548.1| Probable 7-cyano-7-deazaguanine (preQ0) synthesis protein QueE
           [Haemophilus influenzae R2846]
 gi|327467505|gb|EGF13003.1| anaerobic ribonucleoside-triphosphate reductase activating protein
           [Haemophilus aegyptius ATCC 11116]
          Length = 211

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 61/221 (27%), Positives = 97/221 (43%), Gaps = 37/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           ++I EIF +LQGEG + G  +VF RF  CNL            C +CDT +         
Sbjct: 13  FNIVEIFESLQGEGFNTGMPSVFVRFGKCNLD-----------CPWCDTPY-----NNFK 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
           R++V Q+ + +           +  ++TGGEP +   +   ++     G+ +A+ETNG  
Sbjct: 57  RWSVSQILEKV------RSFSSKNIIITGGEPTIVPKIEYLLEQFKSDGYFLAIETNGLK 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQ--VNVSPENYIGFDFERFSLQP 175
             P  ID+I  SPK+    K +        E+++V      +           + + L P
Sbjct: 111 AIPAQIDYIATSPKSLYAHKYEKRCIPFANEVRIVMDSNMPSFCELIEQKIKAKNYYLSP 170

Query: 176 MDGPFLEENTNLAISYC------FQNPKWRLSVQTHKFIGI 210
            +    + N    I+           PKW+LS+QTHK IGI
Sbjct: 171 CEI-DGKMNLLETITLLGQLNQRSNKPKWQLSLQTHKLIGI 210


>gi|261380779|ref|ZP_05985352.1| radical SAM domain protein [Neisseria subflava NJ9703]
 gi|284796241|gb|EFC51588.1| radical SAM domain protein [Neisseria subflava NJ9703]
          Length = 211

 Score =  151 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 99/221 (44%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL            C +CDTD++        
Sbjct: 12  YRIVEIFESLQGEGWNTGMPAVFIRLGKCNL-----------ACSWCDTDYL-------- 52

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
           ++ +  L+D++           R  ++TGGEP +Q  +   + AL   G+ + +ETNG  
Sbjct: 53  KFGMMSLSDILGRLKT---YTARNIIITGGEPTIQPHLDTLLNALKAEGYFLCIETNGLN 109

Query: 123 EPPQGIDWICVSPKAGCDLKI-----KGGQELKLVFPQVNVS--PENYIGFDFERFSLQP 175
             P  ID++  SPKA    K      +   E+++V     ++   E       + + L P
Sbjct: 110 PAPPQIDYVATSPKACYAAKYESGCIEKADEVRIVADGDVIAFCQEMERKIRAQHYYLSP 169

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 170 CEQDGVMNIYDTIRQIGVLNSRPDAPVHWQLSVQTHKWAGI 210


>gi|241759459|ref|ZP_04757563.1| NrdG protein [Neisseria flavescens SK114]
 gi|241320241|gb|EER56574.1| NrdG protein [Neisseria flavescens SK114]
          Length = 211

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 69/221 (31%), Positives = 99/221 (44%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++        
Sbjct: 12  YRIVEIFESLQGEGWNTGMPAVFVRLGKCNLACG-----------WCDTDYL-------- 52

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNGTI 122
           ++ +  L+D++           R  ++TGGEP +Q     L+ AL   G+ + +ETNG  
Sbjct: 53  KFGMMSLSDILGRLKT---YTARNVIITGGEPTIQPHLNTLLDALKAEGYFLCIETNGLN 109

Query: 123 EPPQGIDWICVSPKAGCDLKI-----KGGQELKLVFPQVNVS--PENYIGFDFERFSLQP 175
             P  ID++  SPKA    K      +   E+++V     V+   E       + + L P
Sbjct: 110 PAPPQIDYVATSPKACYAAKYESSCIEKADEVRIVADGDVVAFCQEMERKIRAQHYYLSP 169

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 170 CEQDGVMNIYDTIRQIGVLNSRPDAPVHWQLSVQTHKWAGI 210


>gi|85860085|ref|YP_462287.1| queuosine biosynthesis protein [Syntrophus aciditrophicus SB]
 gi|85723176|gb|ABC78119.1| queuosine biosynthesis protein [Syntrophus aciditrophicus SB]
          Length = 215

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 53/227 (23%), Positives = 84/227 (37%), Gaps = 44/227 (19%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + EIF ++QGE    G   VF R +GCNL           +C +CDT +   +GT   
Sbjct: 3   LKVNEIFYSIQGESSFIGIPCVFVRLTGCNL-----------RCSYCDTRYAYEEGT--- 48

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVETNGTI 122
            +++  + D I               +TGGEPL+Q + P LI+ L  RG  + +ETNG+ 
Sbjct: 49  LWDIPDILDRI------SSYHCPLVEITGGEPLIQKETPLLIRDLLDRGCHVLLETNGSR 102

Query: 123 E-------PPQGIDWICVSPKAGCDLKIKG------GQELKLVFPQVN---VSPENYIGF 166
                     + +D  C S         +         E+K V  +      + E  I  
Sbjct: 103 PIRTIDERCVRIVDIKCPSSGESRSNDYRNLDDLTGQDEIKFVLGERKDYEFAKEILISR 162

Query: 167 DFERF-----SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +            P+      +   L       +   R  +Q HK +
Sbjct: 163 NLANRISHPPIFSPVTNSLDPK--KLVRWILEDHLPVRFQLQLHKIL 207


>gi|296315126|ref|ZP_06865067.1| radical SAM domain protein [Neisseria polysaccharea ATCC 43768]
 gi|296838043|gb|EFH21981.1| radical SAM domain protein [Neisseria polysaccharea ATCC 43768]
          Length = 212

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 94/221 (42%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++        
Sbjct: 13  YRIVEIFESLQGEGWNTGMPAVFVRLGKCNLACG-----------WCDTDYL-------- 53

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNGTI 122
            +++  L+D+            R  ++TGGEP +Q     L+  L   G+ + +ETNG  
Sbjct: 54  TFSMMSLSDI---LGRLKAYAARNIIITGGEPTIQPHLDALLDTLKAEGYFLCLETNGLN 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQ--VNVSPENYIGFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     V              + L P
Sbjct: 111 PAPPQIDYVATSPKAYYAAKYEKSCIETADEVRIVADGDVVGFCENMERKIRARHYYLSP 170

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQDGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 211


>gi|116749416|ref|YP_846103.1| radical SAM domain-containing protein [Syntrophobacter fumaroxidans
           MPOB]
 gi|116698480|gb|ABK17668.1| Radical SAM domain protein [Syntrophobacter fumaroxidans MPOB]
          Length = 215

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 57/229 (24%), Positives = 87/229 (37%), Gaps = 44/229 (19%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               + EIF ++QGE G+AG   VF R +GCNL           +C +CDT +   +G  
Sbjct: 1   MALRVNEIFHSIQGESGYAGWPCVFVRLTGCNL-----------RCSYCDTRYAYDEG-- 47

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVETNG 120
               +   L ++I         +     +TGGEPLLQ + P L+  L   G  + VETNG
Sbjct: 48  ----DFVTLREII---GRVRRFDCPLVEITGGEPLLQPETPELVAELLDLGHTVLVETNG 100

Query: 121 TIE-------PPQGIDWICVSPKAGCDLKIKG------GQELKLVF---PQVNVSPENYI 164
           +++         + +D+ C S        ++         E+K V         + E   
Sbjct: 101 SMDISVVDRRCVKIVDFKCPSSGESDANDMENLERLGSRDEIKCVIGTREDYEFAREIER 160

Query: 165 GFDF-----ERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                          P+ G        LA        + RL +Q HK I
Sbjct: 161 LAAERAGTGSTVCFSPVFGKLEPR--ELAEWILADRLRVRLGLQLHKII 207


>gi|255066205|ref|ZP_05318060.1| radical SAM domain protein [Neisseria sicca ATCC 29256]
 gi|255049415|gb|EET44879.1| radical SAM domain protein [Neisseria sicca ATCC 29256]
          Length = 212

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 66/221 (29%), Positives = 99/221 (44%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++        
Sbjct: 13  YRIVEIFESLQGEGWNTGMPAVFVRLGKCNLACG-----------WCDTDYL-------- 53

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
           ++++  L+D++           R  ++TGGEP +Q  +   + AL   G+ + +ETNG  
Sbjct: 54  KFSMMSLSDILGRLKT---YTVRNIIITGGEPTIQPHLDTLLDALKAEGYFLCIETNGLK 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     V+    +        + L P
Sbjct: 111 PVPPQIDYVATSPKACYAAKYEKSCIETADEVRIVADGDVVAFCENMERKIRARHYYLSP 170

Query: 176 MD--GPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
            +  G     +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQNGVMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 211


>gi|320335721|ref|YP_004172432.1| Radical SAM domain-containing protein [Deinococcus maricopensis DSM
           21211]
 gi|319757010|gb|ADV68767.1| Radical SAM domain protein [Deinococcus maricopensis DSM 21211]
          Length = 230

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 52/217 (23%), Positives = 80/217 (36%), Gaps = 23/217 (10%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y + E F T QGEG H GR A F R  GC              C +CD+     +  +
Sbjct: 1   MKYPVYERFYTWQGEGVHLGRAAYFVRLYGCP-----------QACPWCDSAGTWHRDYR 49

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
                +    + I +       +G   V+TGGEP+L     L+ AL+  G  + +ET+G 
Sbjct: 50  PDGVTLMTAHE-IAQAVAAESPDGAVVVITGGEPILFDLTALVDALHALGRRVHLETSGI 108

Query: 122 IEPPQGIDWICVSPK----AGCDLKIKGGQELKLVFPQVNVSPENYIGF----DFERFSL 173
                 +DW+ +SPK          ++   E+K++    +             D     L
Sbjct: 109 APLRGHLDWVTLSPKPFGTPPLPEVVQRAHEVKIIVHDPSDIDAGLATLDGLPDDAVIWL 168

Query: 174 QPMDGPFLEEN---TNLAISYCFQNPKWRLSVQTHKF 207
            P      E +    N        +P+ R   Q HK 
Sbjct: 169 HPEWSRARERDPAVLNAITETVKASPRLRAGYQMHKL 205


>gi|226354845|ref|YP_002784585.1| organic radical activating enzyme [Deinococcus deserti VCD115]
 gi|226316835|gb|ACO44831.1| putative Organic radical activating enzyme [Deinococcus deserti
           VCD115]
          Length = 230

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 55/220 (25%), Positives = 85/220 (38%), Gaps = 29/220 (13%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y + E F T QGEG H GR A F R  GC             +C +CD+     +  +
Sbjct: 1   MKYPVFERFYTWQGEGVHLGRAAYFVRLYGCP-----------QECPWCDSAGTWHKDYR 49

Query: 62  GG---RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVET 118
                    + +A  + ++   G       V+TGGEP+L    PL++AL+  G  + +ET
Sbjct: 50  PAGVQLMTPEAIAACVAQESPEGAV----VVITGGEPILFDLTPLVEALHGLGRRVHLET 105

Query: 119 NGTIEPPQGIDWICVSPKA----GCDLKIKGGQELKLVFPQVNVSPENYIGF----DFER 170
           +G       IDW+ +SPK          ++   E+K++    +   +         D   
Sbjct: 106 SGIAPLRGAIDWVTLSPKPFGTLPLPSVVQQAHEVKIIVHDTSDIRDGLATLDGLKDDAV 165

Query: 171 FSLQPMDGPFLEEN---TNLAISYCFQNPKWRLSVQTHKF 207
             L P      E +    N        NP+ R   Q HK 
Sbjct: 166 IWLHPEWSKARERDAAVLNAITEAVKANPRLRAGYQMHKL 205


>gi|298370138|ref|ZP_06981454.1| radical SAM domain protein [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298281598|gb|EFI23087.1| radical SAM domain protein [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 241

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 65/221 (29%), Positives = 98/221 (44%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++        
Sbjct: 42  YRIVEIFESLQGEGWNTGMPAVFVRLGKCNLACG-----------WCDTDYL-------- 82

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
           ++ +  L+D++           R  ++TGGEP +Q  +   + AL   G+ + +ETNG  
Sbjct: 83  KFGMMSLSDILGRLKT---YAARNIIITGGEPTIQPHLDTLLDALKAEGYFLCIETNGLK 139

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     V+    +        + L P
Sbjct: 140 PAPPQIDYVATSPKACYAAKYETNCIAEADEVRIVADGDVVAFCENMERKIRARHYYLSP 199

Query: 176 MDGPFLEE--NTNLAISYCFQNP----KWRLSVQTHKFIGI 210
            +   +    +T   I      P     W+LSVQTHK+ GI
Sbjct: 200 CEQNSVMNIYDTIRQIGLLNSRPDASVHWQLSVQTHKWAGI 240


>gi|300112861|ref|YP_003759436.1| radical SAM domain-containing protein [Nitrosococcus watsonii
           C-113]
 gi|299538798|gb|ADJ27115.1| Radical SAM domain protein [Nitrosococcus watsonii C-113]
          Length = 213

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 53/228 (23%), Positives = 83/228 (36%), Gaps = 42/228 (18%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           MK   I EIF +LQGE    G    F R +GC L           +C +CDT++      
Sbjct: 1   MKRLRITEIFYSLQGEARSVGWPTAFVRLTGCPL-----------RCHYCDTEYAF---Q 46

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPL-LQVDVPLIQALNKRGFEIAVETN 119
            G    +D++ D++ E         R+  +TGGEPL     + L+  L   G+E+++ET+
Sbjct: 47  GGNWMALDRILDVVAE------FGVRHVTVTGGEPLVQSACLELLTRLCDAGYEVSLETS 100

Query: 120 G-------TIEPPQGIDWICVSPKAGCDLKIKG------GQELKLVFPQVNVSPENYIGF 166
           G            + +DW                       ++KLV    +         
Sbjct: 101 GALDISAIDCRVVKVMDWKTPGSGEEARNLYTNLAHLSSQDQVKLVLCNRHDYDWAKAVL 160

Query: 167 DFERF------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           D  R          P         T+LA          R+ +Q HK++
Sbjct: 161 DRHRLTEYCDVLFSPSHEQLSP--TDLADWILADRLPVRMQIQLHKYL 206


>gi|261401297|ref|ZP_05987422.1| radical SAM domain protein [Neisseria lactamica ATCC 23970]
 gi|269208675|gb|EEZ75130.1| radical SAM domain protein [Neisseria lactamica ATCC 23970]
          Length = 212

 Score =  151 bits (381), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 63/221 (28%), Positives = 95/221 (42%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++       G
Sbjct: 13  YRIVEIFESLQGEGRNTGMPAVFVRLGKCNLACG-----------WCDTDYLTF-----G 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
             ++  +   ++          R  ++TGGEP +Q  +   + AL   G+ + +ETNG  
Sbjct: 57  MMSLSDILGRLKA------YAARNIIITGGEPTIQPHLDTLLDALKAEGYFLCLETNGLN 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     ++    +        + L P
Sbjct: 111 PAPPQIDYVATSPKACYAAKYETNCIAEADEVRIVADGDVLAFCENMERKIRARHYYLSP 170

Query: 176 MDGPFLEE--NTNLAISYCFQNP----KWRLSVQTHKFIGI 210
            +        +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQNGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 211


>gi|77163686|ref|YP_342211.1| radical SAM domain-containing protein [Nitrosococcus oceani ATCC
           19707]
 gi|254436167|ref|ZP_05049674.1| radical SAM domain protein, putative [Nitrosococcus oceani AFC27]
 gi|76882000|gb|ABA56681.1| Radical SAM domain protein [Nitrosococcus oceani ATCC 19707]
 gi|207089278|gb|EDZ66550.1| radical SAM domain protein, putative [Nitrosococcus oceani AFC27]
          Length = 213

 Score =  151 bits (381), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 52/228 (22%), Positives = 85/228 (37%), Gaps = 42/228 (18%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           MK   I EIF +LQGE    G    F R +GC L           +C +CDT++      
Sbjct: 1   MKRLRITEIFYSLQGEARSVGWPTAFVRLTGCPL-----------RCHYCDTEYAF---Q 46

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPL-LQVDVPLIQALNKRGFEIAVETN 119
            G    +D + D + E         R+  +TGGEPL     + L+  L   G+E+++ET+
Sbjct: 47  GGRWMALDGILDAVAE------FGVRHVTVTGGEPLAQSACLGLLTRLCDAGYEVSLETS 100

Query: 120 G-------TIEPPQGIDWICVSPKAGCD------LKIKGGQELKLVFPQVNVSP------ 160
           G            + +DW                  +    ++KLV    +         
Sbjct: 101 GALDISAVDRRVIKVMDWKTPGSGEEARNLSTNLEHLSSQDQVKLVLCNRHDYDWAKGVL 160

Query: 161 ENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           E +   ++      P         T+LA      +   R+ +Q HK++
Sbjct: 161 ERHRLTEYCEVLFSPSYEQLSP--TDLADWILADHLPVRMQIQLHKYL 206


>gi|294787822|ref|ZP_06753066.1| radical SAM domain protein [Simonsiella muelleri ATCC 29453]
 gi|294484115|gb|EFG31798.1| radical SAM domain protein [Simonsiella muelleri ATCC 29453]
          Length = 205

 Score =  150 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 63/223 (28%), Positives = 102/223 (45%), Gaps = 38/223 (17%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           ++ I EIF TLQGEG + G  +VF RF  CNL            C +CDT++        
Sbjct: 5   IFRIVEIFETLQGEGYNTGMPSVFIRFGKCNL-----------ACHWCDTNY-------- 45

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGT 121
            ++ +  L  ++++     +   +  ++TGGEP +Q  + + +  L   G+ IA+ETNG 
Sbjct: 46  QQFEMMTLTQIMDQ---VYDYSAKNIIITGGEPTIQPQLEILLNRLKSEGYFIAIETNGL 102

Query: 122 IEPPQGIDWICVSPK-----AGCDLKIKGGQELKLVFPQVNV---SPENYIGFDFERFSL 173
              P+ ID+I  SPK     A     +    E+++V    ++             +R+ L
Sbjct: 103 RAVPEQIDYIATSPKRLYANAYDKTCLSAADEVRIVVDSDDIFSFCEIIEQKIRAKRYYL 162

Query: 174 QPMDGPFLEENTNLAISYCFQ------NPKWRLSVQTHKFIGI 210
            P +    E N    I+   +       P W+LS+QTHK  GI
Sbjct: 163 SPCEQ-NGEMNILATITLLGKLNARPNQPHWQLSIQTHKLCGI 204


>gi|33151750|ref|NP_873103.1| hypothetical protein HD0556 [Haemophilus ducreyi 35000HP]
 gi|33147971|gb|AAP95492.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP]
          Length = 209

 Score =  150 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 60/217 (27%), Positives = 93/217 (42%), Gaps = 35/217 (16%)

Query: 7   KEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRYN 66
            EIF +LQGEG + G   +F R   CNL            C +CDT++      +  ++ 
Sbjct: 14  VEIFESLQGEGFNTGLPCIFIRLGKCNL-----------ACPWCDTNY-----NEYQKWT 57

Query: 67  VDQLADLIEEQWITGEKEGRYCVLTGGEPLLQ-VDVPLIQALNKRGFEIAVETNGTIEPP 125
           ++ +   ++          +  ++TGGEP L      L++ L   G+ +A+ETNG    P
Sbjct: 58  LEMILAKVK------SYTAKNIIITGGEPTLYANLTILLEQLKNAGYWLAIETNGLKAVP 111

Query: 126 QGIDWICVSPKAGCDLKIKGG-----QELKLVFPQV--NVSPENYIGFDFERFSLQPMDG 178
             ID+I  SPK     K +        E+++V                    + L P + 
Sbjct: 112 SQIDYIATSPKKMYQEKYQREYLTQADEVRIVVDDDVTEFCALIEQKIQAHHYYLSPCEI 171

Query: 179 P----FLEENTNL-AISYCFQNPKWRLSVQTHKFIGI 210
                 LE  T L  ++     PKW+LS+QTHK IGI
Sbjct: 172 EGKMNLLETITQLGQLNQRVNKPKWQLSIQTHKIIGI 208


>gi|309379630|emb|CBX21801.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 212

 Score =  150 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 64/221 (28%), Positives = 96/221 (43%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++        
Sbjct: 13  YRIVEIFESLQGEGRNTGMPAVFVRLGKCNLACG-----------WCDTDYL-------- 53

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
            + +  L+D++           R  ++TGGEP +Q  +   + AL   G+ + +ETNG  
Sbjct: 54  TFGMMSLSDILGRLKT---YTVRNIIITGGEPTIQPHLDTLLDALKAEGYFLCLETNGLK 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     ++    +        + L P
Sbjct: 111 PAPPQIDYVATSPKAYYAAKYETNCIAEADEVRIVADGDVLAFCENMERKIRARHYYLSP 170

Query: 176 MDGPFLEE--NTNLAISYCFQNP----KWRLSVQTHKFIGI 210
            +        +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQNGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 211


>gi|260914430|ref|ZP_05920899.1| radical SAM domain protein [Pasteurella dagmatis ATCC 43325]
 gi|260631531|gb|EEX49713.1| radical SAM domain protein [Pasteurella dagmatis ATCC 43325]
          Length = 209

 Score =  150 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 64/221 (28%), Positives = 99/221 (44%), Gaps = 37/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y+I EIF +LQGEG + G  ++F RF  CNL            C +CDT++         
Sbjct: 11  YNIVEIFESLQGEGFNTGMPSIFVRFGKCNL-----------ACPWCDTNY--------N 51

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
           +Y    L+ ++++         +  ++TGGEP +   +   +  L   G+ +A+ETNG  
Sbjct: 52  QYTTWSLSQILQK---VRSFSAKNIIITGGEPTIVPKIEYLLDTLKAEGYFLAIETNGLK 108

Query: 123 EPPQGIDWICVSPKAGCDLKI-----KGGQELKLVFPQVNVS--PENYIGFDFERFSLQP 175
             P  ID+I  SPK     K          E+++V  +   S   +       +R+ L P
Sbjct: 109 TIPSQIDYIATSPKRLYQHKYQQKCIPFANEVRIVADEDVFSFCEQIEQQIHADRYYLSP 168

Query: 176 MDGPFLEENTNLAISYC------FQNPKWRLSVQTHKFIGI 210
            +    E N    I+           PKW+LS+QTHK IGI
Sbjct: 169 CEI-DGEMNLLETITQIGLLNQRVNKPKWQLSIQTHKLIGI 208


>gi|225077247|ref|ZP_03720446.1| hypothetical protein NEIFLAOT_02302 [Neisseria flavescens
           NRL30031/H210]
 gi|224951391|gb|EEG32600.1| hypothetical protein NEIFLAOT_02302 [Neisseria flavescens
           NRL30031/H210]
          Length = 211

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 99/221 (44%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL            C +CDTD++        
Sbjct: 12  YRIVEIFESLQGEGWNTGMPAVFIRLGKCNL-----------ACSWCDTDYL-------- 52

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
           ++ +  L+D++           R  ++TGGEP +Q  +   + AL   G+ + +ETNG  
Sbjct: 53  KFGMMSLSDILGRLKT---YTARNIIITGGEPTIQPHLDTLLNALKTEGYFLCIETNGLN 109

Query: 123 EPPQGIDWICVSPKAGCDLKI-----KGGQELKLVFPQVNVS--PENYIGFDFERFSLQP 175
             P  ID++  SPKA    K      +   E+++V     ++   E       + + L P
Sbjct: 110 PAPPQIDYVATSPKACYVAKYEFSCIEKADEVRIVADGDVIAFCQEMERKIRAQHYYLSP 169

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 170 CEQDGVMNIYDTIRQIGVLNSRPDAPVHWQLSVQTHKWAGI 210


>gi|59800591|ref|YP_207303.1| hypothetical protein NGO0132 [Neisseria gonorrhoeae FA 1090]
 gi|59717486|gb|AAW88891.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
          Length = 335

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 95/221 (42%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++        
Sbjct: 136 YRIVEIFESLQGEGWNTGMPAVFVRLGKCNLACG-----------WCDTDYL-------- 176

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
            + +  L+D++           R  ++TGGEP +Q  +   + AL   G+ + +ETNG  
Sbjct: 177 TFGMMSLSDILGRLKT---YAARNIIITGGEPTIQPHLDTLLDALKAEGYFLCLETNGLK 233

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVF--PQVNVSPENYIGFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     V              + L P
Sbjct: 234 PAPPQIDYVATSPKACYAAKYEKSCIETADEVRIVADGDAVGFCENMERKIRAHHYYLSP 293

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 294 CEQDGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 334


>gi|91205678|ref|YP_538033.1| organic radical activating protein [Rickettsia bellii RML369-C]
 gi|157826864|ref|YP_001495928.1| organic radical activating protein [Rickettsia bellii OSU 85-389]
 gi|91069222|gb|ABE04944.1| Organic radical activating enzymes [Rickettsia bellii RML369-C]
 gi|157802168|gb|ABV78891.1| Organic radical activating enzymes [Rickettsia bellii OSU 85-389]
          Length = 225

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 70/219 (31%), Positives = 96/219 (43%), Gaps = 34/219 (15%)

Query: 9   IFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRYNVD 68
           IF T+QGEG   G  A+F R  GCNL            C FCDT+F            +D
Sbjct: 23  IFKTIQGEGIFVGVPAIFIRLGGCNL-----------ACDFCDTEF-----ENFETIKID 66

Query: 69  QLADLIE--EQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT-IEPP 125
            +   +         E+  +  V+TGGEP+ Q    L Q L ++ F++ +ETNGT     
Sbjct: 67  DILSKVNLLALNSKNEQSVKLVVITGGEPMRQPIELLCQKLLEQDFKVQIETNGTLYRSL 126

Query: 126 QGIDWICVSPKAGCDLKIKGGQEL-------KLVFP----QVNVSPENYIGFDFERFSLQ 174
                I  SPKAG     K  ++L       K +      + ++ PE           +Q
Sbjct: 127 PDEVSIICSPKAGKKGYSKIREDLLPKISAVKFIIAKNILEYSLIPEIGQTAYNIPVFVQ 186

Query: 175 PM---DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
           PM   D    +EN  LA+    ++   RLSVQTHKFIGI
Sbjct: 187 PMDQNDQKLNKENNELAVKLALES-GARLSVQTHKFIGI 224


>gi|291612993|ref|YP_003523150.1| radical SAM domain protein [Sideroxydans lithotrophicus ES-1]
 gi|291583105|gb|ADE10763.1| Radical SAM domain protein [Sideroxydans lithotrophicus ES-1]
          Length = 218

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 54/225 (24%), Positives = 80/225 (35%), Gaps = 42/225 (18%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             I EIF +LQGE    G   VF R +GC L           +C +CDT +    G    
Sbjct: 9   LRISEIFYSLQGETSRVGLPTVFVRLTGCPL-----------RCSYCDTAYAFTGGQ--- 54

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
                QL+ +++E         RY  +TGGEPL Q +    ++AL   G+E+++ET G +
Sbjct: 55  ---SMQLSAIMDE---VASYAPRYVTVTGGEPLAQKNCLFLLRALCDAGYEVSLETGGAL 108

Query: 123 EPPQGIDWICVSPK-------------AGCDLKIKGGQELKLV------FPQVNVSPENY 163
           +       +                   G    +    E+K V      +       + +
Sbjct: 109 DVSGVDARVMKVLDIKTPGSGEVQKNLWGNLQHLGRHDEIKFVLCGEADYQWAKQVMQEH 168

Query: 164 IGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                      P  G      T LA          RL VQ HK +
Sbjct: 169 ALAQRCAVLFSPAQGQLAP--TELAEWILRDRLPVRLQVQLHKLL 211


>gi|291044537|ref|ZP_06570246.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|291011431|gb|EFE03427.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
          Length = 267

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 96/221 (43%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++        
Sbjct: 68  YRIVEIFESLQGEGRNTGMPAVFVRLGKCNLACG-----------WCDTDYL-------- 108

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
            + +  L+D++    I      R  ++TGGEP +Q  + + +  L   G+ + +ETNG  
Sbjct: 109 TFGMMSLSDILGRLKI---YAARNIIITGGEPTIQPHLDMLLDTLKAEGYFLCIETNGLN 165

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQ--VNVSPENYIGFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     V              + L P
Sbjct: 166 PVPPQIDYVATSPKACYAAKYEKSCIETADEVRIVADGDVVGFCENMERKIRAHHYYLSP 225

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 226 CEQDGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 266


>gi|319779040|ref|YP_004129953.1| Queuosine Biosynthesis QueE Radical SAM [Taylorella equigenitalis
           MCE9]
 gi|317109064|gb|ADU91810.1| Queuosine Biosynthesis QueE Radical SAM [Taylorella equigenitalis
           MCE9]
          Length = 222

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 64/227 (28%), Positives = 106/227 (46%), Gaps = 43/227 (18%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           + I EIF +LQGEG + G  A F R   CNL  G           +CDT++        G
Sbjct: 18  FRIVEIFKSLQGEGFNTGMPATFVRLGRCNLACG-----------WCDTNYNSF-----G 61

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVETNGTI 122
             ++ ++  ++E+   +        +LTGGEP +  +V  LI+A   RG+ + +ETNG  
Sbjct: 62  LKSLSEILQIVEDLGQSN------IILTGGEPSVHPNVELLIEAFKSRGYYLCIETNGIS 115

Query: 123 EPPQGIDWICVSPKAGCDLKI-----KGGQELKLVFPQVNVSPENYI--------GFDFE 169
           + P+GID+I +SPK     +      +   E+++V      + E+++         F+ +
Sbjct: 116 DVPEGIDYIAISPKYCYKERYEKVGLRYADEIRIVVDFNETNREDFLNWLQDINEKFNSK 175

Query: 170 RFSLQPMDGPFLEENTNLAISYC------FQNPKWRLSVQTHKFIGI 210
           ++ L P++      N    I            P+W LS+QTHK  GI
Sbjct: 176 KYYLSPLE-HDGSMNIQQTIKIIGELNGLKIGPRWELSLQTHKLAGI 221


>gi|67458743|ref|YP_246367.1| organic radical activating protein [Rickettsia felis URRWXCal2]
 gi|67004276|gb|AAY61202.1| Organic radical activating enzymes [Rickettsia felis URRWXCal2]
          Length = 225

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 69/226 (30%), Positives = 96/226 (42%), Gaps = 34/226 (15%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               ++ IF T+QGEG   G  A+F R  GCNL            C FCDT+F       
Sbjct: 16  TKLEVQSIFKTIQGEGIFVGCPAIFIRLGGCNL-----------ACNFCDTEF-----ED 59

Query: 62  GGRYNVDQLADLIEEQWIT--GEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
               ++ ++ + +E   +    EK     V+TGGEP+ Q    L Q L  + F+I +ETN
Sbjct: 60  FKLVDIAEILNKVESLALNSKNEKSINLVVITGGEPMRQPIELLCQKLLDQDFKIQIETN 119

Query: 120 GT-IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGF-----------D 167
           GT          I  SPKAG +   K  ++L      V       I              
Sbjct: 120 GTLYRSLPNEVSIICSPKAGKNGYSKIREDLLPKISAVKFIIAKNILEYSLIPEVGQTSY 179

Query: 168 FERFSLQPM---DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                +QPM   D    +EN  LA+    ++   RLS+QTHKF+GI
Sbjct: 180 NIPVFVQPMDQNDQSLNDENNELAVKLALES-GARLSLQTHKFLGI 224


>gi|167856373|ref|ZP_02479100.1| hypothetical protein HPS_10855 [Haemophilus parasuis 29755]
 gi|167852511|gb|EDS23798.1| hypothetical protein HPS_10855 [Haemophilus parasuis 29755]
          Length = 204

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 66/220 (30%), Positives = 96/220 (43%), Gaps = 35/220 (15%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF TLQGEG + G  ++F RF  CNL            C +CDT++         
Sbjct: 6   YRIVEIFETLQGEGFNTGMPSIFIRFGKCNL-----------ACPWCDTNY--------N 46

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQ-VDVPLIQALNKRGFEIAVETNGTI 122
           +Y    LAD+++   +      +  ++TGGEP +Q     L+  L   G+ IA+ETNG  
Sbjct: 47  QYETKTLADIMQ---VVKGFSAKNIIITGGEPTIQLDLTYLLDTLKAEGYFIAIETNGLK 103

Query: 123 EPPQGIDWICVSPKA-----GCDLKIKGGQELKLVFPQVNVSPENYIG--FDFERFSLQP 175
             P  ID+I  SPK           I    E+++V     ++    I      ER+ L P
Sbjct: 104 PVPPQIDYIATSPKRLYQKNYLKHHIPFANEVRIVVDGDVLAFCEQIESTIKAERYYLSP 163

Query: 176 MDGPFLEENTNLAISYCF-----QNPKWRLSVQTHKFIGI 210
            +   +                   P+W+LS+QTHK  GI
Sbjct: 164 CEENGVMNMLETITQLGKLNQRPNKPRWQLSIQTHKMAGI 203


>gi|117923944|ref|YP_864561.1| radical SAM protein [Magnetococcus sp. MC-1]
 gi|117607700|gb|ABK43155.1| Radical SAM domain protein [Magnetococcus sp. MC-1]
          Length = 204

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/216 (31%), Positives = 93/216 (43%), Gaps = 24/216 (11%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            Y+I +IF ++QGE  H G   VF RFSGC L           +C +CD   +  Q  K 
Sbjct: 4   TYAICDIFHSIQGEATHTGLPMVFIRFSGCPL-----------RCSWCDEP-LHRQADKA 51

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVETNGT 121
               + QL   I E            +LTGGEPL+   +  L+     +G+ IA+ET G 
Sbjct: 52  EHLTLTQLRSRILELAP----HTTNLLLTGGEPLMAPHLDRLVDYFKDQGYWIAMETCGE 107

Query: 122 -IEPPQGIDWICVSPKAGCDLK-IKGGQELKLVF--PQVNVSPENYIGFDFERFSLQPMD 177
             E P  +DW+ +SPK        +   E+KLV          E           LQP  
Sbjct: 108 GGEIPAEVDWVTLSPKNQLPQSLYERADEVKLVLGADADQSDKERLTQCHHPNLWLQPRA 167

Query: 178 GPFL--EENTNLAISYCFQNPK-WRLSVQTHKFIGI 210
            P         L   +  ++   WRLS+QTHK+IG+
Sbjct: 168 LPTGPDPMAVALCYRWALESGGAWRLSLQTHKYIGV 203


>gi|53804445|ref|YP_113696.1| radical activating enzyme family protein [Methylococcus capsulatus
           str. Bath]
 gi|53758206|gb|AAU92497.1| radical activating enzyme family protein [Methylococcus capsulatus
           str. Bath]
          Length = 215

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 53/224 (23%), Positives = 84/224 (37%), Gaps = 42/224 (18%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            I EIF +LQGE    G   VF R +GC L           +C +CDT +     + G R
Sbjct: 7   RITEIFFSLQGETRTVGLPTVFVRLTGCPL-----------RCSYCDTAYAF---SGGER 52

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNGTIE 123
            ++ ++ + +      G    RY  +TGGEPL Q   +PL+ AL   G+++++ET G  +
Sbjct: 53  MSIAEIVERV------GRYGARYVTVTGGEPLAQKACLPLLTALCDEGYQVSLETGGAHD 106

Query: 124 PPQGIDWIC-----VSPKAGCDLKI--------KGGQELKLVFPQVNVSPENYIGFDF-- 168
                  +       +P +G   +         + G ++K V              D   
Sbjct: 107 ISAVDPRVVRVVDLKTPGSGEASRNLYANVDALRQGDQVKFVIADRPDYDWAVAKLDEHR 166

Query: 169 ----ERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                     P+ G        LA          R  +Q HK +
Sbjct: 167 LAERCEILFSPVAGALQPA--QLAEWILRDRLPVRFQLQLHKLL 208


>gi|240114982|ref|ZP_04729044.1| hypothetical protein NgonPID1_01797 [Neisseria gonorrhoeae PID18]
 gi|260441203|ref|ZP_05795019.1| hypothetical protein NgonDG_08991 [Neisseria gonorrhoeae DGI2]
 gi|268600650|ref|ZP_06134817.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268584781|gb|EEZ49457.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
          Length = 212

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 96/221 (43%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++        
Sbjct: 13  YRIVEIFESLQGEGRNTGMPAVFVRLGKCNLACG-----------WCDTDYL-------- 53

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
            + +  L+D++    I      R  ++TGGEP +Q  + + +  L   G+ + +ETNG  
Sbjct: 54  TFGMMSLSDILGRLKI---YAARNIIITGGEPTIQPHLDMLLDTLKAEGYFLCIETNGLN 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQ--VNVSPENYIGFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     V              + L P
Sbjct: 111 PVPPQIDYVATSPKACYAAKYEKSCIETADEVRIVADGDVVGFCENMERKIRAHHYYLSP 170

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQDGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 211


>gi|313668991|ref|YP_004049275.1| hypothetical protein NLA_17110 [Neisseria lactamica ST-640]
 gi|313006453|emb|CBN87916.1| conserved hypothetical protein [Neisseria lactamica 020-06]
          Length = 212

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 64/221 (28%), Positives = 96/221 (43%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++        
Sbjct: 13  YRIVEIFESLQGEGRNTGMPAVFVRLGKCNLACG-----------WCDTDYL-------- 53

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
            + +  L+D++           R  ++TGGEP +Q  +   + AL   G+ + +ETNG  
Sbjct: 54  TFGMMSLSDILGRLKT---YTVRNIIITGGEPTIQPHLDTLLDALKAEGYFLCLETNGLN 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     ++    +        + L P
Sbjct: 111 PAPPQIDYVATSPKACYAAKYEKSCIETADEVRIVADGDVLAFCENMERKIRARHYYLSP 170

Query: 176 MDGPFLEE--NTNLAISYCFQNP----KWRLSVQTHKFIGI 210
            +        +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQNGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 211


>gi|37522605|ref|NP_925982.1| hypothetical protein gll3036 [Gloeobacter violaceus PCC 7421]
 gi|35213606|dbj|BAC90977.1| gll3036 [Gloeobacter violaceus PCC 7421]
          Length = 214

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 57/216 (26%), Positives = 90/216 (41%), Gaps = 29/216 (13%)

Query: 5   SIKEIF-LTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
            ++E F  T+QGEG  AG V  F R  GC +            C +CDT +    G    
Sbjct: 17  PVQETFGPTIQGEGYWAGAVVDFIRLYGCPV-----------GCPWCDTGYA--DGGPQL 63

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVETNGTI 122
              V   +DLI E            V++GGEP +   +P L++A+ + G  +A+ET+G  
Sbjct: 64  PRAVRTFSDLILELK------SPRVVISGGEPFIHAALPALVEAIGRTGRAVAIETSGAF 117

Query: 123 EPP-QGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPM----- 176
             P     W+ +SPK     +     ++     +V +        D  R  L P      
Sbjct: 118 WQPVPDWAWVTLSPKEHVSPRHPVNPQMWRRANEVKIVIAGGAELDVYRRFLPPGVPVSL 177

Query: 177 --DGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
             +    E    L +     +P++RLSVQ HK++ +
Sbjct: 178 QPEWEARERTLPLTLELLKAHPRYRLSVQLHKYLQV 213


>gi|217969210|ref|YP_002354444.1| radical SAM protein [Thauera sp. MZ1T]
 gi|217506537|gb|ACK53548.1| Radical SAM domain protein [Thauera sp. MZ1T]
          Length = 223

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 52/226 (23%), Positives = 83/226 (36%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIF +LQGE    G   VF R +GC L           +C +CDT +     + G
Sbjct: 13  RLRITEIFASLQGESTRVGLPTVFVRLTGCPL-----------RCTWCDTAYAF---SGG 58

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNGT 121
               +D +   +           R+  +TGGEPL Q   +PL+ AL   G ++++ET+G 
Sbjct: 59  ETRTLDDILAEV------ASHGLRHVCVTGGEPLAQKGCLPLLAALCDAGHDVSLETSGA 112

Query: 122 IEPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLV------FPQVNVSPEN 162
           ++       +       +P +G   + +           ELK V      +         
Sbjct: 113 LDIAGVDPRVSRIVDLKAPGSGELARNRWENLALLCAHDELKFVLADAADYAWARQQIAE 172

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +   +     L P+ G        LA          R  +Q HK +
Sbjct: 173 HRLAERCGVLLSPVAGALDPA--ELAGWIVRDRLPVRFQLQLHKIL 216


>gi|261378237|ref|ZP_05982810.1| radical SAM domain protein [Neisseria cinerea ATCC 14685]
 gi|269145315|gb|EEZ71733.1| radical SAM domain protein [Neisseria cinerea ATCC 14685]
          Length = 212

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 64/221 (28%), Positives = 97/221 (43%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  A+F R   CNL  G           +CDTD++        
Sbjct: 13  YRIVEIFESLQGEGWNTGMPAIFVRLGKCNLACG-----------WCDTDYL-------- 53

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
            +++  L+D++           R  ++TGGEP +Q  +   + AL   G+ + +ETNG  
Sbjct: 54  TFDIMSLSDILGRLKT---YAARNIIITGGEPTIQPHLDTLLDALKAEGYFLCIETNGLK 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPK     K +        E+++V     V+    +       R+ L P
Sbjct: 111 PAPPQIDYVATSPKVCYADKYETNCIAEADEVRIVADGDVVAFCENMERKIRARRYYLSP 170

Query: 176 MDGPFLEE--NTNLAISYCFQNP----KWRLSVQTHKFIGI 210
            +        +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQNGAMNIYDTIRQIGILNSRPDASVHWQLSVQTHKWAGI 211


>gi|256823062|ref|YP_003147025.1| Radical SAM domain-containing protein [Kangiella koreensis DSM
           16069]
 gi|256796601|gb|ACV27257.1| Radical SAM domain protein [Kangiella koreensis DSM 16069]
          Length = 213

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 54/228 (23%), Positives = 78/228 (34%), Gaps = 42/228 (18%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M    I EIF +LQGE    G   VF R +GC L           +C +CDTD+      
Sbjct: 1   MSKLRITEIFHSLQGESLTVGVPTVFVRLTGCPL-----------RCVYCDTDYAF---G 46

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDV-PLIQALNKRGFEIAVETN 119
            G     +++   I++          +  +TGGEPL Q  V    + L   G++++ ET 
Sbjct: 47  GGEWMRFEEILAEIKQ------YGCEHVCITGGEPLAQKRVFEFFKLLGDEGYKVSTETG 100

Query: 120 GTIEPPQGIDWICVSPKA-------------GCDLKIKGGQELKLVFPQVNVSP------ 160
           G  +       + V                      +K   ++K V              
Sbjct: 101 GAHDISPVDKRVMVVMDLKTPDSQEMARNLYSNIELLKPTDQVKFVICSRKDYEWCKMTV 160

Query: 161 ENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           E Y           P  G    E  +LA        K R+ VQ HK I
Sbjct: 161 EQYDITSKCEVLFSPSYGQV--EYADLAEWILKDRLKVRMQVQLHKII 206


>gi|154149814|ref|YP_001403432.1| radical SAM domain-containing protein [Candidatus Methanoregula
           boonei 6A8]
 gi|153998366|gb|ABS54789.1| Radical SAM domain protein [Methanoregula boonei 6A8]
          Length = 202

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 66/224 (29%), Positives = 93/224 (41%), Gaps = 40/224 (17%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            I EIF +LQGEG   G   +F R +GCNL            CR+CDT +    GT+   
Sbjct: 2   KIAEIFKSLQGEGVRQGTPCIFIRLAGCNL-----------ACRWCDTQYARSGGTE--- 47

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD--VPLIQALNKRGFEIAVETNGTI 122
                   ++EE W       R   +TGGEPLLQ D  +PL+ +L+KRG  I +ETNGTI
Sbjct: 48  ---TSCDKILEEIWKEN---PRSVCITGGEPLLQTDVLLPLLASLHKRGITIDIETNGTI 101

Query: 123 EPPQ-------GIDWICVSPKAGCDL----KIKGGQELKLVFPQVNVSPENYIGFDFERF 171
           +           +D  C S     DL    +I+    +K V   +               
Sbjct: 102 DFSPVQPFAAVCMDVKCPSSGERSDLSLLARIRPTDSVKFVVGDLADCRYAQEVLARHAI 161

Query: 172 ----SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
                L P+ G   +      +     N   R  +Q HK +G++
Sbjct: 162 AGECFLSPVYGTDCDTIVRFILD---NNLPVRFQLQLHKILGVK 202


>gi|126180149|ref|YP_001048114.1| radical SAM domain-containing protein [Methanoculleus marisnigri
           JR1]
 gi|125862943|gb|ABN58132.1| Radical SAM domain protein [Methanoculleus marisnigri JR1]
          Length = 202

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 52/223 (23%), Positives = 87/223 (39%), Gaps = 40/223 (17%)

Query: 6   IKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRY 65
           + EIF +LQGEG + GR   F R +GCNL           +C +CDT +       G   
Sbjct: 3   VSEIFRSLQGEGKNQGRPCTFIRLAGCNL-----------RCAWCDTPYAR---EGGEEM 48

Query: 66  NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQ--VDVPLIQALNKRGFEIAVETNGTIE 123
           +V Q+ D +   W+       +  +TGGEPLLQ    + L++  +  G+ + +ETNGT +
Sbjct: 49  SVTQVLDRV---WLLRG---THICITGGEPLLQREDVLKLLEKFSLHGYTVEIETNGTCD 102

Query: 124 PPQGIDWICVSPKAGCDLKIKG-----------GQELKLVFPQVNVSPENYIGFDFERF- 171
                 +  +     C    +               +K V    +               
Sbjct: 103 FRDMQPYASICMDVKCPSSGEKSDLSLLSFITPRDCVKFVVADEDDLLYARAVMSRCEIR 162

Query: 172 ---SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
               + P++G        +A     +N   R  +Q HK +G++
Sbjct: 163 GEVFISPVEGSDY---RAVADQIVEENLPVRFQLQLHKILGVK 202


>gi|300869302|ref|ZP_07113893.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300332679|emb|CBN59091.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 210

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 57/222 (25%), Positives = 101/222 (45%), Gaps = 33/222 (14%)

Query: 3   LYSIKEIFL-TLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
              I E F  T+QGEG  +G +  F R +GC +            C +CDT +      +
Sbjct: 9   KLPIHETFQSTVQGEGYWSGTLVDFIRLAGCPV-----------HCPWCDTGYS-----E 52

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVETNG 120
           GG+   +    ++E   +  E +    V++GGEP +  ++P L+++L + G ++++ET+G
Sbjct: 53  GGKDLPNVQRSIVE---LLTELKSPRVVISGGEPFIHKNLPLLVESLLEVGKQVSIETSG 109

Query: 121 -TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFER--------- 170
              +   G  WI +SPK   + K    ++      ++ +        +F R         
Sbjct: 110 SHWQEVAGETWITLSPKEHVNPKYPVQEKFWSRANEIKLVISTGEEVNFYRDGLVSNPNI 169

Query: 171 -FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              LQP +         + +    QNP +RLS+QTHK IG++
Sbjct: 170 PVFLQP-EWSDRFRAIPIILQLLQQNPGYRLSLQTHKLIGVQ 210


>gi|307823680|ref|ZP_07653908.1| Radical SAM domain protein [Methylobacter tundripaludum SV96]
 gi|307734974|gb|EFO05823.1| Radical SAM domain protein [Methylobacter tundripaludum SV96]
          Length = 213

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 51/228 (22%), Positives = 79/228 (34%), Gaps = 42/228 (18%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M    I EIF +LQGE    G   VF R +GC L           +C +CDT +      
Sbjct: 1   MSSLRITEIFHSLQGESNTVGLPTVFIRLTGCPL-----------RCVYCDTAYAFT--- 46

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETN 119
            G +  +D +    E+          Y  +TGGEPL Q   + L+  L  +G+ +++ET+
Sbjct: 47  GGEKIGIDAIIAQAEQ------YGTPYITVTGGEPLAQPSCLELMTKLLDKGYVVSLETS 100

Query: 120 G-------TIEPPQGIDWICVSPKAGCDLKIKG------GQELKLVFPQVNVSPE----- 161
           G            + +D    S         +         ++K V    +         
Sbjct: 101 GALDVSKVDQRVVKVMDLKTPSSGELSRNCYQNIEYLTAKDQVKFVIGNDSDYDWSKSIL 160

Query: 162 -NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
             Y   +       P+ G      T LA          R  +Q HK +
Sbjct: 161 TEYDLPNLCEVLFSPVMGQQNP--TELAEKILKDRLPVRFQLQLHKIL 206


>gi|157803532|ref|YP_001492081.1| 50S ribosomal protein L35 [Rickettsia canadensis str. McKiel]
 gi|157784795|gb|ABV73296.1| 50S ribosomal protein L35 [Rickettsia canadensis str. McKiel]
          Length = 225

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 70/226 (30%), Positives = 100/226 (44%), Gaps = 34/226 (15%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               +K IF T+QGEG   G  A+F R  GCNL            C FCDT+F       
Sbjct: 16  TKLEVKSIFKTIQGEGIFVGSPAIFVRLGGCNL-----------ACHFCDTEF-----ED 59

Query: 62  GGRYNVDQLADLIEEQWIT--GEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
               ++ ++ + +E   +    EK     V+TGGEP+ Q    L Q L  R F++ +ETN
Sbjct: 60  FDLVDITEILNKVESLALNSKNEKSVNLVVITGGEPMRQPIALLCQKLLDRDFKVQIETN 119

Query: 120 GT-IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVN-VSPENYIGFDF--------- 168
           GT          I  SPKAG     K  ++L      V  +  +N + + F         
Sbjct: 120 GTLYRSLPNEVSIICSPKAGQTGYSKIREDLLSQISAVKFIVAKNILEYSFIPEVGQTAY 179

Query: 169 -ERFSLQPMDG---PFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                +QPMD       +EN  LA+    ++   +LS+QTHKF+GI
Sbjct: 180 NIPVFVQPMDQNNPKLNDENNALAVKLALESGS-KLSLQTHKFLGI 224


>gi|327481488|gb|AEA84798.1| radical activating enzyme [Pseudomonas stutzeri DSM 4166]
          Length = 224

 Score =  148 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 54/228 (23%), Positives = 83/228 (36%), Gaps = 43/228 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               I EIF +LQGE   +G   VF R +GC L           +C++CDT +     + 
Sbjct: 12  MTLRITEIFYSLQGETRTSGLPTVFVRLTGCPL-----------RCQYCDTAYAF---SG 57

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDV-PLIQALNKRGFEIAVETNG 120
           G    +D + + +           RY  +TGGEPL Q +  PL+Q L   G+E+++ET+G
Sbjct: 58  GELMALDAILERVAA------YNPRYVCVTGGEPLAQPNCVPLLQRLCDAGYEVSLETSG 111

Query: 121 TIEPPQGIDWIC--VSPKAGCD-----------LKIKGGQELKLVFPQVNVSPENYIGF- 166
            ++     + +   V  K               + +    ++K V               
Sbjct: 112 ALDISPVDERVSRVVDLKTPGSAEVGRNRYENIVHLTRNDQVKFVICSREDYDWAVSKLI 171

Query: 167 ------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                         P  G        LA      N   RL +Q HK I
Sbjct: 172 EYGLDRRAGEVLFSPSHGQVDVRA--LADWIVADNLPVRLQLQLHKII 217


>gi|146283135|ref|YP_001173288.1| radical activating enzyme [Pseudomonas stutzeri A1501]
 gi|145571340|gb|ABP80446.1| probable radical activating enzyme [Pseudomonas stutzeri A1501]
          Length = 213

 Score =  148 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 54/228 (23%), Positives = 83/228 (36%), Gaps = 43/228 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               I EIF +LQGE   +G   VF R +GC L           +C++CDT +     + 
Sbjct: 1   MTLRITEIFYSLQGETRTSGLPTVFVRLTGCPL-----------RCQYCDTAYAF---SG 46

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDV-PLIQALNKRGFEIAVETNG 120
           G    +D + + +           RY  +TGGEPL Q +  PL+Q L   G+E+++ET+G
Sbjct: 47  GELMALDAILERVAA------YNPRYVCVTGGEPLAQPNCVPLLQRLCDAGYEVSLETSG 100

Query: 121 TIEPPQGIDWIC--VSPKAGCD-----------LKIKGGQELKLVFPQVNVSPENYIGF- 166
            ++     + +   V  K               + +    ++K V               
Sbjct: 101 ALDISPVDERVSRVVDLKTPGSAEVGRNRYENIVHLTRNDQVKFVICSREDYDWAVSKLI 160

Query: 167 ------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                         P  G        LA      N   RL +Q HK I
Sbjct: 161 EYGLARRAGEVLFSPSHGQVDVRA--LADWIVADNLPVRLQLQLHKII 206


>gi|268596173|ref|ZP_06130340.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268549961|gb|EEZ44980.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
          Length = 267

 Score =  148 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 65/221 (29%), Positives = 92/221 (41%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++       G
Sbjct: 68  YRIVEIFESLQGEGRNTGMPAVFVRLGKCNLACG-----------WCDTDYLTF-----G 111

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
             ++  +               R  ++TGGEP +Q  + + +  L   G+ + +ETNG  
Sbjct: 112 MMSLSDI------LGCLKTYAARNIIITGGEPTIQPHLDMLLDTLKAEGYFLCIETNGLN 165

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQ--VNVSPENYIGFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     V              + L P
Sbjct: 166 PVPPQIDYVATSPKACYAAKYEKSCIETADEVRIVADGDVVGFCENMERKIRAHHYYLSP 225

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 226 CEQDGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 266


>gi|307352768|ref|YP_003893819.1| Radical SAM domain-containing protein [Methanoplanus petrolearius
           DSM 11571]
 gi|307156001|gb|ADN35381.1| Radical SAM domain protein [Methanoplanus petrolearius DSM 11571]
          Length = 204

 Score =  148 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 93/224 (41%), Gaps = 40/224 (17%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            + EIF ++QGEG + G  + F R SGCNL           +CR+CDT      G+    
Sbjct: 2   KVFEIFPSIQGEGPYQGIPSAFIRLSGCNL-----------RCRWCDTPKT-QDGSSSEE 49

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDV--PLIQALNKRGFEIAVETNGTI 122
             VD++   +++  +       +  +TGGEPL+Q D    L++ L++ G+ + +ETNGTI
Sbjct: 50  MTVDEVFGQVKKLGL------SHVCITGGEPLIQQDELLSLLKDLHEDGYIVEIETNGTI 103

Query: 123 EPPQGIDWICVSPK-----------AGCDLKIKGGQELKLVFPQVNVSPENYIGFD---- 167
           +P   +++  V              A    K++    +K V              D    
Sbjct: 104 DPVPVMEYSSVCMDIKCPSSGEKSFAPFVKKLRPSDCVKFVVEGKEDLEYMTGLLDDIPS 163

Query: 168 FERFSLQPMDGPFLEENTNLAISYCFQ-NPKWRLSVQTHKFIGI 210
           +    + P+ G            Y  +     R  +Q HK +G+
Sbjct: 164 YVEVCVSPVWGSDS----RFIADYIMKLKRPVRFQLQLHKILGV 203


>gi|325127637|gb|EGC50553.1| radical SAM domain protein [Neisseria meningitidis N1568]
 gi|325135881|gb|EGC58493.1| radical SAM domain protein [Neisseria meningitidis M0579]
 gi|325202682|gb|ADY98136.1| radical SAM domain protein [Neisseria meningitidis M01-240149]
 gi|325207572|gb|ADZ03024.1| radical SAM domain protein [Neisseria meningitidis NZ-05/33]
          Length = 212

 Score =  148 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 64/221 (28%), Positives = 96/221 (43%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++       G
Sbjct: 13  YRIVEIFESLQGEGWNTGMPAVFVRLGKCNLACG-----------WCDTDYLTF-----G 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
             ++  +   ++          R  ++TGGEP +Q  + + +  L   G+ + +ETNG  
Sbjct: 57  MMSLSDILGRLKA------YAARNIIITGGEPTIQPHLDMLLDMLKAEGYFLCIETNGLN 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     ++    +        + L P
Sbjct: 111 PAPPQIDYVATSPKACYAAKYENSCIETADEVRIVADGDVLAFCENMERKIRAHHYYLSP 170

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQDGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 211


>gi|294669279|ref|ZP_06734358.1| radical SAM domain protein [Neisseria elongata subsp. glycolytica
           ATCC 29315]
 gi|291308689|gb|EFE49932.1| radical SAM domain protein [Neisseria elongata subsp. glycolytica
           ATCC 29315]
          Length = 212

 Score =  148 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 65/221 (29%), Positives = 96/221 (43%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++        
Sbjct: 13  YRIVEIFESLQGEGWNTGMPAVFVRLGKCNLACG-----------WCDTDYL-------- 53

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
           ++ +  L+D++           R  ++TGGEP +Q  +   +      G+ + +ETNG  
Sbjct: 54  KFGMMSLSDILGRLKT---YAARNVIITGGEPTIQPHLDTLLDTFKAEGYFLCIETNGLK 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     V+    +        + L P
Sbjct: 111 PAPPQIDYVATSPKACYAAKYETNCITEADEVRIVADGDVVAFCENMERKIRARHYYLSP 170

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQDGAMNIYDTIRQIGILNSRPDAPAHWQLSVQTHKWAGI 211


>gi|240013450|ref|ZP_04720363.1| hypothetical protein NgonD_02169 [Neisseria gonorrhoeae DGI18]
 gi|240015889|ref|ZP_04722429.1| hypothetical protein NgonFA_01772 [Neisseria gonorrhoeae FA6140]
 gi|240080029|ref|ZP_04724572.1| hypothetical protein NgonF_01775 [Neisseria gonorrhoeae FA19]
 gi|240112239|ref|ZP_04726729.1| hypothetical protein NgonM_01409 [Neisseria gonorrhoeae MS11]
 gi|240117266|ref|ZP_04731328.1| hypothetical protein NgonPID_02214 [Neisseria gonorrhoeae PID1]
 gi|240120521|ref|ZP_04733483.1| hypothetical protein NgonPI_01854 [Neisseria gonorrhoeae PID24-1]
 gi|240122820|ref|ZP_04735776.1| hypothetical protein NgonP_02565 [Neisseria gonorrhoeae PID332]
 gi|240125015|ref|ZP_04737901.1| hypothetical protein NgonSK_02119 [Neisseria gonorrhoeae SK-92-679]
 gi|254493044|ref|ZP_05106215.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268598297|ref|ZP_06132464.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268602962|ref|ZP_06137129.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268681434|ref|ZP_06148296.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268683601|ref|ZP_06150463.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|226512084|gb|EEH61429.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268582428|gb|EEZ47104.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268587093|gb|EEZ51769.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268621718|gb|EEZ54118.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268623885|gb|EEZ56285.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
          Length = 212

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 65/221 (29%), Positives = 92/221 (41%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++       G
Sbjct: 13  YRIVEIFESLQGEGRNTGMPAVFVRLGKCNLACG-----------WCDTDYLTF-----G 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
             ++  +               R  ++TGGEP +Q  + + +  L   G+ + +ETNG  
Sbjct: 57  MMSLSDI------LGCLKTYAARNIIITGGEPTIQPHLDMLLDTLKAEGYFLCIETNGLN 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQ--VNVSPENYIGFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     V              + L P
Sbjct: 111 PVPPQIDYVATSPKACYAAKYEKSCIETADEVRIVADGDVVGFCENMERKIRAHHYYLSP 170

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQDGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 211


>gi|218767651|ref|YP_002342163.1| hypothetical protein NMA0707 [Neisseria meningitidis Z2491]
 gi|121051659|emb|CAM07962.1| hypothetical protein NMA0707 [Neisseria meningitidis Z2491]
 gi|308388712|gb|ADO31032.1| hypothetical protein NMBB_0569 [Neisseria meningitidis alpha710]
          Length = 212

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 65/221 (29%), Positives = 96/221 (43%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++       G
Sbjct: 13  YRIVEIFESLQGEGWNTGMPAVFVRLGKCNLACG-----------WCDTDYLTF-----G 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
             ++  +   ++          R  ++TGGEP +Q  + + +  L   G+ + +ETNG  
Sbjct: 57  MMSLSDILGRLKA------YAARNIIITGGEPTIQPHLDMLLDMLKAEGYFLCIETNGLN 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     V+    +        + L P
Sbjct: 111 PAPPQIDYVATSPKACYAAKYEKSCIETADEVRIVADGDVVAFCENMERKIRAHHYYLSP 170

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQDGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 211


>gi|194097763|ref|YP_002000804.1| hypothetical protein NGK_0179 [Neisseria gonorrhoeae NCCP11945]
 gi|239998266|ref|ZP_04718190.1| hypothetical protein Ngon3_02112 [Neisseria gonorrhoeae 35/02]
 gi|193933053|gb|ACF28877.1| Conserved hypothetical protein [Neisseria gonorrhoeae NCCP11945]
 gi|317163547|gb|ADV07088.1| hypothetical protein NGTW08_0112 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 212

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 63/221 (28%), Positives = 94/221 (42%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++       G
Sbjct: 13  YRIVEIFESLQGEGRNTGMPAVFVRLGKCNLACG-----------WCDTDYLTF-----G 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
             ++  +               R  ++TGGEP +Q  + + +  L   G+ + +ETNG  
Sbjct: 57  MMSLSDI------LGCLKTYAARNIIITGGEPTIQPHLDMLLDTLKAEGYFLCLETNGLK 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     ++    +        + L P
Sbjct: 111 PAPPQIDYVATSPKACYAAKYETNCIAEADEVRIVADGDVLAFCENMERKIRARHYYLSP 170

Query: 176 MD--GPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
            +  G     +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQNGVMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 211


>gi|119477238|ref|ZP_01617474.1| probable radical activating enzyme [marine gamma proteobacterium
           HTCC2143]
 gi|119449601|gb|EAW30839.1| probable radical activating enzyme [marine gamma proteobacterium
           HTCC2143]
          Length = 214

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 54/229 (23%), Positives = 83/229 (36%), Gaps = 43/229 (18%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M    + EIF +LQGE    G   VF R +GC L           +C +CDT++      
Sbjct: 1   MTDLRLTEIFYSLQGETRTVGLPTVFVRLTGCPL-----------RCAYCDTEYAFH--- 46

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETN 119
            G ++++  + + +           RY  +TGGEPL Q +  PL+ AL  +G+E+++ET+
Sbjct: 47  GGEKWSLQAIQEKV------ASYHPRYVTVTGGEPLAQPNCWPLLTALCDQGYEVSLETS 100

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKG-------------GQELKLVFPQVNVSPENYIGF 166
           G I        +            +                ++K V              
Sbjct: 101 GAISLLGVDSRVVKVMDLKTPASNEMSRNLYENIELLSPQDQIKFVICDRKDYEWARFKL 160

Query: 167 DFERF-------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           D  R           P  G    E+  LA      N   R  VQ HK +
Sbjct: 161 DEHRLVDRVDEVLFSPSFGQI--ESAELAEWILADNLPVRFQVQLHKLL 207


>gi|157825999|ref|YP_001493719.1| organic radical activating protein [Rickettsia akari str. Hartford]
 gi|157799957|gb|ABV75211.1| Organic radical activating enzyme [Rickettsia akari str. Hartford]
          Length = 225

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 67/226 (29%), Positives = 101/226 (44%), Gaps = 34/226 (15%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               ++ IF T+QGEG   G  A+F R  GCNL            C FCDT+F       
Sbjct: 16  TTLEVQSIFKTIQGEGLFVGGPAIFIRLGGCNL-----------ACNFCDTEF-----ED 59

Query: 62  GGRYNVDQLADLIEEQWITGEKE--GRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
               ++ ++ + +E   +  + E      V+TGGEP+ Q    L Q L  + F++ +ETN
Sbjct: 60  FKLVDIVEILNKVESLALNSKNERAINLVVITGGEPMRQPIELLCQKLLDQDFKVQIETN 119

Query: 120 GT-IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVN-VSPENYIGFDF--------- 168
           GT         +I  SPKAG     K  ++L      V  +  +N + ++F         
Sbjct: 120 GTLYRALPNEVYIICSPKAGKTGYSKIREDLLSQISAVKFIVAKNILEYNFIPEVGQTSY 179

Query: 169 -ERFSLQPMDGP---FLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                +QPMD       +EN  LA+    ++   RLS+QTHK +GI
Sbjct: 180 NIPVFIQPMDQNNQRLNDENNELAVKLALES-GARLSLQTHKILGI 224


>gi|319639356|ref|ZP_07994107.1| NrdG protein [Neisseria mucosa C102]
 gi|317399540|gb|EFV80210.1| NrdG protein [Neisseria mucosa C102]
          Length = 211

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 65/222 (29%), Positives = 96/222 (43%), Gaps = 38/222 (17%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL            C +CDTD++        
Sbjct: 12  YRIVEIFESLQGEGWNTGMPAVFIRLGKCNL-----------ACSWCDTDYL-------- 52

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
           ++ +  L+D++           R  ++TGGEP +Q  +   + AL   G+ + +ETNG  
Sbjct: 53  KFGMMSLSDILGRLKT---YTARNIIITGGEPTIQPHLDTLLNALKAEGYFLCIETNGLN 109

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVS--PENYIGFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     ++   E         + L P
Sbjct: 110 PAPPQIDYVATSPKACYAAKYEKSCIEKADEVRIVADGEVIAFCQEMERKIRARHYYLSP 169

Query: 176 MDGPFLEENTNLAISYC------FQNP-KWRLSVQTHKFIGI 210
            +      N    I            P  W+LSVQTHK+ GI
Sbjct: 170 CEQ-DGAMNIYDTIRQIGVLNSRADAPVHWQLSVQTHKWAGI 210


>gi|302879778|ref|YP_003848342.1| Radical SAM domain-containing protein [Gallionella
           capsiferriformans ES-2]
 gi|302582567|gb|ADL56578.1| Radical SAM domain protein [Gallionella capsiferriformans ES-2]
          Length = 219

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 52/225 (23%), Positives = 84/225 (37%), Gaps = 42/225 (18%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             I EIF +LQGE    G   VF R +GC L           +C +CDT +     + G 
Sbjct: 10  LRITEIFFSLQGETRLIGLPTVFVRLTGCPL-----------RCVYCDTAYAF---SGGK 55

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPL-LQVDVPLIQALNKRGFEIAVETNG-- 120
            + + ++   + +       + RY  +TGGEPL  +  +PL++AL   G+++++ET+G  
Sbjct: 56  NHTLAEILQQVAQ------YKTRYVTVTGGEPLAQRNCLPLLKALCDAGYQVSLETSGAL 109

Query: 121 -----TIEPPQGIDWICVSPKAGCDLKIKG------GQELKLVFPQVNVSP------ENY 163
                     + +D    +       + +         E+K V    N           Y
Sbjct: 110 DIGAVDARVMRVVDIKTPASGEVDKNRWENLAILTPQDEIKFVLCDENDYDWACQILAQY 169

Query: 164 IGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
              D       P  G      T LA          R  +Q HK +
Sbjct: 170 HLADQCPVLFSPAQGDLDP--TQLADWILRDGLPVRFQLQLHKIL 212


>gi|110833622|ref|YP_692481.1| radical activating enzyme [Alcanivorax borkumensis SK2]
 gi|110646733|emb|CAL16209.1| radical activating enzyme [Alcanivorax borkumensis SK2]
          Length = 213

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 50/228 (21%), Positives = 87/228 (38%), Gaps = 43/228 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               + EIF +LQGE    GR  VF R +GC             +C +CDT++     + 
Sbjct: 1   MELRLTEIFHSLQGESRTVGRPTVFVRLTGCP-----------QRCVWCDTEYAF---SG 46

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNG 120
           G ++++  + + +           +Y  +TGGEPL Q   +PL++ L   G+++++ET G
Sbjct: 47  GEKWSLAAILEEVAAL------GAQYVTVTGGEPLAQPSCLPLLKTLCDEGYQVSLETGG 100

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQ------ELKLVFPQVNVSPENYIGFDFERFSL- 173
            ++     + + V          +          L     QV     +   +D+ RF L 
Sbjct: 101 AMDIAGVDERVSVVMDLKAPGSGEQHNNRLSNIALLKAHHQVKFVLADRKDYDWARFMLD 160

Query: 174 -------------QPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                         P+ G     +  LA          R  +Q HK +
Sbjct: 161 QYQLHQRVSDVLFSPVQGTLAPGD--LANWIVEDRLPVRFQLQLHKLL 206


>gi|240127528|ref|ZP_04740189.1| hypothetical protein NgonS_02574 [Neisseria gonorrhoeae SK-93-1035]
 gi|268685904|ref|ZP_06152766.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|268626188|gb|EEZ58588.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
          Length = 212

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 66/221 (29%), Positives = 95/221 (42%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++        
Sbjct: 13  YRIVEIFESLQGEGWNTGMPAVFVRLGKCNLACG-----------WCDTDYL-------- 53

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
            + +  L+D++           R  ++TGGEP +Q  + + +  L   G+ + +ETNG  
Sbjct: 54  TFGMMSLSDILGRLKT---YAARNIIITGGEPTIQPHLDMLLDTLKAEGYFLCIETNGLN 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVF--PQVNVSPENYIGFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     V              + L P
Sbjct: 111 PVPPQIDYVATSPKACYAAKYEKSCIETADEVRIVADGDAVGFCENMERKIRAHHYYLSP 170

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQDGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 211


>gi|152987293|ref|YP_001349882.1| radical activating enzyme [Pseudomonas aeruginosa PA7]
 gi|150962451|gb|ABR84476.1| probable radical activating enzyme [Pseudomonas aeruginosa PA7]
          Length = 215

 Score =  147 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 53/228 (23%), Positives = 87/228 (38%), Gaps = 43/228 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           +   I EIF +LQGE   AG   VF R +GC L           +C +CDT +     + 
Sbjct: 3   QTLRITEIFYSLQGETRTAGLPTVFVRLTGCPL-----------RCHYCDTAYAF---SG 48

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNG 120
           G   ++D + + +           RY  +TGGEPL Q + +PL++ L   G+E+++ET+G
Sbjct: 49  GEIVSLDAILERVAAYKP------RYICVTGGEPLAQPNCIPLLERLCDAGYEVSLETSG 102

Query: 121 TIEPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQVNVSPENYIGFD 167
            ++  +    +       +P +G   + +           ++K V               
Sbjct: 103 ALDVSRVDPRVSKVLDLKTPGSGEVGRNRYENIPLLTANDQVKFVVCSREDYDWAVSKLI 162

Query: 168 FERF-------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
             R           P           LA      N   RL +Q HK +
Sbjct: 163 EYRLEQRTGEVLFSPSHRQVDAR--ELADWIVADNLPVRLQLQLHKIL 208


>gi|157964748|ref|YP_001499572.1| organic radical activating protein [Rickettsia massiliae MTU5]
 gi|157844524|gb|ABV85025.1| Organic radical activating enzyme [Rickettsia massiliae MTU5]
          Length = 231

 Score =  147 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 73/227 (32%), Positives = 98/227 (43%), Gaps = 36/227 (15%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               ++ IF T+QGEG   G  A+F R  GCNL            C FCDT+F       
Sbjct: 22  TKLEVQSIFKTIQGEGIFVGCPAIFIRLGGCNL-----------ACNFCDTEF-----ED 65

Query: 62  GGRYNVDQLADLIEEQWIT--GEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
               ++DQ+ + +E   +    EK     V+TGGEP+ Q    L Q L  R  ++ +ETN
Sbjct: 66  FDLVDIDQILNKVESLALNSKNEKSINLVVITGGEPMRQPIELLCQKLLDRDVKVQIETN 125

Query: 120 G--TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVN-----------VSPENYIGF 166
           G      PQ +  IC SPKAG     K  +EL      V            + PE     
Sbjct: 126 GTLYRSLPQEVSIIC-SPKAGKTGYSKIREELLPKISAVKFIVAKNILEYSLIPEVGQTS 184

Query: 167 DFERFSLQPMDGPFLE---ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                 +QPMD        EN  LA+    ++   RLS+QTHKF+ I
Sbjct: 185 YNIPVFIQPMDQNDQRLNGENNELAVKLALES-GARLSLQTHKFLNI 230


>gi|239948218|ref|ZP_04699971.1| queuosine biosynthesis protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239922494|gb|EER22518.1| queuosine biosynthesis protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 225

 Score =  147 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 70/227 (30%), Positives = 97/227 (42%), Gaps = 36/227 (15%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               ++ IF T+QGEG   G  A+F R  GCNL            C FCDT+F       
Sbjct: 16  TKLEVQSIFKTIQGEGIFVGCPAIFIRLGGCNL-----------ACNFCDTEF-----ED 59

Query: 62  GGRYNVDQLADLIE--EQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
               ++D++ + +E        EK     V+TGGEP+ Q    L   L    F++ +ETN
Sbjct: 60  FDLVDIDKILNKVEILALNSKNEKSINLVVITGGEPMRQPIELLCHKLLDLDFKVQIETN 119

Query: 120 G--TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVN-----------VSPENYIGF 166
           G      P+G+  IC SPKAG     K  + L      V            + PE     
Sbjct: 120 GTLYRSLPKGVSIIC-SPKAGKTGYSKIRENLLPKISAVKFIVAKNILEYSIIPEVGQTS 178

Query: 167 DFERFSLQPMDGP---FLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                 +QPMD       +EN  LA+    ++   RLS+QTHKF+ I
Sbjct: 179 YNIPVFIQPMDQNNQRLNDENNELAVKLALES-GARLSLQTHKFLNI 224


>gi|268594121|ref|ZP_06128288.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268547510|gb|EEZ42928.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
          Length = 240

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 63/221 (28%), Positives = 94/221 (42%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++       G
Sbjct: 41  YRIVEIFESLQGEGRNTGMPAVFVRLGKCNLACG-----------WCDTDYLTF-----G 84

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
             ++  +               R  ++TGGEP +Q  + + +  L   G+ + +ETNG  
Sbjct: 85  MMSLSDI------LGCLKTYAARNIIITGGEPTIQPHLDMLLDTLKAEGYFLCLETNGLK 138

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     ++    +        + L P
Sbjct: 139 PAPPQIDYVATSPKACYAAKYETNCIAEADEVRIVADGDVLAFCENMERKIRARHYYLSP 198

Query: 176 MD--GPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
            +  G     +T   I      P     W+LSVQTHK+ GI
Sbjct: 199 CEQNGVMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 239


>gi|82703824|ref|YP_413390.1| radical SAM family protein [Nitrosospira multiformis ATCC 25196]
 gi|82411889|gb|ABB75998.1| Radical SAM [Nitrosospira multiformis ATCC 25196]
          Length = 234

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 52/225 (23%), Positives = 86/225 (38%), Gaps = 42/225 (18%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + EIFL+LQGE    G   VF R +GC L           +C +CDT +   +   G 
Sbjct: 25  LRVNEIFLSLQGETSRVGLPTVFVRLTGCPL-----------RCGYCDTAYAFHE---GE 70

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNGTI 122
           R ++  +   +           R+  +TGGEPL Q + + L++ L   G+ +++ET G +
Sbjct: 71  RLSLAAILMEVAR------HGARHVTVTGGEPLAQKECLALLRLLCDAGYSVSMETGGAL 124

Query: 123 EPPQGIDWIC-----VSPKAGCDLKI--------KGGQELKLVFPQVN---VSPENYIGF 166
           +  +    +       +P +G   K             E+K V    +    + E     
Sbjct: 125 DISKVDARVSRILDLKTPGSGEVEKNLWSNVQYLTSHDEVKFVLCDEDDYRWAVEMMGKH 184

Query: 167 DFER---FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
             +        P+ G      T LA          R+ VQ HK +
Sbjct: 185 RLDHTCPVLFSPVHGKLEP--TVLAEWILRDRLPVRMQVQLHKLL 227


>gi|329893688|ref|ZP_08269822.1| Queuosine Biosynthesis QueE Radical SAM [gamma proteobacterium
           IMCC3088]
 gi|328923615|gb|EGG30927.1| Queuosine Biosynthesis QueE Radical SAM [gamma proteobacterium
           IMCC3088]
          Length = 230

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 83/230 (36%), Gaps = 47/230 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           +   I EIF +LQGE    G   VF R +GC L           +C +CDT++    G  
Sbjct: 18  QTLRISEIFYSLQGETRTLGLPTVFIRLTGCPL-----------RCVYCDTEYAFHGG-- 64

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNG 120
                   L D++E+         R+  +TGGEPL Q +  PL+Q L   G+E+++ET+G
Sbjct: 65  ----TQIALGDILEQ---AAAFNTRFVTVTGGEPLAQPNCWPLLQMLCDEGYEVSLETSG 117

Query: 121 TIEPPQGIDWI-------CVSPKAGCDLKIKG------GQELKLVFPQVNVSPENYIGFD 167
            +        +                   +         ++K V    +    ++  F 
Sbjct: 118 ALSVADVDARVVKVLDLKTPGSGESHRNDYENIALLNLHDQVKFVIT--DREDYDWARFK 175

Query: 168 FER---------FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
            +              P+ G      T LA          R  +Q HK +
Sbjct: 176 VDELGLVGRVSDILFSPVHGKLTP--TQLADWILADRLPVRFQLQLHKLL 223


>gi|254516700|ref|ZP_05128759.1| radical SAM domain protein [gamma proteobacterium NOR5-3]
 gi|219675123|gb|EED31490.1| radical SAM domain protein [gamma proteobacterium NOR5-3]
          Length = 226

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 83/230 (36%), Gaps = 47/230 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           +   I EIF +LQGE    G   VF R +GC L           +C +CDT++       
Sbjct: 14  QTLRITEIFYSLQGEARTVGLPTVFVRLTGCPL-----------RCLYCDTEYAFH---G 59

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNG 120
           G     + +A  + +          Y  +TGGEPL Q + +PL+  L  +G+E+++ET+G
Sbjct: 60  GEIMTFEHIAGQVAQHAPA------YVTVTGGEPLAQPNCLPLLSLLCDQGYEVSLETSG 113

Query: 121 TIEPPQGIDWI--CVSPKAGCD-----------LKIKGGQELKLVFPQVNVSPENYIGFD 167
            +        +   +  K                 +    +LK V    N     +  F 
Sbjct: 114 AMPVADVDPRVVKVLDLKTPASGEAGRNDYANIEHLTSNDQLKFVICDRN--DYEWARFK 171

Query: 168 FERFSL---------QPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
            +  +L          P           LA          RL +Q HK +
Sbjct: 172 LDELALVPRVSDVLFSPSHEQLAPR--ELAEWILADRLPVRLQLQLHKLL 219


>gi|261364119|ref|ZP_05977002.1| radical SAM domain protein [Neisseria mucosa ATCC 25996]
 gi|288567697|gb|EFC89257.1| radical SAM domain protein [Neisseria mucosa ATCC 25996]
          Length = 212

 Score =  146 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 65/221 (29%), Positives = 97/221 (43%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++        
Sbjct: 13  YRIVEIFESLQGEGWNTGMPAVFVRLGKCNLACG-----------WCDTDYL-------- 53

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
           ++ +  L+D++           R  ++TGGEP +Q  +   + AL   G+ + +ETNG  
Sbjct: 54  KFGMMSLSDILGRLKT---YTARNIIITGGEPTIQPHLDTLLDALKAEGYFLCIETNGLK 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     V+    +        + L P
Sbjct: 111 PAPPQIDYVATSPKACYAAKYETNCIAEADEVRIVADGDVVAFCENMERKIRARYYYLSP 170

Query: 176 MDGPFLEE--NTNLAISYCFQNP----KWRLSVQTHKFIGI 210
            +        +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQNGAMNIYDTIHQIGILNSRPDAPVHWQLSVQTHKWAGI 211


>gi|15676436|ref|NP_273574.1| hypothetical protein NMB0529 [Neisseria meningitidis MC58]
 gi|7225754|gb|AAF40959.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|316985383|gb|EFV64331.1| radical SAM superfamily protein [Neisseria meningitidis H44/76]
 gi|325139736|gb|EGC62270.1| radical SAM domain protein [Neisseria meningitidis CU385]
 gi|325200783|gb|ADY96238.1| radical SAM domain protein [Neisseria meningitidis H44/76]
          Length = 212

 Score =  146 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 65/221 (29%), Positives = 97/221 (43%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++        
Sbjct: 13  YRIVEIFESLQGEGWNTGMPAVFVRLGKCNLACG-----------WCDTDYL-------- 53

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
            + +  L+D++           R  ++TGGEP +Q  + + +  L   G+ + +ETNG  
Sbjct: 54  TFGMMGLSDILGRLKT---YAARNIIITGGEPTIQPHLDMLLDTLKAEGYFLCLETNGLN 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     ++    +        + L P
Sbjct: 111 PAPPQIDYVATSPKACYAAKYENSCIETADEVRIVADGDVLAFCENMERKIRAHHYYLSP 170

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQDGAMNIYDTIRQIGILNSRPDASVHWQLSVQTHKWAGI 211


>gi|254669979|emb|CBA04660.1| conserved hypothetical protein [Neisseria meningitidis alpha153]
          Length = 212

 Score =  146 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 65/221 (29%), Positives = 97/221 (43%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++        
Sbjct: 13  YRIVEIFESLQGEGWNTGMPAVFVRLGKCNLACG-----------WCDTDYL-------- 53

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
            + +  L+D++           R  ++TGGEP +Q  + + +  L   G+ + +ETNG  
Sbjct: 54  TFGMMGLSDILGRLKT---YAARNIIITGGEPTIQPHLDMLLDTLKAEGYFLCLETNGLN 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     ++    +        + L P
Sbjct: 111 PAPPQIDYVATSPKACYAAKYENSCIETADEVRIVADGDVLAFCENMERKIRAHHYYLSP 170

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQDGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 211


>gi|163781704|ref|ZP_02176704.1| hypothetical protein HG1285_02438 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882924|gb|EDP76428.1| hypothetical protein HG1285_02438 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 218

 Score =  146 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 60/224 (26%), Positives = 92/224 (41%), Gaps = 37/224 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
            S+ EI+ ++QGEG   G  ++F R  GCNL           +C +CD            
Sbjct: 12  LSVNEIYESIQGEGLLVGTPSIFIRLQGCNL-----------RCPWCDQPEAL--SFSNT 58

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
              V+ +   ++E         R+ V+TGGEP    ++ + ++AL + GF + +ETNGT+
Sbjct: 59  TIPVEGILQKVQE------FPARHVVITGGEPFAHQNLHVLVRALIEEGFSLQIETNGTL 112

Query: 123 EPPQ-----GIDWICVSPKA-----GCDLKIKGGQELKLVFPQ-----VNVSPENYIGFD 167
                        I  SPKA          IK   ELK V  +     V +  E      
Sbjct: 113 WNEGLDSMAEQVHITCSPKAAANFFVNPRVIKHTNELKFVVDEEFSSDVVLREEFRGLLL 172

Query: 168 FERFSLQPMDGP--FLEENTNLAISYCFQNPKWRLSVQTHKFIG 209
            E+  LQP      FL +  ++      +  K R+  Q HK +G
Sbjct: 173 AEKVVLQPEGNKVSFLRKALDIQRELSLKGFKVRVIPQVHKLLG 216


>gi|319409907|emb|CBY90232.1| conserved hypothetical protein [Neisseria meningitidis WUE 2594]
          Length = 212

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/221 (28%), Positives = 94/221 (42%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++       G
Sbjct: 13  YRIVEIFESLQGEGWNTGMPAVFVRLGKCNLACG-----------WCDTDYLTF-----G 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
             ++  +               R  ++TGGEP +Q  + + +  L   G+ + +ETNG  
Sbjct: 57  MMSLSDI------LGCLKTYAARNIIITGGEPTIQPHLDMLLDTLKAEGYFLCLETNGLN 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     ++    +        + L P
Sbjct: 111 PAPPQIDYVATSPKACYAAKYENSCIETADEVRIVADGDVLAFCENMERKIRAHHYYLSP 170

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQDGAMNIYDTIRQIGILNSRPDASVHWQLSVQTHKWAGI 211


>gi|254427312|ref|ZP_05041019.1| radical SAM domain protein [Alcanivorax sp. DG881]
 gi|196193481|gb|EDX88440.1| radical SAM domain protein [Alcanivorax sp. DG881]
          Length = 213

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 50/228 (21%), Positives = 86/228 (37%), Gaps = 43/228 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               + EIF +LQGE    GR  VF R +GC             +C +CDT++     + 
Sbjct: 1   MELRLTEIFHSLQGESRTVGRPTVFVRLTGCP-----------QRCVWCDTEYAF---SG 46

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNG 120
           G ++ +  + + +           +Y  +TGGEPL Q + +PL+ AL   G+++++ET G
Sbjct: 47  GEKWTLAAIREQVAA------HGAQYVTVTGGEPLAQPNCLPLLTALCDDGYQVSLETGG 100

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQ------ELKLVFPQVNVSPENYIGFDFERFSL- 173
            ++     + + V          +          L     QV     +   +D+ RF L 
Sbjct: 101 AMDIAGVDERVSVVMDLKAPGSGEQHNNRLENIPLLKAHHQVKFVLADRKDYDWARFMLD 160

Query: 174 -------------QPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                         P+          LA          R  +Q HK++
Sbjct: 161 QHQLHKRVSDVLFSPVQDGLAPG--ELADWIVADRLPVRFQLQLHKYL 206


>gi|254490155|ref|ZP_05103346.1| radical SAM domain protein, putative [Methylophaga thiooxidans
           DMS010]
 gi|224464641|gb|EEF80899.1| radical SAM domain protein, putative [Methylophaga thiooxydans
           DMS010]
          Length = 213

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 56/228 (24%), Positives = 89/228 (39%), Gaps = 42/228 (18%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M    I EIF +LQGE    G   VF R +GC L           +C +CDT++    G 
Sbjct: 1   MAQCRITEIFYSLQGESRTVGLPTVFVRLTGCPL-----------RCGYCDTEYAFYGGQ 49

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETN 119
           K        ++D++E+       + RY  +TGGEPL Q + +PL+ AL   G E+++ET+
Sbjct: 50  K------MDISDIVEQ---VAAYKPRYVCVTGGEPLAQPNCIPLLTALCDLGVEVSIETS 100

Query: 120 GTIEPPQGIDWI-------CVSPKAGCDLKIKG------GQELKLVFPQVNVSP------ 160
           G ++  +    +                 + +         +LK V              
Sbjct: 101 GAMDISKVDPRVIRVMDLKTPGSGEESKNRYENIALLESKDQLKFVICHREDYDWACETL 160

Query: 161 ENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
             Y   D       P+ G     +  LA      N   R+ +Q HK++
Sbjct: 161 AEYQLSDRCEVLFSPIHGELKPAD--LADWIVEDNLPVRMQLQLHKYL 206


>gi|161869455|ref|YP_001598622.1| hypothetical protein NMCC_0466 [Neisseria meningitidis 053442]
 gi|161595008|gb|ABX72668.1| conserved hypothetical protein [Neisseria meningitidis 053442]
          Length = 212

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/221 (28%), Positives = 94/221 (42%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++       G
Sbjct: 13  YRIVEIFESLQGEGWNTGMPAVFVRLGKCNLACG-----------WCDTDYLTF-----G 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
             ++  +               R  ++TGGEP +Q  + + +  L   G+ + +ETNG  
Sbjct: 57  MMSLSDI------LGCLKTYAARNIIITGGEPTIQPHLDMLLDTLKAEGYFLCLETNGLN 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     ++    +        + L P
Sbjct: 111 PAPPQIDYVATSPKACYAAKYENSCIETADEVRIVADGDVLAFCENMERKIRAHHYYLSP 170

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQDGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 211


>gi|293397670|ref|ZP_06641876.1| conserved hypothetical protein [Neisseria gonorrhoeae F62]
 gi|291611616|gb|EFF40685.1| conserved hypothetical protein [Neisseria gonorrhoeae F62]
          Length = 241

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 95/221 (42%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++        
Sbjct: 42  YRIVEIFESLQGEGWNTGMPAVFVRLGKCNLACG-----------WCDTDYL-------- 82

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
            + +  L+D++           R  ++TGGEP +Q  +   + AL   G+ + +ETNG  
Sbjct: 83  TFGMMSLSDILGRLKT---YAARNIIITGGEPTIQPHLDTLLDALKAEGYFLCLETNGLK 139

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVF--PQVNVSPENYIGFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     V              + L P
Sbjct: 140 PAPPQIDYVATSPKACYAAKYEKSCIETADEVRIVADGDAVGFCENMERKIRAHHYYLSP 199

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 200 CEQDGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 240


>gi|325133661|gb|EGC56318.1| radical SAM domain protein [Neisseria meningitidis M13399]
 gi|325143843|gb|EGC66158.1| radical SAM domain protein [Neisseria meningitidis M01-240013]
 gi|325206619|gb|ADZ02072.1| radical SAM domain protein [Neisseria meningitidis M04-240196]
          Length = 212

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 65/221 (29%), Positives = 94/221 (42%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++       G
Sbjct: 13  YRIVEIFESLQGEGWNTGMPAVFVRLGKCNLACG-----------WCDTDYLTF-----G 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
             ++  +               R  ++TGGEP +Q  + + +  L   G+ + +ETNG  
Sbjct: 57  MMSLSDI------LGCLKTYAARNIIITGGEPTIQPHLDMLLDTLKAEGYFLCLETNGLN 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     V+    +        + L P
Sbjct: 111 PAPPQIDYVATSPKACYAAKYEKSCIETADEVRIVADGDVVAFCENMERKIRAHHYYLSP 170

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQDGAMNIYDTIRQIGILNSRPDASVHWQLSVQTHKWAGI 211


>gi|146306312|ref|YP_001186777.1| radical SAM domain-containing protein [Pseudomonas mendocina ymp]
 gi|145574513|gb|ABP84045.1| Radical SAM domain protein [Pseudomonas mendocina ymp]
          Length = 226

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 55/230 (23%), Positives = 82/230 (35%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I EIF +LQGE   AG   VF R +GC L           +C++CDT +     
Sbjct: 12  MQETLRITEIFYSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDTAYAF--- 57

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
           + G    +D + D +           RY  +TGGEPL Q + +PL+  L   G+E+++ET
Sbjct: 58  SGGEIVTLDSILDQVAA------YRPRYVCVTGGEPLAQPNCIPLLTRLCDAGYEVSLET 111

Query: 119 NGTIEPPQGIDWICVSPK---AGCDLKIKGGQE----------LKLVFPQVNVSPENYIG 165
           +G ++       +         G     +   E          +K V             
Sbjct: 112 SGALDVSAVDPRVSKVLDLKTPGSAEVQRNRYENIEWLTANDQVKFVICSREDYDWAVSK 171

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                           P       E   LA      N   RL +Q HK +
Sbjct: 172 LIQYDLPARAGEVLFSP--SHKQVEARALADWIVADNLPVRLQLQLHKIL 219


>gi|261393100|emb|CAX50697.1| conserved hypothetical protein [Neisseria meningitidis 8013]
 gi|325203620|gb|ADY99073.1| radical SAM domain protein [Neisseria meningitidis M01-240355]
          Length = 212

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/221 (28%), Positives = 94/221 (42%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++       G
Sbjct: 13  YRIVEIFESLQGEGWNTGMPAVFVRLGKCNLACG-----------WCDTDYLTF-----G 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
             ++  +               R  ++TGGEP +Q  + + +  L   G+ + +ETNG  
Sbjct: 57  MMSLSDI------LGCLKTYAARNIIITGGEPTIQPHLDMLLDMLKAEGYFLCIETNGLN 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     ++    +        + L P
Sbjct: 111 PAPPQIDYVATSPKACYAAKYEKSCIETADEVRIVADGDVLAFCENMERKIRAHHYYLSP 170

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQDGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 211


>gi|71909659|ref|YP_287246.1| radical SAM family protein [Dechloromonas aromatica RCB]
 gi|71849280|gb|AAZ48776.1| Radical SAM [Dechloromonas aromatica RCB]
          Length = 212

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 49/227 (21%), Positives = 81/227 (35%), Gaps = 42/227 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               I EIF +LQGE    G   VF R +GC L           +C +CDT +       
Sbjct: 1   MALRITEIFYSLQGEASRVGLPTVFVRLTGCPL-----------RCSWCDTTYSFT---G 46

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPL-LQVDVPLIQALNKRGFEIAVETNG 120
           G    V+ +   +       +   R   +TGGEPL  +  +PL+ AL   G+++++ET+G
Sbjct: 47  GEAATVESVLAEV------AKYPARQVCVTGGEPLSQKDCLPLLAALCNAGYDVSLETSG 100

Query: 121 TIEPPQGIDWIC--VSPKAGCD-----------LKIKGGQELKLVFPQVNVSPENYIGFD 167
            ++       +   +  KA                +    E+K+V               
Sbjct: 101 ALDVSAVDPRVARIMDLKAPDSAESARNLWENLTVLTPRDEIKIVIASRGDYEWARDVLR 160

Query: 168 FERF------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
            ++          P  G    +  +LA          R  +Q HK +
Sbjct: 161 QKKLDQICSVLFSPAQGVIEPQ--SLAEWILEDGLNVRFQLQLHKLL 205


>gi|121634324|ref|YP_974569.1| hypothetical protein NMC0468 [Neisseria meningitidis FAM18]
 gi|120866030|emb|CAM09768.1| hypothetical protein NMC0468 [Neisseria meningitidis FAM18]
 gi|325129656|gb|EGC52471.1| radical SAM domain protein [Neisseria meningitidis OX99.30304]
 gi|325131671|gb|EGC54376.1| radical SAM domain protein [Neisseria meningitidis M6190]
 gi|325137687|gb|EGC60264.1| radical SAM domain protein [Neisseria meningitidis ES14902]
 gi|325141739|gb|EGC64192.1| radical SAM domain protein [Neisseria meningitidis 961-5945]
 gi|325197741|gb|ADY93197.1| radical SAM domain protein [Neisseria meningitidis G2136]
          Length = 212

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/221 (28%), Positives = 94/221 (42%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++       G
Sbjct: 13  YRIVEIFESLQGEGWNTGIPAVFVRLGKCNLACG-----------WCDTDYLTF-----G 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
             ++  +               R  ++TGGEP +Q  + + +  L   G+ + +ETNG  
Sbjct: 57  MMSLSDI------LGCLKTYAARNIIITGGEPTIQPHLDMLLDMLKAEGYFLCIETNGLN 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     ++    +        + L P
Sbjct: 111 PAPPQIDYVATSPKACYAAKYEKSCIETADEVRIVADGDVLAFCENMERKIRAHHYYLSP 170

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQDGAMNIYDTIRQIGILNSRPDASVHWQLSVQTHKWAGI 211


>gi|227827777|ref|YP_002829557.1| radical SAM protein [Sulfolobus islandicus M.14.25]
 gi|227830487|ref|YP_002832267.1| radical SAM protein [Sulfolobus islandicus L.S.2.15]
 gi|229579299|ref|YP_002837697.1| Radical SAM domain protein [Sulfolobus islandicus Y.G.57.14]
 gi|229581941|ref|YP_002840340.1| Radical SAM domain protein [Sulfolobus islandicus Y.N.15.51]
 gi|229585048|ref|YP_002843550.1| Radical SAM domain protein [Sulfolobus islandicus M.16.27]
 gi|238619949|ref|YP_002914775.1| Radical SAM domain protein [Sulfolobus islandicus M.16.4]
 gi|284997981|ref|YP_003419748.1| Radical SAM domain protein [Sulfolobus islandicus L.D.8.5]
 gi|227456935|gb|ACP35622.1| Radical SAM domain protein [Sulfolobus islandicus L.S.2.15]
 gi|227459573|gb|ACP38259.1| Radical SAM domain protein [Sulfolobus islandicus M.14.25]
 gi|228010013|gb|ACP45775.1| Radical SAM domain protein [Sulfolobus islandicus Y.G.57.14]
 gi|228012657|gb|ACP48418.1| Radical SAM domain protein [Sulfolobus islandicus Y.N.15.51]
 gi|228020098|gb|ACP55505.1| Radical SAM domain protein [Sulfolobus islandicus M.16.27]
 gi|238381019|gb|ACR42107.1| Radical SAM domain protein [Sulfolobus islandicus M.16.4]
 gi|284445876|gb|ADB87378.1| Radical SAM domain protein [Sulfolobus islandicus L.D.8.5]
 gi|323477585|gb|ADX82823.1| Radical SAM domain protein [Sulfolobus islandicus HVE10/4]
          Length = 208

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 67/229 (29%), Positives = 99/229 (43%), Gaps = 40/229 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y + EIF ++QGEG   G  + F R + CNL           +C +CDT +       
Sbjct: 1   MKYRVIEIFTSVQGEGEVIGTPSNFIRLATCNL-----------RCVWCDTKYSW---EI 46

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G    +D++   I+++        R   +TGGEPLLQ  VPL + L   G +I +ETNGT
Sbjct: 47  GTEMTIDEIIAKIDKKI-------RTTTITGGEPLLQNVVPLAKELKSIGHKIVIETNGT 99

Query: 122 IEPPQG----IDWICVSPK---AGCDLKIKGGQEL----KLVFPQVNVSPENYIGF---- 166
           I+P +     ID   VSPK   +G  LK     +     K V    N   +  I F    
Sbjct: 100 IKPSEELRKIIDVFSVSPKLSNSGHKLKYDFSDDWATYYKFVIVYPNKDIDEVIKFVESQ 159

Query: 167 --DFERFSLQP-MDGPFLEENTNLAISYCFQN-PKWRLSVQTHKFIGIR 211
             +  +  LQP  +        N  +        ++R+  Q H+ IG+R
Sbjct: 160 NINPRKVILQPDGNRSDYINAINEIVQIVLDRGLQFRVLPQLHRIIGVR 208


>gi|294055328|ref|YP_003548986.1| Radical SAM domain protein [Coraliomargarita akajimensis DSM 45221]
 gi|293614661|gb|ADE54816.1| Radical SAM domain protein [Coraliomargarita akajimensis DSM 45221]
          Length = 226

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 51/213 (23%), Positives = 77/213 (36%), Gaps = 22/213 (10%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           K   + E F + QGEG HAGR A F R  GC +            C +CD+         
Sbjct: 3   KQLPVHEQFYSFQGEGCHAGRAAYFIRLFGCPV-----------HCPWCDSAGTWHPDYV 51

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
               +     DL+     T      + V+TGGEP +     L   L + G+ + +ET+G 
Sbjct: 52  PESIDRVLANDLLASVQKTA---AEFVVITGGEPAIHDLSELTAVLRRAGYPVHLETSGA 108

Query: 122 IEPPQGIDWICVSPKAGC---DLKIKGGQELKLVFPQVNVSPENYIG---FDFERFSLQP 175
            E     DW+ +SPK         +K   E KL+  ++    E              L P
Sbjct: 109 FELKGVFDWVTLSPKRWKLPLPENLKRADEFKLIVDELGAIEEYARLPGVLRSVPVWLHP 168

Query: 176 MD-GPFLEENTNLAISYCFQN-PKWRLSVQTHK 206
                  +   +    +   +   +R   Q HK
Sbjct: 169 EWSQQRNQAILSAITEWVKAHGAPFRAGWQMHK 201


>gi|254804413|ref|YP_003082634.1| hypothetical protein NMO_0411 [Neisseria meningitidis alpha14]
 gi|254667955|emb|CBA04204.1| conserved hypothetical protein [Neisseria meningitidis alpha14]
          Length = 212

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 63/221 (28%), Positives = 93/221 (42%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++       G
Sbjct: 13  YRIVEIFESLQGEGWNTGMPAVFVRLGKCNLACG-----------WCDTDYLTF-----G 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
             ++  +               R  ++TGGEP +Q  + + +  L   G+ + +ETNG  
Sbjct: 57  MMSLSDI------LGCLKTYAARNIIITGGEPTIQPHLDMLLDMLKAEGYFLCIETNGLN 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQVNVSPENYI--GFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     V+    +        + L P
Sbjct: 111 PAPPQIDYVATSPKACYAAKYEKSCIETADEVRIVADGDVVAFCENMERKIRAHHYYLSP 170

Query: 176 MDGPFLEE--NTNLAISYCFQNP----KWRLSVQTHKFIGI 210
            +        +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQNGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGI 211


>gi|325283487|ref|YP_004256028.1| Radical SAM domain-containing protein [Deinococcus proteolyticus
           MRP]
 gi|324315296|gb|ADY26411.1| Radical SAM domain protein [Deinococcus proteolyticus MRP]
          Length = 285

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 51/216 (23%), Positives = 74/216 (34%), Gaps = 23/216 (10%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            Y + E F T QGEG H GR A F R  GC              C +CD+        + 
Sbjct: 57  KYPVYERFYTWQGEGVHLGRAAYFIRLYGCP-----------QHCPWCDSAGTWHPEYRP 105

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTI 122
               +     L +             ++TGGEP+L    PL  AL+  G  + +ET+G  
Sbjct: 106 ESVGLMDAQALADAVAAESPAGAV-VIITGGEPILFDLAPLTDALHAIGRRVHIETSGIA 164

Query: 123 EPPQGIDWICVSPKAGCDLKIK----GGQELKLVFPQVNVSPENYIGF----DFERFSLQ 174
                +DW+ +SPK      +        E+K++  +               D     L 
Sbjct: 165 PLRGELDWVTLSPKPTQKWPLPEVVAHADEVKIIVHEPQDIAAGLATLDGLRDDAVIWLH 224

Query: 175 PMDGPFLEENT---NLAISYCFQNPKWRLSVQTHKF 207
           P      E      N        +P+ R   Q HK 
Sbjct: 225 PEWSRAREREMRVLNAITEAVKADPRLRAGYQMHKL 260


>gi|254482513|ref|ZP_05095752.1| radical SAM domain protein, putative [marine gamma proteobacterium
           HTCC2148]
 gi|214037204|gb|EEB77872.1| radical SAM domain protein, putative [marine gamma proteobacterium
           HTCC2148]
          Length = 222

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 50/226 (22%), Positives = 85/226 (37%), Gaps = 43/226 (19%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             I EIF +LQGE    G   VF R +GC L           +C +CDT++     + G 
Sbjct: 12  LRITEIFYSLQGEARTVGVPTVFVRLTGCPL-----------RCVYCDTEYAF---SGGD 57

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNGTI 122
            +++D +   +         + R+  +TGGEPL Q + + L+  L   G+E+++ET+G +
Sbjct: 58  LFSIDDVVSRVAA------YQPRFVTVTGGEPLAQPNCLLLLTRLCDAGYEVSLETSGAM 111

Query: 123 EPPQGIDWICV--------SPKAGCDLKIKGG-----QELKLVFPQVNVSPENYIGFDFE 169
              +    +          S + G +            ++K V    +         D  
Sbjct: 112 TVAEVDSRVVKVIDLKTPASAEMGRNDYDNIPLLLPDDQVKFVICDRDDYEWARFKLDEY 171

Query: 170 RF-------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +           P  G        LA      N   R+ +Q HK +
Sbjct: 172 QLPARVSDVLFSPSHGQLS--GRELAEWVLEDNLPVRMQLQLHKIL 215


>gi|193215257|ref|YP_001996456.1| radical SAM domain-containing protein [Chloroherpeton thalassium
           ATCC 35110]
 gi|193088734|gb|ACF14009.1| Radical SAM domain protein [Chloroherpeton thalassium ATCC 35110]
          Length = 219

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 56/233 (24%), Positives = 90/233 (38%), Gaps = 49/233 (21%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + EIF ++QGE   AG   VF R SGC+L           +C +CDT +       G
Sbjct: 1   MLKVNEIFHSIQGESSKAGWPCVFIRLSGCDL-----------RCSYCDTGYAFFD---G 46

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDV-PLIQALNKRGFEIAVETNGT 121
             ++ +++ + +         + R   +TGGEPLLQ +V PL+ AL + G+E+ +ET G 
Sbjct: 47  KEFSQEEILEQV------AFYKTRLVEITGGEPLLQPNVYPLMTALCEAGYEVLLETGGH 100

Query: 122 IEPP-------QGIDWICVSPKAGCDLKIKGGQ-------------ELKLV------FPQ 155
            +         + ID    S +       +  +             E K+V      +  
Sbjct: 101 HDVEKVDPRVYKIIDIKTPSSEMSEWNCYRNLELSIAEAKSGVLKTEFKIVLSSEGDYRW 160

Query: 156 VNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                E Y    F         G        +A      +   RL +Q HK+I
Sbjct: 161 AKNLIERYDLARFVPVIFSAAFGALHPR--QIAEWILADHLPVRLQLQLHKYI 211


>gi|88705614|ref|ZP_01103324.1| radical activating enzyme [Congregibacter litoralis KT71]
 gi|88700127|gb|EAQ97236.1| radical activating enzyme [Congregibacter litoralis KT71]
          Length = 226

 Score =  145 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 50/227 (22%), Positives = 80/227 (35%), Gaps = 43/227 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIF +LQGE    G   VF R +GC L           +C +CDT++       G
Sbjct: 15  TLRITEIFYSLQGEARTVGLPTVFVRLTGCPL-----------RCLYCDTEYAFH---GG 60

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNGT 121
              +++ +AD +            Y  +TGGEPL Q + +PL+  L  +G+E+++ET+G 
Sbjct: 61  EIMSLEHIADQVAAHKPA------YVTVTGGEPLAQPNCLPLLSRLCDQGYEVSLETSGA 114

Query: 122 IEPPQGIDWICVSP-------------KAGCDLKIKGGQELKLVFPQVNVSPENYIGFDF 168
           +        +                   G    +    ++K V              D 
Sbjct: 115 MSVAGVDPRVVKVLDLKTPASGEVARNDYGNVQYLTPNDQVKFVICDRGDYEWARFKLDE 174

Query: 169 ERF-------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                        P           LA        + RL +Q HK++
Sbjct: 175 YTLGDRVSDVLFSPSHEQLAPR--ELAEWILGDGLQVRLQLQLHKYL 219


>gi|304388249|ref|ZP_07370369.1| radical SAM domain protein [Neisseria meningitidis ATCC 13091]
 gi|304337776|gb|EFM03925.1| radical SAM domain protein [Neisseria meningitidis ATCC 13091]
          Length = 212

 Score =  145 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 65/221 (29%), Positives = 92/221 (41%), Gaps = 36/221 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           Y I EIF +LQGEG + G  AVF R   CNL  G           +CDTD++       G
Sbjct: 13  YRIVEIFESLQGEGWNTGMPAVFVRLGKCNLACG-----------WCDTDYLTF-----G 56

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
             ++  +               R  ++TGGEP +Q  + + +  L   G+ + +ETNG  
Sbjct: 57  MMSLSDI------LGCLKTYAARNIIITGGEPTIQPHLDMLLDTLKAEGYFLCLETNGLN 110

Query: 123 EPPQGIDWICVSPKAGCDLKIKGG-----QELKLVFPQ--VNVSPENYIGFDFERFSLQP 175
             P  ID++  SPKA    K +        E+++V     V              + L P
Sbjct: 111 PAPPQIDYVATSPKACYAAKYEKSCIAEADEVRIVADGDVVGFCENMERKIRAHHYYLSP 170

Query: 176 M--DGPFLEENTNLAISYCFQNP----KWRLSVQTHKFIGI 210
              DG     +T   I      P     W+LSVQTHK+ GI
Sbjct: 171 CEQDGAMNIYDTIRQIGILNSRPDASVHWQLSVQTHKWAGI 211


>gi|119896705|ref|YP_931918.1| putative radical activating enzyme [Azoarcus sp. BH72]
 gi|119669118|emb|CAL93031.1| conserved hypothetical radical activating enzyme [Azoarcus sp.
           BH72]
          Length = 220

 Score =  145 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 79/226 (34%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              + EIF ++QGE    G    F R +GC L           +C +CDT +       G
Sbjct: 10  KLRLTEIFASIQGESTRVGLPTTFVRLTGCPL-----------RCSWCDTAYAFT---GG 55

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNGT 121
               +  + D +    +      R+  +TGGEPL Q   + L+ AL   G+ +++ET+G 
Sbjct: 56  EARALSDVLDDVAALGL------RHVCVTGGEPLAQKYCLALLTALCDAGYSVSLETSGA 109

Query: 122 IEPPQGIDWICVSP-------------KAGCDLKIKGGQELKLV------FPQVNVSPEN 162
           ++       +                 +      ++   ELK+V      +        +
Sbjct: 110 LDIGGVDPRVSRVMDLKAPGSAEVTRNRLENIPLLRARDELKIVLADQADYDWARAMIAD 169

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +         L P+ G        LA          R  +Q HK +
Sbjct: 170 HDLAARCPVLLSPVAGTLDPA--QLAEWIVRDRLPVRFQLQLHKIL 213


>gi|91776688|ref|YP_546444.1| radical SAM family protein [Methylobacillus flagellatus KT]
 gi|91710675|gb|ABE50603.1| Radical SAM [Methylobacillus flagellatus KT]
          Length = 212

 Score =  145 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 51/227 (22%), Positives = 80/227 (35%), Gaps = 43/227 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGE    G   VF R +GC             +C +CDT++    G+  
Sbjct: 1   MLRIHEIFHSLQGESSRVGLPTVFVRLTGCP-----------MRCVYCDTEYAFKGGSN- 48

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV--DVPLIQALNKRGFEIAVETNG 120
               +DQ+ + +           RY  +TGGEPL Q    + L++ L   G+E+++ET G
Sbjct: 49  --MTLDQIMEQV------ASYGARYVCVTGGEPLAQKKHCLELLRQLCDAGYEVSLETGG 100

Query: 121 TIEPPQGI-------DWICVSPKAGCDLKI------KGGQELKLV------FPQVNVSPE 161
            I             D                    K   E+K+V      +        
Sbjct: 101 AIATDGVDERVAIILDIKTPDSGEVAKNHWDNLSRLKPNDEVKIVLCSRADYEWAKQLLA 160

Query: 162 NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
            +   +       P+       +  LA          R+ VQ HK +
Sbjct: 161 EHALNEKCAVIFSPVYSQVKPAD--LADWVLEDRLPVRMQVQLHKIL 205


>gi|114330319|ref|YP_746541.1| radical SAM domain-containing protein [Nitrosomonas eutropha C91]
 gi|114307333|gb|ABI58576.1| Radical SAM domain protein [Nitrosomonas eutropha C91]
          Length = 211

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 49/226 (21%), Positives = 83/226 (36%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + EIF +LQGE    G   VF R +GC L           +C +CDT +     + G
Sbjct: 1   MLRVTEIFYSLQGETSRMGLPTVFIRLTGCPL-----------RCGYCDTSYAF---SGG 46

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPL-LQVDVPLIQALNKRGFEIAVETNGT 121
              ++ ++   +            Y  +TGGEPL     + L+ AL  RG+ +++ET+G 
Sbjct: 47  ESMDISEIMRKV------ASFSPHYVTVTGGEPLAQADSLTLLTALCDRGYSVSLETSGA 100

Query: 122 IEPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQV---NVSPENYIG 165
           ++  +    +       +P +G   K             E+K V       N + +  + 
Sbjct: 101 LDISRVDTRVSRILDIKTPGSGEMEKNYWNNLDCLTAHDEIKFVLCDRTDYNWAMQKLLT 160

Query: 166 FDFERFS---LQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
            +          P+          LA          RL  Q HK +
Sbjct: 161 LELANICPVLFSPVYNQLDPAA--LAAWILQDRLPVRLQFQLHKLL 204


>gi|30248245|ref|NP_840315.1| radical activating enzyme [Nitrosomonas europaea ATCC 19718]
 gi|30180130|emb|CAD84132.1| Radical activating enzymes [Nitrosomonas europaea ATCC 19718]
          Length = 211

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 52/226 (23%), Positives = 88/226 (38%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF +LQGE    G   VF R +GC L           +C +CDT +     + G
Sbjct: 1   MLRITEIFYSLQGETSRMGLPTVFVRLTGCPL-----------RCGYCDTGYAF---SGG 46

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGT 121
              ++ ++   +           RY  +TGGEPL Q D  + + AL  RG+ +++ET+G 
Sbjct: 47  KSMSISEIMGEV------ASFSPRYVTVTGGEPLAQADSLVLLAALCDRGYSVSLETSGA 100

Query: 122 IEPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQV---NVSPENYIG 165
           ++  +    +       +P +G   K             E+K V       + + +  + 
Sbjct: 101 LDIARVDARVSRIVDIKTPGSGEVEKNHWNNLAYLTSHDEIKFVLCDRADYDWARQKLLE 160

Query: 166 FDFERFS---LQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
              +        P  G  +  +  LA          RL +Q HK +
Sbjct: 161 LKLDVICPVLFSPAYGQLVPAD--LAAWILQDQLPVRLQLQLHKLL 204


>gi|257454238|ref|ZP_05619508.1| radical SAM domain protein [Enhydrobacter aerosaccus SK60]
 gi|257448411|gb|EEV23384.1| radical SAM domain protein [Enhydrobacter aerosaccus SK60]
          Length = 240

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 50/232 (21%), Positives = 85/232 (36%), Gaps = 47/232 (20%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + EIF +LQGE   AG   +F R +GC L           +C +CDT++  +    G 
Sbjct: 22  LKVTEIFYSLQGEALSAGLPTIFIRLTGCPL-----------RCVYCDTEYAFV---GGE 67

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNG-- 120
           R ++  +  + +          +   LTGGEPL Q + + L+  L   G+EI++ET+G  
Sbjct: 68  RMSLAGILAVCQ------SFPCQRICLTGGEPLAQPNAIALMNLLLAHGYEISLETSGAL 121

Query: 121 -----TIEPPQGIDWICVSPKAGCDLKIKG------GQELKLVFPQVN-------VSPEN 162
                     + +D    S +       +         ++K V    +       +  + 
Sbjct: 122 SVAEVPTAVSKVMDIKTPSSQEADKNLWQNIPYLTAHDQIKFVIMNRDDYDWSKQILADY 181

Query: 163 YIGFDFERFSLQPMDGPFLEE------NTNLAISYCFQNPKWRLSVQTHKFI 208
            +          PM      +       T+LA          R  +Q HK I
Sbjct: 182 QLDKKVATVWFSPMFNVEERQANVPTLATDLAEWILADALPVRFQLQLHKII 233


>gi|304312904|ref|YP_003812502.1| Putative radical activating enzyme [gamma proteobacterium HdN1]
 gi|301798637|emb|CBL46869.1| Putative radical activating enzyme [gamma proteobacterium HdN1]
          Length = 218

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 53/226 (23%), Positives = 92/226 (40%), Gaps = 43/226 (19%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             I EIF +LQGE    G   VF R +GC L           +C++CDT +     + G 
Sbjct: 8   LRITEIFHSLQGETRTLGLPTVFVRLTGCPL-----------RCQYCDTAYAF---SGGQ 53

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNGTI 122
           + +++Q+ + +            Y  +TGGEPL Q + +PL+QAL  +G+E+++ET+G +
Sbjct: 54  QMSLEQILETV------AGFRTHYVTVTGGEPLAQPNCIPLLQALCDQGYEVSLETSGAL 107

Query: 123 EPPQGIDWI--CVSPKAGCDLKIKG-----------GQELKLVF---PQVNVSPENYIGF 166
           +  +    +   V  K     ++               ++K V       + +    + +
Sbjct: 108 DISEIDARVVRVVDLKTPGSGEMHRNLYENIKYLQPHDQVKFVLCSRQDYDWARAKLLEY 167

Query: 167 DFER----FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           D           P  G    + T LA          R  +Q HK +
Sbjct: 168 DLCNRVSDVLFSPSWGQL--DATELAEWILADRLPVRFQMQLHKLL 211


>gi|107100431|ref|ZP_01364349.1| hypothetical protein PaerPA_01001456 [Pseudomonas aeruginosa PACS2]
          Length = 215

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 52/228 (22%), Positives = 86/228 (37%), Gaps = 43/228 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           +   I EIF +LQGE   AG   VF R +GC L           +C +CDT +     + 
Sbjct: 3   QTLRITEIFYSLQGETRTAGLPTVFVRLTGCPL-----------RCHYCDTAYAF---SG 48

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNG 120
           G   ++D + + +           RY  +TGGEPL Q + + L++ L   G+E+++ET+G
Sbjct: 49  GDVVSLDAIFERVAAYKP------RYICVTGGEPLAQPNCISLLERLCDAGYEVSLETSG 102

Query: 121 TIEPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQVNVSPENYIGFD 167
            ++  +    +       +P +G   + +           ++K V               
Sbjct: 103 ALDVSRIDPRVSKVLDLKTPGSGEVGRNRYENIPLLTDNDQVKFVVCSREDYDWAVSKLI 162

Query: 168 FERF-------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
             R           P           LA      N   RL +Q HK +
Sbjct: 163 EYRLDQRAGEVLFSPSHHQVSAR--ELADWIVADNLPVRLQLQLHKIL 208


>gi|284048974|ref|YP_003399313.1| Radical SAM domain protein [Acidaminococcus fermentans DSM 20731]
 gi|283953195|gb|ADB47998.1| Radical SAM domain protein [Acidaminococcus fermentans DSM 20731]
          Length = 218

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 54/230 (23%), Positives = 96/230 (41%), Gaps = 42/230 (18%)

Query: 1   MKL--YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQ 58
           MK   + + E+F +++GEG   G +AVF RF+GCNL           +C +CDT +    
Sbjct: 1   MKTETFPVVELFDSIEGEGKRTGAMAVFVRFAGCNL-----------RCSYCDTGYALEP 49

Query: 59  GTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVET 118
                    + L   I           +   LTGGEPLLQ    L + L++ G+E+ +ET
Sbjct: 50  ADAREHLTEEDLMGRIRR------YPWKKVTLTGGEPLLQPLDSLCRTLSREGYEVNIET 103

Query: 119 NGTIEPPQG------IDWICVSPKAGCDLKIK--------GGQELKLVF-PQVNVSPENY 163
           NG +   +             SP +G   +++        G   +K V   + ++   + 
Sbjct: 104 NGAVPLLEERPRGLFYTMDVKSPSSGMRGRMRMENLTRLTGEDVVKFVVGSREDLEDMDR 163

Query: 164 IGFDFE---RFSLQPMDGPFLEENTNLAISYCFQNP--KWRLSVQTHKFI 208
           +  ++    +  + P+ G          + +  ++   + R+ VQ HK I
Sbjct: 164 VLREYTLRSQVYVSPVYGAIEPR---ELVEFVREHKLAQVRVQVQLHKII 210


>gi|253997441|ref|YP_003049505.1| Radical SAM domain-containing protein [Methylotenera mobilis JLW8]
 gi|253984120|gb|ACT48978.1| Radical SAM domain protein [Methylotenera mobilis JLW8]
          Length = 212

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 51/227 (22%), Positives = 80/227 (35%), Gaps = 42/227 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               I EIF +LQGE    G   VF R +GC             +C +CDT +    G+ 
Sbjct: 1   MKLKIHEIFYSLQGESSRVGLPTVFVRLTGCP-----------MRCVYCDTAYAFSGGSN 49

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNG 120
                  ++ D+I +     E    Y  +TGGEPL Q D  + ++AL  +G+ +++ET G
Sbjct: 50  ------MEVEDIITK---VAEYATPYVTVTGGEPLAQKDCHVLLKALCDQGYSVSLETGG 100

Query: 121 TIEPPQGIDWICVSPKA-------------GCDLKIKGGQELKLV------FPQVNVSPE 161
            I+       + V                 G    +K   E+K V      +        
Sbjct: 101 AIDIAPVDPRVSVILDVKTPDSGELKNNLWGNLAHLKKADEVKFVLCSRADYEWAKDFLA 160

Query: 162 NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                        P+       +  LA          R+ +Q HK +
Sbjct: 161 KEQLTAKCSVLFSPVYSQLAPAD--LADWVLADKLPVRMQLQLHKIL 205


>gi|218893054|ref|YP_002441923.1| putative radical activating enzyme [Pseudomonas aeruginosa LESB58]
 gi|218773282|emb|CAW29094.1| probable radical activating enzyme [Pseudomonas aeruginosa LESB58]
          Length = 264

 Score =  144 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 52/228 (22%), Positives = 86/228 (37%), Gaps = 43/228 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           +   I EIF +LQGE   AG   VF R +GC L           +C +CDT +     + 
Sbjct: 52  QTLRITEIFYSLQGETRTAGLPTVFVRLTGCPL-----------RCHYCDTAYAF---SG 97

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNG 120
           G   ++D + + +           RY  +TGGEPL Q + + L++ L   G+E+++ET+G
Sbjct: 98  GDVVSLDAIFERVAAYKP------RYICVTGGEPLAQPNCISLLERLCDAGYEVSLETSG 151

Query: 121 TIEPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQVNVSPENYIGFD 167
            ++  +    +       +P +G   + +           ++K V               
Sbjct: 152 ALDVSRVDPRVSKVLDLKTPGSGEVGRNRYENIPLLTDNDQVKFVVCSREDYDWAVSKLI 211

Query: 168 FERF-------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
             R           P           LA      N   RL +Q HK +
Sbjct: 212 EYRLDQRAGEVLFSPSHHQVSAR--ELADWIVADNLPVRLQLQLHKIL 257


>gi|254239323|ref|ZP_04932646.1| hypothetical protein PACG_05520 [Pseudomonas aeruginosa C3719]
 gi|126171254|gb|EAZ56765.1| hypothetical protein PACG_05520 [Pseudomonas aeruginosa C3719]
          Length = 264

 Score =  144 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 52/228 (22%), Positives = 86/228 (37%), Gaps = 43/228 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           +   I EIF +LQGE   AG   VF R +GC L           +C +CDT +     + 
Sbjct: 52  QTLRITEIFYSLQGETRTAGLPTVFVRLTGCPL-----------RCHYCDTAYAF---SG 97

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNG 120
           G   ++D + + +           RY  +TGGEPL Q + + L++ L   G+E+++ET+G
Sbjct: 98  GDVVSLDAIFERVAAYKP------RYICVTGGEPLAQPNCISLLERLCDAGYEVSLETSG 151

Query: 121 TIEPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQVNVSPENYIGFD 167
            ++  +    +       +P +G   + +           ++K V               
Sbjct: 152 ALDVSRVDPRVSKVLDLKTPGSGEVGRNRYENIPLLTDNDQVKFVVCSREDYDWAVSKLI 211

Query: 168 FERF-------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
             R           P           LA      N   RL +Q HK +
Sbjct: 212 EYRLDQRAGEVLFSPSHHQVSAR--ELADWIVADNLPVRLQLQLHKIL 257


>gi|49082982|gb|AAT50891.1| PA0975 [synthetic construct]
          Length = 265

 Score =  144 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 52/228 (22%), Positives = 86/228 (37%), Gaps = 43/228 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           +   I EIF +LQGE   AG   VF R +GC L           +C +CDT +     + 
Sbjct: 52  QTLRITEIFYSLQGETRTAGLPTVFVRLTGCPL-----------RCHYCDTAYAF---SG 97

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNG 120
           G   ++D + + +           RY  +TGGEPL Q + + L++ L   G+E+++ET+G
Sbjct: 98  GDVVSLDAIFERVAAYKP------RYICVTGGEPLAQPNCISLLERLCDAGYEVSLETSG 151

Query: 121 TIEPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQVNVSPENYIGFD 167
            ++  +    +       +P +G   + +           ++K V               
Sbjct: 152 ALDVSRVDPRVSKVLDLKTPGSGEVGRNRYENIPLLTDNDQVKFVVCSREDYDWAVSKLI 211

Query: 168 FERF-------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
             R           P           LA      N   RL +Q HK +
Sbjct: 212 EYRLDQRAGEVLFSPSHHQVSAR--ELADWIVADNLPVRLQLQLHKIL 257


>gi|15596172|ref|NP_249666.1| radical activating enzyme [Pseudomonas aeruginosa PAO1]
 gi|254245258|ref|ZP_04938580.1| hypothetical protein PA2G_06150 [Pseudomonas aeruginosa 2192]
 gi|9946883|gb|AAG04364.1|AE004531_1 probable radical activating enzyme [Pseudomonas aeruginosa PAO1]
 gi|126198636|gb|EAZ62699.1| hypothetical protein PA2G_06150 [Pseudomonas aeruginosa 2192]
          Length = 264

 Score =  144 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 52/228 (22%), Positives = 86/228 (37%), Gaps = 43/228 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           +   I EIF +LQGE   AG   VF R +GC L           +C +CDT +     + 
Sbjct: 52  QTLRITEIFYSLQGETRTAGLPTVFVRLTGCPL-----------RCHYCDTAYAF---SG 97

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNG 120
           G   ++D + + +           RY  +TGGEPL Q + + L++ L   G+E+++ET+G
Sbjct: 98  GDVVSLDAIFERVAAYKP------RYICVTGGEPLAQPNCISLLERLCDAGYEVSLETSG 151

Query: 121 TIEPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQVNVSPENYIGFD 167
            ++  +    +       +P +G   + +           ++K V               
Sbjct: 152 ALDVSRVDPRVSKVLDLKTPGSGEVGRNRYENIPLLTDNDQVKFVVCSREDYDWAVSKLI 211

Query: 168 FERF-------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
             R           P           LA      N   RL +Q HK +
Sbjct: 212 EYRLDQRAGEVLFSPSHHQVSAR--ELADWIVADNLPVRLQLQLHKIL 257


>gi|188990578|ref|YP_001902588.1| Putative radical activating enzyme [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167732338|emb|CAP50530.1| Putative radical activating enzyme [Xanthomonas campestris pv.
           campestris]
          Length = 227

 Score =  144 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 52/226 (23%), Positives = 82/226 (36%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIFL+LQGE   AG   VF R +GC L           +C +CDT +       G
Sbjct: 17  RLKITEIFLSLQGEAEAAGWPTVFVRLTGCPL-----------RCTYCDTAYAFH---GG 62

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNGT 121
             +++D +   +           R+  +TGGEPL Q   + L+  L   GF++++ET+G 
Sbjct: 63  EWHDIDAIVAEV------ASHGVRHVCVTGGEPLAQKRCLALLHKLCDAGFDVSLETSGA 116

Query: 122 IEPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQVNVSP------EN 162
           ++       +       +P +G D + +           ++K V                
Sbjct: 117 LDVSAVDARVSRVVDIKTPASGEDHRNRWDNLPLLTARDQIKFVICSRADYEWSRDVVAT 176

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                       P  G        LA       P  R  +Q HK +
Sbjct: 177 QALDRRCTVWFSPSKGQVSAR--ELADWIVADRPPVRFQMQLHKIL 220


>gi|312962750|ref|ZP_07777238.1| queuosine biosynthesis protein QueE [Pseudomonas fluorescens WH6]
 gi|311282967|gb|EFQ61560.1| queuosine biosynthesis protein QueE [Pseudomonas fluorescens WH6]
          Length = 218

 Score =  144 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 87/230 (37%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I E+F +LQGE   AG   VF R +GC L           +C++CD+ +    G
Sbjct: 4   MQDTLRITEVFYSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAFSGG 52

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
                  +  L D++E+       + RY  +TGGEPL Q + +PL++ L   G+E+++ET
Sbjct: 53  ------TIRTLDDILEQ---VAGYKPRYVCVTGGEPLAQPNAIPLLKQLCDAGYEVSLET 103

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIKG------GQELKLVFPQVNVSPENYIG 165
           +G ++       +           K     + +         ++K V    +        
Sbjct: 104 SGALDISAVDSRVSRVVDLKTPDSKEAHRNRYENIELLTPNDQVKFVICSRDDYDWATSK 163

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                           P           LA      N   RL +Q HK++
Sbjct: 164 LIQYGLERRAGEVLFSPSHHDLNAR--ELADWVVADNLPVRLQLQLHKYL 211


>gi|192361070|ref|YP_001983293.1| radical SAM domain-containing protein [Cellvibrio japonicus
           Ueda107]
 gi|190687235|gb|ACE84913.1| radical SAM domain protein [Cellvibrio japonicus Ueda107]
          Length = 252

 Score =  144 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 77/226 (34%), Gaps = 43/226 (19%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             I EIF +LQGE    G   VF R +GC L           +C +CD+++       G 
Sbjct: 42  LKITEIFYSLQGEARTVGLPTVFVRLTGCPL-----------RCGYCDSEYAFY---GGE 87

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPL-LQVDVPLIQALNKRGFEIAVETNGTI 122
           R ++D++   +           R+  +TGGEP+  +  V L++ L   G+ +++ET+G +
Sbjct: 88  RLSLDEILARVAR------YHPRHVCVTGGEPMAQRECVTLLKMLCDAGYGVSLETSGAM 141

Query: 123 EPPQGIDWI-------CVSPKAGCDLKIKG------GQELKLVFPQVNVSPENYIGFDFE 169
                   +                 + +         ++K V              D  
Sbjct: 142 PLEDVDPRVSKVMDLKTPGSGEVGRNRWENIPLLGEQDQVKFVICNREDYEWARFKLDEY 201

Query: 170 RF-------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                       P  G        LA      N   R  +Q HK +
Sbjct: 202 ELASRAGEVLFSPSHGQVKP--VELAEWILADNLPVRFQLQLHKLL 245


>gi|194366888|ref|YP_002029498.1| Radical SAM domain-containing protein [Stenotrophomonas maltophilia
           R551-3]
 gi|194349692|gb|ACF52815.1| Radical SAM domain protein [Stenotrophomonas maltophilia R551-3]
          Length = 233

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 50/226 (22%), Positives = 80/226 (35%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIF +LQGE   AG   VF R +GC L           +C++CDT +    GT  
Sbjct: 23  RLKITEIFTSLQGEADTAGWPTVFVRLTGCPL-----------RCQYCDTAYAFHGGTW- 70

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGT 121
             +++D +   +  Q        R+  +TGGEPL Q    + +Q L   G ++++ET+G 
Sbjct: 71  --WDIDDIVAEVLAQ------GVRHVCVTGGEPLAQKRCLVLLQKLCDAGMDVSLETSGA 122

Query: 122 IEPPQGIDWIC--VSPKAGCD-----------LKIKGGQELKLV------FPQVNVSPEN 162
           ++       +   V  K                 +    ++K V      +         
Sbjct: 123 LDVSAVDPRVSRVVDIKTPGSAEAARNRLENLPLLTARDQIKFVICSREDYDWAKAMLAE 182

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +           P  G        LA          R  +Q HK +
Sbjct: 183 HDLVKRCTVFFSPSKGEITAR--QLADWIVEDRLPVRFQMQLHKIL 226


>gi|313105862|ref|ZP_07792125.1| putative radical activating enzyme [Pseudomonas aeruginosa 39016]
 gi|310878627|gb|EFQ37221.1| putative radical activating enzyme [Pseudomonas aeruginosa 39016]
          Length = 215

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 52/228 (22%), Positives = 88/228 (38%), Gaps = 43/228 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           +   I EIF +LQGE   AG   VF R +GC L           +C +CDT +     + 
Sbjct: 3   QTLRITEIFYSLQGETRTAGLPTVFVRLTGCPL-----------RCHYCDTAYAF---SG 48

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNG 120
           G   ++D + + +         + RY  +TGGEPL Q + + L++ L   G+E+++ET+G
Sbjct: 49  GDVVSLDAILERV------ATYKPRYICVTGGEPLAQPNCISLLERLCDAGYEVSLETSG 102

Query: 121 TIEPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQVNVSPENYIGFD 167
            ++  +    +       +P +G   + +           ++K V               
Sbjct: 103 ALDVSRVDPRVSKVLDLKTPGSGEVGRNRYENIPLLTDNDQVKFVVCSREDYDWAVSKLI 162

Query: 168 FERF-------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
             R           P    +      LA      N   RL +Q HK +
Sbjct: 163 EYRLDQRAGEVLFSP--SHYQVSARELADWIVADNLPVRLQLQLHKIL 208


>gi|254523566|ref|ZP_05135621.1| radical activating enzyme [Stenotrophomonas sp. SKA14]
 gi|219721157|gb|EED39682.1| radical activating enzyme [Stenotrophomonas sp. SKA14]
          Length = 233

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 48/226 (21%), Positives = 78/226 (34%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIF +LQGE   AG   VF R +GC L           +C++CDT +    GT  
Sbjct: 23  RLKITEIFTSLQGEADTAGWPTVFVRLTGCPL-----------RCQYCDTAYAFHGGTW- 70

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGT 121
             +++D +   +  Q        R+  +TGGEPL Q    + +Q L   G ++++ET+G 
Sbjct: 71  --WDIDDIVAEVLAQ------GVRHVCVTGGEPLAQKRCLVLLQKLCDAGMDVSLETSGA 122

Query: 122 IEPPQGID-------WICVSPKAGCDLKIKG------GQELKLV------FPQVNVSPEN 162
           ++                         + +         ++K V      +         
Sbjct: 123 LDVSAVDPRVSRVVDIKTPGSAEVARNRWENLPLLTARDQIKFVICSREDYDWAKALLAE 182

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +           P  G        LA          R  +Q HK +
Sbjct: 183 HELVKRCTVFFSPSKGEITAR--QLADWIVEDRLPVRFQMQLHKIL 226


>gi|74318221|ref|YP_315961.1| radical activating enzyme [Thiobacillus denitrificans ATCC 25259]
 gi|74057716|gb|AAZ98156.1| radical activating enzyme; radical SAM family [Thiobacillus
           denitrificans ATCC 25259]
          Length = 216

 Score =  144 bits (363), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 52/226 (23%), Positives = 81/226 (35%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIFL+LQGE    G   VF R +GC L           +CR+CDT +       G
Sbjct: 6   TLRITEIFLSLQGETSRTGLATVFVRLAGCPL-----------RCRWCDTTYSF---QGG 51

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNGT 121
              ++D++   +               +TGGEPL Q + +PL+  L   G+ +++ET+G 
Sbjct: 52  ETVSLDEVLARV------AGFGVSVVCVTGGEPLAQKNCLPLLARLCDAGYSVSLETSGA 105

Query: 122 IE----PPQGIDWICVSPKAGCDLKIKG---------GQELKLVFPQVNVSPENYIGFDF 168
           ++     P+    + V P    ++               E+K V                
Sbjct: 106 LDVSAVDPRVSRIVDVKPPESGEVARNRWENLAHLGAHDEIKFVLADRADYEWAREVLRE 165

Query: 169 ------ERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                       P+ G        LA          R+ VQ HK +
Sbjct: 166 RALERVCPVLFSPVQGELAPA--QLAEWILADRLPVRMQVQLHKLL 209


>gi|297539673|ref|YP_003675442.1| Radical SAM domain-containing protein [Methylotenera sp. 301]
 gi|297259020|gb|ADI30865.1| Radical SAM domain protein [Methylotenera sp. 301]
          Length = 212

 Score =  144 bits (363), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 47/227 (20%), Positives = 77/227 (33%), Gaps = 42/227 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               + EIF ++QGE    G   VF R +GC             +C +CDT +    G+ 
Sbjct: 1   MKLKVHEIFYSIQGESSRVGLPTVFVRLTGCP-----------MRCVYCDTAYAFSGGSN 49

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNG 120
                     ++ +      E   +Y  +TGGEPL Q D    ++ L   G+ +++ET G
Sbjct: 50  ---------IEIADILAKVAEFGTKYVTVTGGEPLAQKDCHFLLKDLCDAGYSVSLETGG 100

Query: 121 TIEPPQGIDWICVSPKA-------------GCDLKIKGGQELKLV------FPQVNVSPE 161
            I+       + V                      +K   E+K V      +        
Sbjct: 101 AIDISPVDKRVSVILDVKTPDSGELKNNVWSNLDHLKSSDEVKFVLCSREDYQWARDLLS 160

Query: 162 NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
            +   +       P+        T+LA          R+ VQ HK +
Sbjct: 161 THKIAEKCPVLFSPVYSQVSP--TDLAEWVLADKLPVRMQVQLHKIL 205


>gi|292572231|gb|ADE30146.1| Organic radical activating enzyme [Rickettsia prowazekii Rp22]
          Length = 225

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 66/226 (29%), Positives = 96/226 (42%), Gaps = 34/226 (15%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               ++ IF T+QGEG   G  ++F R  GCNL            C FCDT+F       
Sbjct: 16  TKLEVQSIFKTIQGEGIFVGYPSIFIRLGGCNL-----------ACNFCDTEF-----ED 59

Query: 62  GGRYNVDQLADLIEEQWITGE--KEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
               ++DQ+ + ++   +  +  K     V+TGGEP+ Q    L Q L  + F++ +ETN
Sbjct: 60  FKLIDIDQILNKVKNLSLNSKNAKTINLVVITGGEPMRQPIGLLCQKLLDQDFKVQIETN 119

Query: 120 GT-IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVN-----------VSPENYIGFD 167
           GT         +I  SPK G     K  ++L      V            + PE      
Sbjct: 120 GTLYRSLPKEVFIVCSPKVGKTGYNKIREDLLPQISAVKFIISKNIVEYSIIPEVGQSAY 179

Query: 168 FERFSLQPMDGPF---LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                +Q MD        EN  LA+    ++   RLS+QTHKF+GI
Sbjct: 180 DIPVFVQSMDQNDKRLNNENNELAVKLALES-GARLSLQTHKFLGI 224


>gi|54297969|ref|YP_124338.1| hypothetical protein lpp2024 [Legionella pneumophila str. Paris]
 gi|53751754|emb|CAH13176.1| hypothetical protein lpp2024 [Legionella pneumophila str. Paris]
          Length = 217

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 51/232 (21%), Positives = 83/232 (35%), Gaps = 46/232 (19%)

Query: 1   MKL----YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG 56
           MK       I EIF +LQGE    G   VF R +GC L           +C++CDT +  
Sbjct: 1   MKRFNEQLRITEIFHSLQGESVTVGLPTVFVRLTGCPL-----------RCQYCDTAYAF 49

Query: 57  IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIA 115
              + G    +D + + +         + ++  +TGGEPL Q   VPL+  L   G+ ++
Sbjct: 50  ---SGGEVVEIDDILNKV------ASYQCQHVCVTGGEPLAQPGCVPLLSKLCDAGYSVS 100

Query: 116 VETNGTIEPPQGIDWICVSPK-------------AGCDLKIKGGQELKLVFPQVNVSPE- 161
           +ET+G  +       + +                      +K   ++K V    N     
Sbjct: 101 LETSGARDIASVDQRVMIVMDLKTPDSKEADKNLLSNLNFLKPTDQIKFVLCSRNDYEWA 160

Query: 162 -----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                 Y   +  +    P         T+LA          R  +Q HK +
Sbjct: 161 CSMLSEYQLAERVQLLFSPSWNQLNP--TDLANWIIQDKLPVRFQLQLHKIL 210


>gi|15604457|ref|NP_220975.1| hypothetical protein RP607 [Rickettsia prowazekii str. Madrid E]
 gi|3861151|emb|CAA15051.1| unknown [Rickettsia prowazekii]
          Length = 234

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 66/226 (29%), Positives = 96/226 (42%), Gaps = 34/226 (15%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               ++ IF T+QGEG   G  ++F R  GCNL            C FCDT+F       
Sbjct: 25  TKLEVQSIFKTIQGEGIFVGYPSIFIRLGGCNL-----------ACNFCDTEF-----ED 68

Query: 62  GGRYNVDQLADLIEEQWITGE--KEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
               ++DQ+ + ++   +  +  K     V+TGGEP+ Q    L Q L  + F++ +ETN
Sbjct: 69  FKLIDIDQILNKVKNLSLNSKNAKTINLVVITGGEPMRQPIGLLCQKLLDQDFKVQIETN 128

Query: 120 GT-IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVN-----------VSPENYIGFD 167
           GT         +I  SPK G     K  ++L      V            + PE      
Sbjct: 129 GTLYRSLPKEVFIVCSPKVGKTGYNKIREDLLPQISAVKFIISKNIVEYSIIPEVGQSAY 188

Query: 168 FERFSLQPMDGPF---LEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                +Q MD        EN  LA+    ++   RLS+QTHKF+GI
Sbjct: 189 DIPVFVQSMDQNDKRLNNENNELAVKLALES-GARLSLQTHKFLGI 233


>gi|323474845|gb|ADX85451.1| organic radical activating enzyme, NrdG [Sulfolobus islandicus
           REY15A]
          Length = 208

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 67/229 (29%), Positives = 98/229 (42%), Gaps = 40/229 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y + EIF ++QGEG   G  + F R + CNL           +C +CDT +       
Sbjct: 1   MKYRVIEIFTSVQGEGEVIGTPSNFIRLATCNL-----------RCVWCDTKYSW---EI 46

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G    +D++   I+++        R   +TGGEPLLQ  VPL + L   G +I +ETNGT
Sbjct: 47  GTEMTIDEIIAKIDKKI-------RTTTITGGEPLLQNVVPLAKELKSIGHKIVIETNGT 99

Query: 122 IEPPQG----IDWICVSPK---AGCDLKIKGGQEL----KLVFPQVNVSPENYIGF---- 166
           I+P +     ID   VSPK   +G  LK     +     K V    N   +  I F    
Sbjct: 100 IKPSEELRKIIDVFSVSPKLSNSGHKLKYDFSDDWATYYKFVIVYPNKDIDEVIKFVESQ 159

Query: 167 --DFERFSLQP-MDGPFLEENTNLAISYCFQN-PKWRLSVQTHKFIGIR 211
             +  +  LQP  +        N  +         +R+  Q H+ IG+R
Sbjct: 160 NINPRKVILQPDGNRSDYINAINEIVQIVLDRGLLFRVLPQLHRIIGVR 208


>gi|116048900|ref|YP_792299.1| radical activating enzyme [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115584121|gb|ABJ10136.1| probable radical activating enzyme [Pseudomonas aeruginosa
           UCBPP-PA14]
          Length = 264

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 52/228 (22%), Positives = 87/228 (38%), Gaps = 43/228 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           +   I EIF +LQGE   AG   VF R +GC L           +C +CDT +     + 
Sbjct: 52  QTLRITEIFYSLQGETRTAGLPTVFVRLTGCPL-----------RCHYCDTAYAF---SG 97

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNG 120
           G   ++D + + +         + RY  +TGGEPL Q + + L++ L   G+E+++ET+G
Sbjct: 98  GDVVSLDAILERV------ATYKPRYICVTGGEPLAQPNCISLLERLCDAGYEVSLETSG 151

Query: 121 TIEPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQVNVSPENYIGFD 167
            ++  +    +       +P +G   + +           ++K V               
Sbjct: 152 ALDVSRVDPRVSKVLDLKTPGSGEVGRNRYENIPLLTDNDQVKFVVCSREDYDWAVSKLI 211

Query: 168 FERF-------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
             R           P           LA      N   RL +Q HK +
Sbjct: 212 EYRLDQRAGEVLFSPSHHQVSAR--ELADWIVADNLPVRLQLQLHKIL 257


>gi|296390666|ref|ZP_06880141.1| radical activating enzyme [Pseudomonas aeruginosa PAb1]
          Length = 215

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 52/228 (22%), Positives = 87/228 (38%), Gaps = 43/228 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           +   I EIF +LQGE   AG   VF R +GC L           +C +CDT +     + 
Sbjct: 3   QTLRITEIFYSLQGETRTAGLPTVFVRLTGCPL-----------RCHYCDTAYAF---SG 48

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNG 120
           G   ++D + + +         + RY  +TGGEPL Q + + L++ L   G+E+++ET+G
Sbjct: 49  GDVVSLDAILERV------ATYKPRYICVTGGEPLAQPNCISLLERLCDAGYEVSLETSG 102

Query: 121 TIEPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQVNVSPENYIGFD 167
            ++  +    +       +P +G   + +           ++K V               
Sbjct: 103 ALDVSRVDPRVSKVLDLKTPGSGEVGRNRYENIPLLTDNDQVKFVVCSREDYDWAVSKLI 162

Query: 168 FERF-------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
             R           P           LA      N   RL +Q HK +
Sbjct: 163 EYRLDQRAGEVLFSPSHHQVSAR--ELADWIVADNLPVRLQLQLHKIL 208


>gi|220935394|ref|YP_002514293.1| putative radical activating enzyme [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996704|gb|ACL73306.1| putative radical activating enzyme [Thioalkalivibrio sp. HL-EbGR7]
          Length = 227

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 77/226 (34%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIFL+LQGE    G   VF R +GC L           +C +CDT++       G
Sbjct: 17  RLRITEIFLSLQGESRSVGWPTVFVRLTGCPL-----------RCGYCDTEYAFT---GG 62

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPL-LQVDVPLIQALNKRGFEIAVETNGT 121
              +++ +   +            +  +TGGEPL  +  + L+  L   G+E+++ET+G 
Sbjct: 63  EWMSLEAVLAQV------ASHGVHHVTVTGGEPLAQRACLELLTRLCDAGYEVSLETSGA 116

Query: 122 IEPPQGIDWI-------CVSPKAGCDLKIKG------GQELKLVFPQVNVSP------EN 162
           ++       +         +       + +         ++K V                
Sbjct: 117 LDVAAVDPRVVKVMDLKTPASGEAGRNRYENLGYLSLKDQVKFVICDRADYEWARQTVAT 176

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +           P  G     +  LA          R  +Q HK +
Sbjct: 177 HDLTARCEVLFSPSYGQLAPRD--LADWIVADRLPVRFQLQLHKIL 220


>gi|15892856|ref|NP_360570.1| hypothetical protein RC0933 [Rickettsia conorii str. Malish 7]
 gi|34581434|ref|ZP_00142914.1| hypothetical protein [Rickettsia sibirica 246]
 gi|157828787|ref|YP_001495029.1| hypothetical protein A1G_05140 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933515|ref|YP_001650304.1| queuosine biosynthesis protein [Rickettsia rickettsii str. Iowa]
 gi|229586950|ref|YP_002845451.1| Organic radical activating enzyme [Rickettsia africae ESF-5]
 gi|15620043|gb|AAL03471.1| unknown [Rickettsia conorii str. Malish 7]
 gi|28262819|gb|EAA26323.1| unknown [Rickettsia sibirica 246]
 gi|157801268|gb|ABV76521.1| hypothetical protein A1G_05140 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908602|gb|ABY72898.1| queuosine biosynthesis protein [Rickettsia rickettsii str. Iowa]
 gi|228022000|gb|ACP53708.1| Organic radical activating enzyme [Rickettsia africae ESF-5]
          Length = 225

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 69/225 (30%), Positives = 97/225 (43%), Gaps = 36/225 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             ++ IF T+QGEG   G  A+F R  GCNL            C FCDT+F         
Sbjct: 18  LEVQSIFKTIQGEGIFVGCPAIFIRLGGCNL-----------ACNFCDTEF-----EDFD 61

Query: 64  RYNVDQLADLIEEQWIT--GEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG- 120
             ++D++ + +E   +    EK     V+TGGEP+ Q    L Q L  R  ++ +ETNG 
Sbjct: 62  LVDIDKILNKVESLALNSKNEKSINLVVITGGEPMRQPIELLCQKLLDRDVKVQIETNGT 121

Query: 121 -TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVN-----------VSPENYIGFDF 168
                P+ +  IC SPK G     K  ++L      V            + PE       
Sbjct: 122 LYRSLPKEVSIIC-SPKVGKTGYSKIREDLLPKISAVKFIVAKNILEYSLIPEVGQTSYN 180

Query: 169 ERFSLQPMDGPFLE---ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               +QPMD        EN  LA+    ++   RLS+QTHKF+ I
Sbjct: 181 IPVFIQPMDQNNQRLNGENNELAVKLALES-GARLSLQTHKFLNI 224


>gi|254787332|ref|YP_003074761.1| radical SAM domain-containing protein [Teredinibacter turnerae
           T7901]
 gi|237685298|gb|ACR12562.1| radical SAM domain protein [Teredinibacter turnerae T7901]
          Length = 214

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 81/227 (35%), Gaps = 43/227 (18%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M    I EIF +LQGE    G   VF R +GC L           +C++CD+++      
Sbjct: 1   MTDLRITEIFHSLQGEARTVGVPTVFVRLTGCPL-----------RCQYCDSEYAFF--- 46

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETN 119
            G + ++D++  L+            +  +TGGEPL Q + +PL++ L   G  +++ET+
Sbjct: 47  GGEKKSLDEIEALVI------GFRCSHVCVTGGEPLAQPNCIPLLERLCDAGLAVSLETS 100

Query: 120 GTIEPPQGIDWICVSPKAGCDLKIKGG-------------QELKLVFPQVNVSPENYIGF 166
           G ++       + +          +                ++K V    +         
Sbjct: 101 GAMDISAVDTRVSIVLDLKTPDSGERDKNLLSNIPLLAAKDQIKFVICSRSDYEWARFML 160

Query: 167 DFER-------FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHK 206
           D ++           P           LA          R  +Q HK
Sbjct: 161 DEQQLVGRVGDIFFSPSYTQLAPA--ELAQWILDDRLPVRFQMQLHK 205


>gi|148652703|ref|YP_001279796.1| radical SAM domain-containing protein [Psychrobacter sp. PRwf-1]
 gi|148571787|gb|ABQ93846.1| Radical SAM domain protein [Psychrobacter sp. PRwf-1]
          Length = 245

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 55/238 (23%), Positives = 80/238 (33%), Gaps = 53/238 (22%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + EIF +LQGE   AG   VF R +GC L           +C +CDT +       G 
Sbjct: 21  LRMTEIFYSLQGEALTAGLPTVFVRLTGCPL-----------RCVYCDTTYSFT---GGE 66

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNG-- 120
           R +++ +   I +         +   LTGGEPL Q + +PL+Q L   G+EI++ET G  
Sbjct: 67  RLSLEAIMADIAQ------YPCKRICLTGGEPLAQPNAIPLMQRLLDEGYEISLETAGAL 120

Query: 121 -----TIEPPQGIDWICVSPKAGCDLKIKG------GQELKLVFPQVNVSPENYIGFDFE 169
                     + +D    S                   +LK V    +    +       
Sbjct: 121 SVADVPAAVSKVMDIKTPSSGESDKNLWSNLEYLTQHDQLKFVIMNRSDYDWSKQKLAEY 180

Query: 170 RF-------SLQPMDGPFLEE------------NTNLAISYCFQNPKWRLSVQTHKFI 208
                       PM     +                LA          RL +Q HK I
Sbjct: 181 NLDKVVGTVWFSPMFNVHDDAQGDVAAVDVPNLARELAEWILADALPVRLQLQLHKII 238


>gi|190575559|ref|YP_001973404.1| putative radical SAM-superfamily protein [Stenotrophomonas
           maltophilia K279a]
 gi|190013481|emb|CAQ47116.1| putative radical SAM-superfamily protein [Stenotrophomonas
           maltophilia K279a]
          Length = 233

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 48/226 (21%), Positives = 78/226 (34%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIF +LQGE   AG   VF R +GC L           +C++CDT +    GT  
Sbjct: 23  RLKITEIFTSLQGEADTAGWPTVFVRLTGCPL-----------RCQYCDTAYAFHGGTW- 70

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGT 121
             +++D +   +  Q        R+  +TGGEPL Q    + +Q L   G ++++ET+G 
Sbjct: 71  --WDIDDIVAEVLAQ------GVRHVCVTGGEPLAQKRCLVLLQKLCDAGMDVSLETSGA 122

Query: 122 IEPPQGID-------WICVSPKAGCDLKIKG------GQELKLV------FPQVNVSPEN 162
           ++                         + +         ++K V      +         
Sbjct: 123 LDVSAVDPRVSRVVDIKTPGSAEAARNRWENLPLLTARDQIKFVICSRGDYDWAKALVAE 182

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +           P  G        LA          R  +Q HK +
Sbjct: 183 HELVKRCTVFFSPSKGEITAR--QLADWIVEDRLPVRFQMQLHKIL 226


>gi|118594347|ref|ZP_01551694.1| Radical SAM [Methylophilales bacterium HTCC2181]
 gi|118440125|gb|EAV46752.1| Radical SAM [Methylophilales bacterium HTCC2181]
          Length = 216

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 49/226 (21%), Positives = 80/226 (35%), Gaps = 42/226 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           +   I EIF +LQGE    G   +F R +GC             +C +CDT +   +G  
Sbjct: 5   QTLKINEIFYSLQGESSRIGLPTIFIRLTGCP-----------MRCNYCDTAYAFHEGKN 53

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPL-LQVDVPLIQALNKRGFEIAVETNG 120
               ++D + + I++       +  +  +TGGEPL  +    L+  L   G+ +++ET G
Sbjct: 54  ---LSIDAIIEEIKQ------YDTNFITVTGGEPLAQRNCYSLLDQLCSLGYNVSLETGG 104

Query: 121 TIEPPQGI-------DWICVSPKAGCDLKI------KGGQELKLVFPQVNVSPENYIGFD 167
            +   +         D          +         K   E+K+V         +     
Sbjct: 105 ALSINEVHENVKIILDIKTPGSGESENNHWDNLPLIKQKDEIKMVITNQEDYEWSKNIIQ 164

Query: 168 FERFSL------QPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKF 207
            +   L       P  G        LA      N K R+ VQ HK 
Sbjct: 165 EKGLYLNYDILFSPSFGQLEPS--QLADWILQDNLKVRMQVQLHKI 208


>gi|51473785|ref|YP_067542.1| hypothetical protein RT0595 [Rickettsia typhi str. Wilmington]
 gi|51460097|gb|AAU04060.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 231

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 64/226 (28%), Positives = 94/226 (41%), Gaps = 34/226 (15%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               ++ IF T+QGEG   G  ++F R  GCNL            C FCDT+F       
Sbjct: 22  TKLEVQSIFKTIQGEGIFVGYPSIFIRLGGCNL-----------ACNFCDTEF-----ED 65

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRY--CVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
               ++DQ+ + ++   +  +        V+TGGEP+ Q    L Q L  + F++ +ETN
Sbjct: 66  FELIDIDQIINKVQNLSLNSKNSKTINLVVITGGEPMRQPIGLLCQKLLDQDFKVQIETN 125

Query: 120 GT-IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVN-----------VSPENYIGFD 167
           GT         +I  SPK G     K  ++L      V            + PE      
Sbjct: 126 GTLYRSLPKGVFIVCSPKVGKTGYNKIREDLLPQVCAVKFIISKNIIEYSIIPEVGQSAY 185

Query: 168 FERFSLQPMDG---PFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                +Q MD        EN  LA+    ++   RLS+Q HKF+GI
Sbjct: 186 NIPVFVQSMDQNDKKLNAENNELAVKLALES-GARLSLQIHKFLGI 230


>gi|227498703|ref|ZP_03928847.1| radical SAM family protein [Acidaminococcus sp. D21]
 gi|226904159|gb|EEH90077.1| radical SAM family protein [Acidaminococcus sp. D21]
          Length = 222

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 53/230 (23%), Positives = 81/230 (35%), Gaps = 42/230 (18%)

Query: 1   MKL--YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQ 58
           MK   + + EIF ++ GEG   G +A F RF+GCNL           +C +CDT +    
Sbjct: 5   MKTERFPVVEIFDSIDGEGKRTGYMATFVRFAGCNL-----------RCSYCDTAYAWDA 53

Query: 59  GTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVET 118
                  + D L   I           +   LTGGEP+LQ    L + L   G+E+ +ET
Sbjct: 54  SQAKEWLSEDNLFQQITA------YPWKRVTLTGGEPMLQPIETLCRRLGDAGYEVNIET 107

Query: 119 NG--------TIEPPQGIDWICVSPKAGCDLKIKG------GQELKLVFPQVNVSPENYI 164
           NG               +D    S      ++ +          LK V   V        
Sbjct: 108 NGAAALFLERPDRLFYTMDIKSPSSGEKDRMRWENLSLLTADDVLKFVVGSVEDLRYMET 167

Query: 165 GFD----FERFSLQPMDGPFLEENTNLAISYCFQNP--KWRLSVQTHKFI 208
                    +  + P+ G          + +   +   +  + VQ HK I
Sbjct: 168 ILSTYSIKAQIYVSPVFGKIEPVAL---VDFVKHHQLSRVCVQVQLHKVI 214


>gi|213586502|ref|ZP_03368328.1| hypothetical protein SentesTyph_36610 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 170

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 51/180 (28%), Positives = 70/180 (38%), Gaps = 40/180 (22%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGI---- 57
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT         
Sbjct: 1   MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPV-----------GCAWCDTKHTWDKLSD 49

Query: 58  -------------QGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI 104
                        +  K G  + + L  +I  Q        R+ V+TGGEP +   +PL 
Sbjct: 50  REVSLFSILAKTKESDKWGAASSEDLLAVINRQG----YTARHVVITGGEPCIHDLMPLT 105

Query: 105 QALNKRGFEIAVETNGTIE-PPQGIDWICVSPKAGC-------DLKIKGGQELKLVFPQV 156
             L K GF   +ET+GT E       W+ VSPK             ++   E+K    +V
Sbjct: 106 DLLEKSGFSCQIETSGTHEVRCTPNTWVTVSPKVNMRGGYDVLSQALERANEIKHPVGRV 165


>gi|313202056|ref|YP_004040714.1| radical sam domain-containing protein [Methylovorus sp. MP688]
 gi|312441372|gb|ADQ85478.1| Radical SAM domain protein [Methylovorus sp. MP688]
          Length = 212

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 51/227 (22%), Positives = 75/227 (33%), Gaps = 42/227 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               I EIF +LQGE    G   VF R +GC             +C +CDT +       
Sbjct: 1   MKLRIHEIFHSLQGESSRVGLPTVFVRLTGCP-----------MRCVYCDTAYAFH---G 46

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPL-LQVDVPLIQALNKRGFEIAVETNG 120
           GG   +D +   + E          Y  +TGGEPL  +    L+  L   G+ +++ET G
Sbjct: 47  GGSMEIDDIMQKVAE------YGAHYVTVTGGEPLAQRDCHVLLTRLCDAGYSVSLETGG 100

Query: 121 TIEPPQGIDWICVSPK-------------AGCDLKIKGGQELKLVFPQVNVSPENYIGFD 167
            ++       + V                 G    +K   E+K V              D
Sbjct: 101 AMDIANVDPRVSVILDIKTPGSGELEKNLWGNLAHLKAQDEVKFVLCDHADYLWAKELLD 160

Query: 168 FERF------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
            +           P+        T LA          R+ VQ HK +
Sbjct: 161 KQPLHRTCSVLFSPVYSQVNP--TELAEWILADKLPVRMQVQLHKIL 205


>gi|330811384|ref|YP_004355846.1| Putative radical SAM-superfamily protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327379492|gb|AEA70842.1| Putative radical SAM-superfamily protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 215

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 53/230 (23%), Positives = 87/230 (37%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I E+F +LQGE   AG   VF R +GC L           +C++CD+ +    G
Sbjct: 1   MQDTLRITEVFYSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAFSGG 49

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
                  +  L D++E+         RY  +TGGEPL Q + +PL++ L   G+E+++ET
Sbjct: 50  ------TLRTLDDILEQ---VASYRPRYVCVTGGEPLAQPNAIPLLKQLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIKG------GQELKLVFPQVNVSPENYIG 165
           +G ++       +           K     + +         ++K V             
Sbjct: 101 SGALDISAVDPRVSRVVDLKTPGSKEAHRNRYENIELLTPNDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                         L P        +  LA      N   RL +Q HK++
Sbjct: 161 LIQYGLDQRAGEVLLSPSHHDLSARD--LADWVVADNLPVRLQLQLHKYL 208


>gi|255020132|ref|ZP_05292202.1| Queuosine Biosynthesis QueE Radical SAM [Acidithiobacillus caldus
           ATCC 51756]
 gi|254970425|gb|EET27917.1| Queuosine Biosynthesis QueE Radical SAM [Acidithiobacillus caldus
           ATCC 51756]
          Length = 213

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 56/228 (24%), Positives = 83/228 (36%), Gaps = 42/228 (18%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M    + EIF +LQGE   +G  A F R +GC L           +C +CDT +      
Sbjct: 1   MSRLRVSEIFHSLQGETTASGVPATFVRLTGCPL-----------RCSYCDTAYAFH--- 46

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETN 119
            G   + DQ+   + E+      + R  V+TGGEPL Q     L+ AL   G E+ +ET+
Sbjct: 47  GGEWLDADQILARVAER------DNRLVVITGGEPLAQPAVHALMTALCDGGREVYLETS 100

Query: 120 GTIEPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQVNVSPENYIGF 166
           G +   +    +       SP +G   +             ++K V    +         
Sbjct: 101 GALSVAEVDPRVVKILDLKSPGSGELERNLWENLDYLGSRDQVKFVLCNRDDYEWARTTV 160

Query: 167 DF------ERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                         P  G     +  LA          RL +Q HKFI
Sbjct: 161 RERKLQGRCELLFSPAYGQLTARD--LAEWILEDRLPVRLQIQLHKFI 206


>gi|148359615|ref|YP_001250822.1| radical activating enzyme [Legionella pneumophila str. Corby]
 gi|296107657|ref|YP_003619358.1| Organic radical activating enzyme [Legionella pneumophila 2300/99
           Alcoy]
 gi|148281388|gb|ABQ55476.1| radical activating enzyme [Legionella pneumophila str. Corby]
 gi|295649559|gb|ADG25406.1| Organic radical activating enzyme [Legionella pneumophila 2300/99
           Alcoy]
          Length = 217

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 49/232 (21%), Positives = 82/232 (35%), Gaps = 46/232 (19%)

Query: 1   MKL----YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG 56
           MK       I EIF +LQGE    G   VF R +GC L           +C++CDT +  
Sbjct: 1   MKRFNEQLRITEIFHSLQGESVTVGLPTVFVRLTGCPL-----------RCQYCDTAYAF 49

Query: 57  IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIA 115
              + G    +D + + +         + ++  +TGGEPL Q   +PL+  L   G+ ++
Sbjct: 50  ---SGGEVVEIDDILNKV------ASYQCQHVCVTGGEPLAQPGCIPLLSKLCDAGYSVS 100

Query: 116 VETNGTIEPPQGIDWICVSPK-------------AGCDLKIKGGQELKLVFPQVNVSPE- 161
           +ET+G  +       + +                      +K   ++K V    N     
Sbjct: 101 LETSGARDIASVDQRVMIVMDLKTPDSREADKNLLSNLSFLKPTDQIKFVLCSRNDYEWA 160

Query: 162 -----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                 Y   +  +    P        +  LA          R  +Q HK +
Sbjct: 161 CSMLSEYQLAERVQLLFSPSWNQLNPAD--LANWIIQDKLPVRFQLQLHKIL 210


>gi|269467818|gb|EEZ79570.1| organic radical activating enzyme [uncultured SUP05 cluster
           bacterium]
          Length = 211

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 53/227 (23%), Positives = 92/227 (40%), Gaps = 42/227 (18%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M   +I EIF +LQGE    G   VF R +GC L           +C +CDT++      
Sbjct: 1   MVNLNINEIFYSLQGEAREVGLPTVFVRLTGCPL-----------RCTYCDTEYAF---K 46

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETN 119
                ++ ++   ++      + + +Y  +TGGEPL Q++  + + AL K G+++++ET+
Sbjct: 47  GNNTLSISKILTEVK------KYKTQYVCITGGEPLAQINCHVLLDALVKEGYQVSLETS 100

Query: 120 GTIEPPQ-------GIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDF---- 168
           G+I+           +D    S       K     +LK V  Q+     +   FD+    
Sbjct: 101 GSIDVSAVNSGVSIVMDVKTPSSNESKHNKYDNIDKLK-VKDQLKFVIGSKEDFDWSVDV 159

Query: 169 -------ERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                   +    P+          LA     +    R+ VQ HK +
Sbjct: 160 LGRYPTMAQVLFSPVFEAIKPA--QLADWILEKQLNVRMQVQLHKLL 204


>gi|330502228|ref|YP_004379097.1| radical SAM domain-containing protein [Pseudomonas mendocina NK-01]
 gi|328916514|gb|AEB57345.1| radical SAM domain-containing protein [Pseudomonas mendocina NK-01]
          Length = 226

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 54/230 (23%), Positives = 84/230 (36%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I EIF +LQGE   AG   VF R +GC L           +C++CDT +     
Sbjct: 12  MQETLRITEIFYSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDTAYAF--- 57

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
           + G    +D++ D +            Y  +TGGEPL Q + + L+  L   G+E+++ET
Sbjct: 58  SGGEIVTLDRILDQVAA------YRPHYVCVTGGEPLAQPNCISLLTRLCDAGYEVSLET 111

Query: 119 NGTIEPPQGIDWICVSPK---AGCDLKIKGGQE----------LKLVFPQVNVSP----- 160
           +G ++       +         G     +   E          +K V             
Sbjct: 112 SGALDVAAVDPRVSKVLDLKTPGSAEVQRNRYENIQWLTRNDQVKFVICSREDYDWAISK 171

Query: 161 --ENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
             E+ +          P       E   LA      N   RL +Q HK +
Sbjct: 172 LIEHDLAARAGEVLFSPSHTQV--EARALAEWIIADNLPVRLQLQLHKIL 219


>gi|113474000|ref|YP_720061.1| hypothetical protein Tery_0080 [Trichodesmium erythraeum IMS101]
 gi|110165048|gb|ABG49588.1| conserved hypothetical protein [Trichodesmium erythraeum IMS101]
          Length = 207

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 55/220 (25%), Positives = 87/220 (39%), Gaps = 33/220 (15%)

Query: 5   SIKEIFL-TLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
            I E F  T+QGEG  AG    F R +GC +            C +CDT +    G    
Sbjct: 8   PIHETFQKTIQGEGYWAGTPVDFIRLAGCPV-----------GCHYCDTGYA--DGGISL 54

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVETNGT- 121
              +  L  LI E +          V++GGEP +   +P LI  +   G ++++ET+G  
Sbjct: 55  PRQIQTLDKLINELF------SPRVVISGGEPFIHKQLPALINRIEATGRQVSIETSGCY 108

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDF----------ERF 171
            +      W+ +SPK     K      +     ++ +  E     +F             
Sbjct: 109 WQNISPNAWVTLSPKEHISHKYPIVPSMWTRASEIKLVIETGKELEFYSKILLLKNQTPV 168

Query: 172 SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            LQP +    +    L      + P  RLS+Q HK++GI+
Sbjct: 169 FLQP-EWYNRDFTLPLVQKLLQEYPHCRLSIQLHKYLGIK 207


>gi|238650659|ref|YP_002916511.1| queuosine biosynthesis protein [Rickettsia peacockii str. Rustic]
 gi|238624757|gb|ACR47463.1| queuosine biosynthesis protein [Rickettsia peacockii str. Rustic]
          Length = 225

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 69/225 (30%), Positives = 97/225 (43%), Gaps = 36/225 (16%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             ++ IF T+QGEG   G  A+F R  GCNL            C FCDT+F         
Sbjct: 18  LEVQSIFKTIQGEGIFVGCPAIFIRLGGCNL-----------ACNFCDTEFEAFD----- 61

Query: 64  RYNVDQLADLIEEQWIT--GEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG- 120
             ++D++ + +E   +    EK     V+TGGEP+ Q    L Q L  R  ++ +ETNG 
Sbjct: 62  LVDIDKILNKVESLALNSKNEKSINLVVITGGEPMRQPIELLCQKLLDRDVKVQIETNGT 121

Query: 121 -TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVN-----------VSPENYIGFDF 168
                P+ +  IC SPK G     K  ++L      V            + PE       
Sbjct: 122 LYRSLPKEVSIIC-SPKVGKTSYSKIREDLLPKISAVKFIVAKNILEYSLIPEVGQTSYN 180

Query: 169 ERFSLQPMDGPFLE---ENTNLAISYCFQNPKWRLSVQTHKFIGI 210
               +QPMD        EN  LA+    ++   RLS+QTHKF+ I
Sbjct: 181 IPVFIQPMDQNNQRLNGENNELAVKLALES-GTRLSLQTHKFLNI 224


>gi|21232445|ref|NP_638362.1| radical activating enzyme [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66767472|ref|YP_242234.1| radical activating enzyme [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|21114226|gb|AAM42286.1| radical activating enzyme [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66572804|gb|AAY48214.1| radical activating enzyme [Xanthomonas campestris pv. campestris
           str. 8004]
          Length = 227

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 51/226 (22%), Positives = 81/226 (35%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIFL+LQGE   AG   VF R +GC L           +C +CDT +       G
Sbjct: 17  RLKITEIFLSLQGEAEAAGWPTVFVRLTGCPL-----------RCTYCDTAYAFH---GG 62

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNGT 121
             +++D +   +           R+  +TGGEPL Q   + L+  L   GF++++ET+G 
Sbjct: 63  EWHDIDAIVAEV------ASHGVRHVCVTGGEPLAQKRCLALLHKLCDAGFDVSLETSGA 116

Query: 122 IEPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQVNVSP------EN 162
           ++       +       +P +G D + +           ++K V                
Sbjct: 117 LDVSAVDARVSRVVDIKTPASGEDHRNRWDNLPLLTARDQIKFVICSRADYEWSRDVVAT 176

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                       P  G        LA          R  +Q HK +
Sbjct: 177 QALDRRCTVWFSPSKGQVSAR--ELADWIVADRLPVRFQMQLHKIL 220


>gi|307610772|emb|CBX00384.1| hypothetical protein LPW_21051 [Legionella pneumophila 130b]
          Length = 217

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 49/232 (21%), Positives = 82/232 (35%), Gaps = 46/232 (19%)

Query: 1   MKL----YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG 56
           MK       I EIF +LQGE    G   VF R +GC L           +C++CDT +  
Sbjct: 1   MKRFNEQLRITEIFHSLQGESVTVGLPTVFVRLTGCPL-----------RCQYCDTAYAF 49

Query: 57  IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIA 115
              + G    +D + + +         + ++  +TGGEPL Q   +PL+  L   G+ ++
Sbjct: 50  ---SGGEVVEIDDILNKV------ASYQCQHVCVTGGEPLAQPGCIPLLSKLCDAGYSVS 100

Query: 116 VETNGTIEPPQGIDWICVSPK-------------AGCDLKIKGGQELKLVFPQVNVSPE- 161
           +ET+G  +       + +                      +K   ++K V          
Sbjct: 101 LETSGARDIASVDQRVMIVMDLKTPDSREADKNLLSNLSFLKPTDQIKFVLCSRTDYEWA 160

Query: 162 -----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                 Y   +  +    P         T+LA          R  +Q HK +
Sbjct: 161 CSMLSEYQLAERVQLLFSPSWNQLNP--TDLANWIIQDKLPVRFQLQLHKIL 210


>gi|88810549|ref|ZP_01125806.1| Radical SAM domain protein [Nitrococcus mobilis Nb-231]
 gi|88792179|gb|EAR23289.1| Radical SAM domain protein [Nitrococcus mobilis Nb-231]
          Length = 225

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 48/225 (21%), Positives = 82/225 (36%), Gaps = 42/225 (18%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + EIF +LQGE G  G   VF R +GC L           +C +CDT +       G 
Sbjct: 16  LRVTEIFYSLQGEAGTVGAPTVFVRLTGCPL-----------RCHYCDTAYAFH---GGE 61

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPL-LQVDVPLIQALNKRGFEIAVETNGTI 122
           + ++ ++ D +      GE   ++  +TGGEPL  +  + L+ +L  RG+ +++ET+G +
Sbjct: 62  KMSIIRILDRV------GEHAAKFVTVTGGEPLAQRGCLTLLSSLCDRGYRVSLETSGAL 115

Query: 123 EPPQGIDWI-------CVSPKAGCDLKIKG------GQELKLVFPQVNVSPENYIGFDFE 169
           +       +                 + +         ELK V                 
Sbjct: 116 DVQAVDPRVIKVMDLKTPGSGEERRNRWENLNYLRPHDELKFVICNRQDYDWARTKVSEL 175

Query: 170 RF------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +             G        LA      +   RL +Q HK++
Sbjct: 176 KLGERWTVFFSASYGELSSRL--LADWILADHLNVRLQIQLHKYL 218


>gi|119493534|ref|ZP_01624200.1| hypothetical protein L8106_18202 [Lyngbya sp. PCC 8106]
 gi|119452651|gb|EAW33832.1| hypothetical protein L8106_18202 [Lyngbya sp. PCC 8106]
          Length = 204

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 56/223 (25%), Positives = 89/223 (39%), Gaps = 33/223 (14%)

Query: 1   MKLYSIKEIFL-TLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M   +I E F  T+QGEG  AG    F R +GC +            C +CDT +    G
Sbjct: 1   MNEIAIHETFQNTIQGEGFWAGTPVDFIRLAGCPVQ-----------CHYCDTGYAN--G 47

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVET 118
            +G   NV     LI E            V++GGEP +   +P L++ +      + +ET
Sbjct: 48  GEGLPRNVRSFEALIAELRSPK------VVISGGEPFIYPQLPDLVKCIEATNRTVFIET 101

Query: 119 NGTIEPP-QGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFE-------- 169
           +G    P     WI +SPK   +       ++     ++ +  E      +         
Sbjct: 102 SGCFWQPISSSVWITLSPKEHLNPHYPVVDQMWERASEIKLVIETGSELKYYDQYLSLKP 161

Query: 170 --RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                LQP +    +    L +    Q P +RLS+Q HK++G+
Sbjct: 162 QIPVFLQP-EWTQRDYTLPLVLELLQQYPDYRLSLQLHKYVGV 203


>gi|77460620|ref|YP_350127.1| radical SAM family protein [Pseudomonas fluorescens Pf0-1]
 gi|77384623|gb|ABA76136.1| putative radical SAM-superfamily protein [Pseudomonas fluorescens
           Pf0-1]
          Length = 215

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 86/230 (37%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I E+F +LQGE   AG   VF R +GC L           +C++CD+ +    G
Sbjct: 1   MQDTLRITEVFYSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAFSGG 49

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
                  +  L D++E+         RY  +TGGEPL Q + +PL++ L   G+E+++ET
Sbjct: 50  ------TIRTLDDILEQ---VAGFRPRYVCVTGGEPLAQPNAIPLLKRLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIKG------GQELKLVFPQVNVSPENYIG 165
           +G ++       +           K     + +         ++K V             
Sbjct: 101 SGALDISAVDPRVSRVVDLKTPDSKEAHRNRYENIDLLTPNDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                           P        +  LA      N   RL +Q HK++
Sbjct: 161 LIQYGLERRAGEVLFSPSHHDLNARD--LADWVVADNLPVRLQLQLHKYL 208


>gi|254000097|ref|YP_003052160.1| Radical SAM domain-containing protein [Methylovorus sp. SIP3-4]
 gi|253986776|gb|ACT51633.1| Radical SAM domain protein [Methylovorus sp. SIP3-4]
          Length = 212

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 50/227 (22%), Positives = 74/227 (32%), Gaps = 42/227 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               I EIF +LQGE    G   VF R +GC             +C +CDT +       
Sbjct: 1   MKLRIHEIFHSLQGESSRVGLPTVFVRLTGCP-----------MRCVYCDTAYAFH---G 46

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPL-LQVDVPLIQALNKRGFEIAVETNG 120
           G    +D +   + E          Y  +TGGEPL  +    L+  L   G+ +++ET G
Sbjct: 47  GSSMEIDDIMQKVAE------YGAHYVTVTGGEPLAQRDCHVLLTRLCDAGYSVSLETGG 100

Query: 121 TIEPPQGIDWICVSPK-------------AGCDLKIKGGQELKLVFPQVNVSPENYIGFD 167
            ++       + V                 G    +K   E+K V              D
Sbjct: 101 AMDIANVDPRVSVILDIKTPGSGELEKNLWGNLAHLKAQDEVKFVLCDHADYLWAKELLD 160

Query: 168 FERF------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
            +           P+        T LA          R+ VQ HK +
Sbjct: 161 KQPLHRTCSVLFSPVYSQVNP--TELAEWILADKLPVRMQVQLHKIL 205


>gi|229592292|ref|YP_002874411.1| putative radical SAM-superfamily protein [Pseudomonas fluorescens
           SBW25]
 gi|229364158|emb|CAY51804.1| putative radical SAM-superfamily protein [Pseudomonas fluorescens
           SBW25]
          Length = 215

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 53/230 (23%), Positives = 87/230 (37%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I E+F +LQGE   AG   VF R +GC L           +C++CD+ +    G
Sbjct: 1   MQDTLRITEVFYSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAFSGG 49

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
                  V  L D++E+       + RY  +TGGEPL Q + +PL++ L   G+E+++ET
Sbjct: 50  ------TVRTLDDILEQ---VAGYKPRYVCVTGGEPLAQPNAIPLLKQLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIKG------GQELKLVFPQVNVSPENYIG 165
           +G ++       +           K     + +         ++K V             
Sbjct: 101 SGALDISAVDPRVSRVVDLKTPGSKEAHRNRYENIELLTANDQVKFVICSREDYDWANSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                           P        +  LA      N   RL +Q HK++
Sbjct: 161 LIQYGLDRRAGEVLFSPSHHDLNARD--LADWVVADNLPVRLQLQLHKYL 208


>gi|90417119|ref|ZP_01225047.1| radical activating enzyme family protein [marine gamma
           proteobacterium HTCC2207]
 gi|90331135|gb|EAS46391.1| radical activating enzyme family protein [marine gamma
           proteobacterium HTCC2207]
          Length = 216

 Score =  141 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 48/228 (21%), Positives = 81/228 (35%), Gaps = 43/228 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               I EIF +LQGE    G   VF R +GC L           +C +CDT +       
Sbjct: 4   TELRITEIFHSLQGETSTVGLPTVFVRLTGCPL-----------RCGYCDTAYAF---EG 49

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPL-LQVDVPLIQALNKRGFEIAVETNG 120
           G ++ +  +   +       +   +Y  +TGGEPL     + L++ L   G+ +++ET+G
Sbjct: 50  GSKWTLSDILSTV------ADYGAKYVTVTGGEPLAQPQCIELLKQLCDLGYRVSLETSG 103

Query: 121 TIE----PPQGIDWICVSPKAGCD---------LKIKGGQELKLVFPQVNVSPENYIGFD 167
            +      P+    + +      +           +    E+K V         + +  D
Sbjct: 104 AMPVEDVDPRVFKIVDLKTPGSGEVSKNLYSNIEYLLPHDEVKFVICDRQDYDWSCMKID 163

Query: 168 F-------ERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                         P  G        LA          R+ +QTHK+I
Sbjct: 164 ELGLQGRVAEILFSPSQGVLPPA--ELAKWMLHDKLNLRMQIQTHKYI 209


>gi|284174859|ref|ZP_06388828.1| hypothetical protein Ssol98_09426 [Sulfolobus solfataricus 98/2]
 gi|261602301|gb|ACX91904.1| Radical SAM domain protein [Sulfolobus solfataricus 98/2]
          Length = 208

 Score =  141 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 65/229 (28%), Positives = 99/229 (43%), Gaps = 40/229 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y + EIF ++QGEG   G  + F R + CNL           +C +CDT +       
Sbjct: 1   MKYRVIEIFTSIQGEGEVIGIPSNFIRLATCNL-----------RCVWCDTKYSW---EI 46

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G   ++D++   ++++  T         +TGGEPLLQ  +PL + L   G +I VETNGT
Sbjct: 47  GTEMSIDEIIAKLDKKIKT-------TTITGGEPLLQNILPLAKELKSIGHKIVVETNGT 99

Query: 122 IEPPQG----IDWICVSPK---AGCDLKIKGGQEL----KLVFPQVNVSPENYIGF---- 166
           I+P +     ID   VSPK   +G  LK     +     K V    N   +  + F    
Sbjct: 100 IKPSEELRKIIDIFSVSPKLSNSGHKLKYDFADDWATYYKFVIVYPNKDIDEVVKFVESQ 159

Query: 167 --DFERFSLQP-MDGPFLEENTNLAISYCFQN-PKWRLSVQTHKFIGIR 211
             +  +  LQP  +        N  +        ++R+  Q H+ IG R
Sbjct: 160 SINPRKVILQPDGNRSDYINAINEIVQIVLDRGLQFRVLPQLHRIIGAR 208


>gi|289548016|ref|YP_003473004.1| radical SAM protein [Thermocrinis albus DSM 14484]
 gi|289181633|gb|ADC88877.1| Radical SAM domain protein [Thermocrinis albus DSM 14484]
          Length = 219

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 61/228 (26%), Positives = 91/228 (39%), Gaps = 36/228 (15%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               + EI+ +LQGEG   G  +VF R  GCNL           +C +CD       G  
Sbjct: 10  TALKVSEIYPSLQGEGLLVGTPSVFVRLQGCNL-----------RCPWCDQPESLHPG-G 57

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPL-LQVDVPLIQALNKRGFEIAVETNG 120
           G   +V+ +           E   R+ V+TGGEP        L++ L K GF + +ETNG
Sbjct: 58  GALMSVEDV------IGKVREYPHRHVVITGGEPFTQSFLTLLVEELLKEGFSVQIETNG 111

Query: 121 TIEPPQ-----GIDWICVSPKAGCDLKIKGG-----QELKLVFP-----QVNVSPENYIG 165
           T+             I +SPK      +        +ELK V        + + P     
Sbjct: 112 TLWQKGMDTLASHIHITLSPKGVASWFVHPKVLLYARELKWVVDHLLTLDIILMPSFRRF 171

Query: 166 FDFERFSLQPMDGP--FLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
            + ER  LQP      FL++  +L         + R+  Q HK +G++
Sbjct: 172 LEEERVVLQPEGNKEIFLQKALSLQEELLSLGYRVRVLPQLHKLLGLK 219


>gi|15897539|ref|NP_342144.1| hypothetical protein SSO0624 [Sulfolobus solfataricus P2]
 gi|13813792|gb|AAK40934.1| Conserved hypothetical protein [Sulfolobus solfataricus P2]
          Length = 211

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 65/229 (28%), Positives = 99/229 (43%), Gaps = 40/229 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y + EIF ++QGEG   G  + F R + CNL           +C +CDT +       
Sbjct: 4   MKYRVIEIFTSIQGEGEVIGIPSNFIRLATCNL-----------RCVWCDTKYSW---EI 49

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
           G   ++D++   ++++  T         +TGGEPLLQ  +PL + L   G +I VETNGT
Sbjct: 50  GTEMSIDEIIAKLDKKIKT-------TTITGGEPLLQNILPLAKELKSIGHKIVVETNGT 102

Query: 122 IEPPQG----IDWICVSPK---AGCDLKIKGGQEL----KLVFPQVNVSPENYIGF---- 166
           I+P +     ID   VSPK   +G  LK     +     K V    N   +  + F    
Sbjct: 103 IKPSEELRKIIDIFSVSPKLSNSGHKLKYDFADDWATYYKFVIVYPNKDIDEVVKFVESQ 162

Query: 167 --DFERFSLQP-MDGPFLEENTNLAISYCFQN-PKWRLSVQTHKFIGIR 211
             +  +  LQP  +        N  +        ++R+  Q H+ IG R
Sbjct: 163 SINPRKVILQPDGNRSDYINAINEIVQIVLDRGLQFRVLPQLHRIIGAR 211


>gi|302035630|ref|YP_003795952.1| putative radical-activating enzyme, radical SAM superfamily
           [Candidatus Nitrospira defluvii]
 gi|300603694|emb|CBK40025.1| putative Radical-activating enzyme, radical SAM superfamily
           [Candidatus Nitrospira defluvii]
          Length = 212

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 56/226 (24%), Positives = 84/226 (37%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  + EIF ++QGE  +AGR  VF R +GC L           +C +CDT +       G
Sbjct: 1   MVKVTEIFHSIQGESTYAGRPCVFVRLTGCPL-----------RCTWCDTAYAFY---GG 46

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNGT 121
               +D + + +               +TGGEPL Q   +PL+  L   GFE+ VET+G 
Sbjct: 47  RDLTIDDIVNQV------RAFSCDLVEVTGGEPLSQPASLPLLTRLCDEGFEVLVETSGA 100

Query: 122 IEPPQGIDWICV-----SPKAGCDLKIKG--------GQELKLV------FPQVNVSPEN 162
           IE       + V      P +G   ++            E+K V      +         
Sbjct: 101 IETIGVDRRVHVILDVKCPGSGMTDRMCWSNLDRLAPQDEVKFVIKDRVDYEWAREVLHR 160

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +         + P+ G        LA          R  +Q HKFI
Sbjct: 161 HELPGRCTVLMSPVFGEVEVRY--LAEWILADKLPVRFQLQMHKFI 204


>gi|56476931|ref|YP_158520.1| radical activating enzyme [Aromatoleum aromaticum EbN1]
 gi|56312974|emb|CAI07619.1| SAM radical family enzyme similar to queE gene product; involved in
           queuosine biosynthesis [Aromatoleum aromaticum EbN1]
          Length = 221

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 50/224 (22%), Positives = 82/224 (36%), Gaps = 42/224 (18%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            + EIF +LQGE    G   VF R +GC L           +C +CDT++    G     
Sbjct: 13  RLTEIFASLQGESTRVGLPTVFVRLTGCPL-----------RCVWCDTEYAFQGGE---- 57

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNGTIE 123
                +A ++EE          +  +TGGEPL Q   + L+ AL   G  +++ET+G ++
Sbjct: 58  --SRSIASIVEEVL---GHGIEHVCVTGGEPLAQKSCLALLAALCDAGLSVSLETSGALD 112

Query: 124 PPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLV------FPQVNVSPENYI 164
                  +       +P +G   + +           E+K+V      +         + 
Sbjct: 113 IAAVDPRVSRVMDLKAPGSGEVARNRWDNLARLNERDEVKIVLADRLDYEWAVQCLAEHR 172

Query: 165 GFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                   L P+ G        LA          R  +Q HK +
Sbjct: 173 LAQRCTVLLSPVQGKLDPA--QLAEWIVRDRLPVRFQLQLHKIL 214


>gi|254448671|ref|ZP_05062129.1| radical activating enzyme [gamma proteobacterium HTCC5015]
 gi|198261679|gb|EDY85966.1| radical activating enzyme [gamma proteobacterium HTCC5015]
          Length = 235

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 47/225 (20%), Positives = 76/225 (33%), Gaps = 42/225 (18%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             I EIF +LQGE   AG    F R +GC L           +C +CD+++       G 
Sbjct: 26  LKITEIFCSLQGESTLAGLPTTFVRLTGCPL-----------RCTYCDSEYAFF---GGD 71

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPL-LQVDVPLIQALNKRGFEIAVETNGTI 122
            ++ + L D ++              +TGGEPL  +    L+ AL  RG+ +++ET+G +
Sbjct: 72  WWSQEALLDRVDTL------GAPNVCVTGGEPLAQRSCHELMSALCDRGYRVSLETSGAL 125

Query: 123 EPPQ-------GIDWICVSPKAGCDLKIKGGQELK------------LVFPQVNVSPENY 163
           +           +D      +     K     +LK              +          
Sbjct: 126 DISTVDQRVMVVMDIKTPDSREDHRNKFDNLSQLKAGDQVKFVIGSRADYDWAKQRVAER 185

Query: 164 IGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                      P          +LA          R  +QTHK +
Sbjct: 186 EIDQRCEVLFSPNYEKLSAR--SLADWIVEDRLPVRFQMQTHKLL 228


>gi|188577425|ref|YP_001914354.1| radical activating enzyme [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188521877|gb|ACD59822.1| radical activating enzyme [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 213

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 47/228 (20%), Positives = 77/228 (33%), Gaps = 42/228 (18%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M    I EIFL+LQGE   AG   VF R +GC L           +C +CDT +      
Sbjct: 1   MPRLKITEIFLSLQGEAEAAGWPTVFVRLTGCPL-----------RCVYCDTAYAFH--- 46

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETN 119
            G  +++D +   +           R+  +TGGEPL Q    + +Q L   G+++++ET+
Sbjct: 47  GGEWHDIDDVLAEV------ATHGVRHVCVTGGEPLAQKRCLVLLQKLCDAGYDVSLETS 100

Query: 120 GTIEPPQGID-------WICVSPKAGCDLKIKG------GQELKLVFPQVNVSP------ 160
           G ++                 +       + +         ++K V              
Sbjct: 101 GALDVSAVDPRVSRVVDIKTPASGEEARNRWENLLLLTARDQIKFVICSRADYEWSREIV 160

Query: 161 ENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
             +           P           LA          R  +Q HK +
Sbjct: 161 AAHALDRRCTVWFSPSKSEVGPR--QLADWIVADRLPVRFQMQLHKLL 206


>gi|148244548|ref|YP_001219242.1| organic radical activating enzyme [Candidatus Vesicomyosocius
           okutanii HA]
 gi|146326375|dbj|BAF61518.1| organic radical activating enzyme [Candidatus Vesicomyosocius
           okutanii HA]
          Length = 213

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 51/224 (22%), Positives = 83/224 (37%), Gaps = 40/224 (17%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
             +I EIF ++QGE    G  +VF R +GC L            C +CDT++        
Sbjct: 5   KLNINEIFYSIQGEAREVGLPSVFIRLTGCPLK-----------CTYCDTEYAFH---GN 50

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVETNGT 121
               +D +   I++       +  Y  +TGGEPLLQ +   L+  L +  +++++ET+G+
Sbjct: 51  NLMEIDAIISEIKQ------YDTTYICVTGGEPLLQKNCYLLLDRLVENNYQVSLETSGS 104

Query: 122 IEPPQGIDWI-------CVSPKAGCDLKIKGG------QELKLVFPQVNVSPENYIGFDF 168
           I        +         S       K           +LK V    +    +    + 
Sbjct: 105 INIQDVNALVSIVMDVKTPSSGESEQNKYTNFKKLTVKDQLKFVIGSHSDFDWSVAILNQ 164

Query: 169 ER----FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                     P+ G      T LA     Q    RL +Q HK +
Sbjct: 165 YHTTAGVLFSPVFGNITP--TQLADWILDQQLNVRLQLQLHKLL 206


>gi|305663006|ref|YP_003859294.1| coenzyme PQQ synthesis protein, conjectural [Ignisphaera aggregans
           DSM 17230]
 gi|304377575|gb|ADM27414.1| coenzyme PQQ synthesis protein, conjectural [Ignisphaera aggregans
           DSM 17230]
          Length = 219

 Score =  141 bits (355), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 56/215 (26%), Positives = 86/215 (40%), Gaps = 27/215 (12%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            + EIF ++QGEG   GR AVF R  GCNL   +           CDT +     + G  
Sbjct: 7   RVSEIFYSIQGEGPFIGRPAVFIRLQGCNLRCTKNSVGWD-----CDTQYAW-DSSGGME 60

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIEP 124
            ++D++ D++ +       + R+ V+TGGEP++Q    +       G+ I +ETNGTI  
Sbjct: 61  ISIDRVVDIVRQ------YQCRHIVITGGEPMIQQREVIELIKRLDGYAIEIETNGTIPL 114

Query: 125 PQGIDW----ICVSPKAGCDLKI---KGGQELKLVFPQVN-----VSPENYIGFDFERFS 172
                     + VSPK    ++    +    LK V           S     G +  R  
Sbjct: 115 DPDFPVEKVRLNVSPKPHAPIRPEYIRYASCLKFVVASEKDLVFVDSFVKIYGVEPSRIW 174

Query: 173 LQPMDGPFLE--ENTNLAISYCFQNPKWRLSVQTH 205
           L P      E   N  L   Y      + ++ + H
Sbjct: 175 LMPASRNVDEHNRNIRLCWEYAKLR-GYNVTPRLH 208


>gi|70732080|ref|YP_261836.1| radical activating enzyme [Pseudomonas fluorescens Pf-5]
 gi|68346379|gb|AAY93985.1| radical activating enzyme [Pseudomonas fluorescens Pf-5]
          Length = 215

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 86/230 (37%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I E+F +LQGE   AG   VF R +GC L           +C++CD+ +     
Sbjct: 1   MQDTLRITEVFYSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAF--- 46

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
           + G +  +D L + +           RY  +TGGEPL Q + +PL+Q L   G+E+++ET
Sbjct: 47  SGGSQRTLDSLLEQV------AGFRPRYVCVTGGEPLAQPNAIPLLQHLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIKG------GQELKLVFPQVNVSPENYIG 165
           +G ++       +           K     + +         ++K V             
Sbjct: 101 SGALDISAVDPRVSRILDLKTPGSKEAHRNRYENIELLTANDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                           P        +  LA      N   RL +Q HK++
Sbjct: 161 LIQYGLERRAGEVLFSPSHHDLNARD--LADWIVADNLPVRLQLQLHKYL 208


>gi|52842258|ref|YP_096057.1| radical activating enzyme [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52629369|gb|AAU28110.1| radical activating enzyme [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 217

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 49/232 (21%), Positives = 81/232 (34%), Gaps = 46/232 (19%)

Query: 1   MKL----YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG 56
           MK       I EIF +LQGE    G   VF R +GC L           +C++CDT +  
Sbjct: 1   MKRFNEQLRITEIFHSLQGESVTVGLPTVFVRLTGCPL-----------RCQYCDTAYAF 49

Query: 57  IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIA 115
              + G    +D + + +         + ++  +TGGEPL Q   + L+  L   G+ ++
Sbjct: 50  ---SGGEVVEIDDILNKV------ASYQCQHVCVTGGEPLAQPGCILLLSKLCDAGYSVS 100

Query: 116 VETNGTIEPPQGIDWICVSPK-------------AGCDLKIKGGQELKLVFPQVNVSPE- 161
           +ET+G  +       + +                      +K   ++K V          
Sbjct: 101 LETSGARDIASVDQRVMIVMDLKTPDSREADKNLLSNLSFLKPTDQIKFVLCSRTDYEWA 160

Query: 162 -----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                 Y   +  +    P         TNLA          R  +Q HK +
Sbjct: 161 CSMLSEYQLAERVQLLFSPSWNQLNP--TNLANWIIQDKLPVRFQLQLHKIL 210


>gi|21243865|ref|NP_643447.1| radical activating enzyme [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21109466|gb|AAM37983.1| radical activating enzyme [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 227

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 48/226 (21%), Positives = 77/226 (34%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIFL+LQGE   AG   VF R +GC L           +C +CDT +       G
Sbjct: 17  RLKITEIFLSLQGEAEAAGWPTVFVRLTGCPL-----------RCHYCDTAYAFH---GG 62

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGT 121
             +++D +   +           R+  +TGGEPL Q    + +Q L   GF++++ET+G 
Sbjct: 63  QWHDIDAIVAEV------ASHGVRHVCVTGGEPLAQKRCLVLLQKLCDAGFDVSLETSGA 116

Query: 122 IEPPQGI-------DWICVSPKAGCDLKIKG------GQELKLVFPQVNVSP------EN 162
           ++            D    +       + +         ++K V                
Sbjct: 117 LDVSAVDSRVSRVVDIKTPASGEEARNRWENLPLLTARDQIKFVICSRADYEWSREIVAA 176

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +           P           LA          R  +Q HK +
Sbjct: 177 HALDRRCTVWFSPSKSEVSPR--QLADWIVADRLPVRFQMQLHKLL 220


>gi|91200480|emb|CAJ73528.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 211

 Score =  140 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 52/223 (23%), Positives = 82/223 (36%), Gaps = 42/223 (18%)

Query: 6   IKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRY 65
           I EIF ++QGE    G   VF R +GCNL           +C +CDT +   +   G   
Sbjct: 3   INEIFRSIQGETSFTGLPFVFVRLTGCNL-----------RCSYCDTQYAYDE---GNEM 48

Query: 66  NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTIE- 123
            +  + D I+          +   +TGGEPL   + P+ ++ L  R + + VETNG+ + 
Sbjct: 49  PISSIIDKID------SFGLKSVCVTGGEPLSNHNTPVLVRELLNRNYTVLVETNGSYDV 102

Query: 124 ------PPQGIDWICVSPKAGCDLKIKG------GQELKLVFPQVNVSPE------NYIG 165
                   + +D  C        +            E+K V    N           Y  
Sbjct: 103 SVLPEGTIRILDVKCPDSGMSHKMCWHNISHLTKKDEVKFVLSSRNDYEWARSMISKYHL 162

Query: 166 FDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
            +     + P+ G         A      +   RL +Q HK+I
Sbjct: 163 TEIAHILMNPVYGMIQPSLI--ASWILEDHINVRLQLQMHKYI 203


>gi|254468966|ref|ZP_05082372.1| radical SAM domain protein [beta proteobacterium KB13]
 gi|207087776|gb|EDZ65059.1| radical SAM domain protein [beta proteobacterium KB13]
          Length = 212

 Score =  140 bits (354), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 51/227 (22%), Positives = 87/227 (38%), Gaps = 41/227 (18%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M    I EIF ++QGE    G+  VF R +GC             +C +CDT +   +G 
Sbjct: 1   MSTLRINEIFYSIQGESSRIGKPTVFVRLTGCP-----------MRCTYCDTAYAFHEGQ 49

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETN 119
           +          ++ E      + +  Y  +TGGEPL Q + + L+  L + G+++++ET 
Sbjct: 50  Q---------QEIEEIIQEIKQFDTNYVTVTGGEPLAQKNCIDLMNQLCELGYQVSLETG 100

Query: 120 GTIEPPQGIDWICV-----SPKAGCD--------LKIKGGQELKLVFPQVN-----VSPE 161
           G ++       + +     +PK+  D          I+   E+K V          +   
Sbjct: 101 GALDIKDVHAKVKIILDVKTPKSNEDKNNFWPNLENIRTNDEIKFVIQDYEDFSWSMDII 160

Query: 162 NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                +  +    P+       N  LA          RL VQ HK +
Sbjct: 161 KKYQLNQGQILFSPVYKVL--ANEQLAGWILKHQLNVRLQVQLHKIL 205


>gi|325923406|ref|ZP_08185071.1| organic radical activating enzyme [Xanthomonas gardneri ATCC 19865]
 gi|325546121|gb|EGD17310.1| organic radical activating enzyme [Xanthomonas gardneri ATCC 19865]
          Length = 227

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 47/226 (20%), Positives = 76/226 (33%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIFL+LQGE   AG   VF R +GC L           +C +CDT +       G
Sbjct: 17  RLKITEIFLSLQGEAEAAGWPTVFVRLTGCPL-----------RCHYCDTAYAFH---GG 62

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGT 121
             +++D +   +           R+  +TGGEPL Q    + +Q L   GF++++ET+G 
Sbjct: 63  EWHDIDAIVAEV------ASHGVRHVCVTGGEPLAQKRCLVLLQKLCDAGFDVSLETSGA 116

Query: 122 IEPPQGID-------WICVSPKAGCDLKIKG------GQELKLVFPQVNVSP------EN 162
           ++                 +       + +         ++K V                
Sbjct: 117 LDVSAVDPRVSRVVDIKTPASGEEQRNRWENLPLLTARDQIKFVICSRADYEWSREIVAA 176

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +           P           LA          R  +Q HK +
Sbjct: 177 HALDRRCTVWFSPSKSEVTPR--ELADWIVADRLPVRFQMQLHKLL 220


>gi|257095755|ref|YP_003169396.1| Radical SAM domain-containing protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257048279|gb|ACV37467.1| Radical SAM domain protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 219

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 50/225 (22%), Positives = 77/225 (34%), Gaps = 42/225 (18%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             I EIFL+LQGE    G   VF R +GC L           +C +CDT +       G 
Sbjct: 10  LKISEIFLSLQGETSRVGLPTVFVRLTGCPL-----------RCVWCDTAYAF---AGGR 55

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNGTI 122
              +  +   +         + R+  +TGGEPL Q   + L+  L   G+ +++ET+G +
Sbjct: 56  TMTLPDILAEVAR------HDVRHVCVTGGEPLAQPACLALLSELCDTGYAVSLETSGAL 109

Query: 123 EPPQGIDWIC--VSPKAGCDLKIKGG-----------QELKLV------FPQVNVSPENY 163
           +       +   V  KA    +                E+K V      +          
Sbjct: 110 DIGGVDQRVARIVDLKAPGSGESDRNLWANLSLLNSGDEIKFVLAHRADYEWARQVIVER 169

Query: 164 IGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
              D       P+ G        LA          R  +Q HK +
Sbjct: 170 RLADVCPLLFSPVAGELAAS--TLAEWILADRLPVRFQLQLHKVL 212


>gi|254282112|ref|ZP_04957080.1| radical SAM domain protein [gamma proteobacterium NOR51-B]
 gi|219678315|gb|EED34664.1| radical SAM domain protein [gamma proteobacterium NOR51-B]
          Length = 217

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 51/230 (22%), Positives = 82/230 (35%), Gaps = 47/230 (20%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               I EIF +LQGE    G   VF R +GC L           +C +CDT +     + 
Sbjct: 5   TTLRITEIFHSLQGEARTVGLPTVFVRLTGCPL-----------RCVYCDTAYAF---SG 50

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNG 120
           G    +D + + +               +TGGEPL Q + + L+ AL  RG+++++ET+G
Sbjct: 51  GELTTLDDILERV------AGFSCTRVCVTGGEPLAQPECLSLLTALCDRGYDVSLETSG 104

Query: 121 TIEPPQGIDWI-------------CVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFD 167
            +        +             C         ++    ++K V      +   +  F 
Sbjct: 105 AMPIAGADTRVSRVLDLKTPDSGECHRNDWSNIEQLTPHDQIKFVVCSR--TDYEWARFK 162

Query: 168 FERFSL---------QPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
            + F L          P  G        LA          RL +Q HK +
Sbjct: 163 LDEFKLPTRVSDVLFSPSYGVVEPA--ELAQWLLDDRLAARLQLQLHKLL 210


>gi|93005554|ref|YP_579991.1| radical SAM family protein [Psychrobacter cryohalolentis K5]
 gi|92393232|gb|ABE74507.1| Radical SAM [Psychrobacter cryohalolentis K5]
          Length = 244

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 51/238 (21%), Positives = 84/238 (35%), Gaps = 53/238 (22%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + EIF +LQGE  ++G   +F R +GC L           +C +CDT++     + G 
Sbjct: 20  LRLTEIFYSLQGEALNSGLPTIFVRLTGCPL-----------RCVYCDTEYAF---SGGE 65

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNGTI 122
           R +++ +   I           +   LTGGEPL Q + + L++ L   G+EI++ET G +
Sbjct: 66  RQSLETIMATI------ASFPCKRICLTGGEPLAQPNAIELMKRLLNEGYEISLETAGAL 119

Query: 123 -------EPPQGIDWICVSPKAGCDLKIKG------GQELKLVFPQV---NVSPENYIGF 166
                     + +D    S                   ++K V       + +    I +
Sbjct: 120 TVENVPPAVSKVMDLKTPSSGEVDKNLWSNLDYLTQHDQIKFVIMNRTDYDWAKAKLIDY 179

Query: 167 DFE----RFSLQPMDGPFLEE------------NTNLAISYCFQNPKWRLSVQTHKFI 208
                       PM     E+               LA          R  +Q HK I
Sbjct: 180 KLNDLVGTVWFSPMFNVAHEDTANDNSPEVPVLARELAEWMLTDALPVRFQLQLHKII 237


>gi|289661912|ref|ZP_06483493.1| putative radical activating enzyme [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 227

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 76/226 (33%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIFL+LQGE   AG   VF R +GC L           +C +CDT +       G
Sbjct: 17  RLKITEIFLSLQGEAEAAGWPTVFVRLTGCPL-----------RCLYCDTAYAFH---GG 62

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGT 121
             +++D +   +           R+  +TGGEPL Q    + +Q L   G+++++ET+G 
Sbjct: 63  EWHDIDAIVAEVAR------HGVRHVCVTGGEPLAQKRCLVLLQKLCDAGYDVSLETSGA 116

Query: 122 IEPPQGID-------WICVSPKAGCDLKIKG------GQELKLVFPQVNVSP------EN 162
           ++                 +       + +         ++K V                
Sbjct: 117 LDVSAVDPRVSRVVDIKTPASGEEARNRWENLPLLTARDQIKFVICSRADYEWSREIVAA 176

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +           P           LA          R  +Q HK +
Sbjct: 177 HALDRRCTVWFSPSKSEVSPR--QLADWIVADRLPVRFQMQLHKLL 220


>gi|197122965|ref|YP_002134916.1| radical SAM protein [Anaeromyxobacter sp. K]
 gi|196172814|gb|ACG73787.1| Radical SAM domain protein [Anaeromyxobacter sp. K]
          Length = 210

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 61/223 (27%), Positives = 88/223 (39%), Gaps = 41/223 (18%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            + EIF ++QGEG  AGR  VF RF+GC+L           +C +CDT +       G  
Sbjct: 2   RVTEIFFSIQGEGSRAGRPCVFVRFTGCDL-----------RCGYCDTAYAFH---GGAD 47

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVETNGTIE 123
            +   +   +           R+  LTGGEP+LQ ++P L + L  RG+E+AVET+G   
Sbjct: 48  MDRAAILAEVAR------HPARFVCLTGGEPMLQRELPDLARDLVARGYEVAVETHGQRP 101

Query: 124 PP--QGIDWICVSPKAGCD----------LKIKGGQELKLVFPQVN---VSPENYIGFDF 168
                      V  K               +++   E+K V    +    S E       
Sbjct: 102 LDALPAEAIRVVDVKTPGSGEVTTDFAYLDRLQPHDEVKFVVCSEDDFRWSREVVRRHAL 161

Query: 169 E---RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           E   +  L P  G     +  L           RLS+Q HK I
Sbjct: 162 EGRVQVLLSPAWGQVAPRD--LVRWMLESGLDARLSLQVHKVI 202


>gi|153005327|ref|YP_001379652.1| radical SAM domain-containing protein [Anaeromyxobacter sp.
           Fw109-5]
 gi|152028900|gb|ABS26668.1| Radical SAM domain protein [Anaeromyxobacter sp. Fw109-5]
          Length = 210

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 58/223 (26%), Positives = 80/223 (35%), Gaps = 41/223 (18%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            + EIF +LQGEG  AGR  VF RF+GC+L           +C +CD+ +       G  
Sbjct: 2   RVTEIFFSLQGEGTRAGRPCVFVRFTGCDL-----------RCGYCDSAYAFH---GGRE 47

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQ-VDVPLIQALNKRGFEIAVETNGTIE 123
               ++   I           +   LTGGEP+LQ     L + L  RG E+ VET+G   
Sbjct: 48  LTRAEILAEIAR------HPAKLVCLTGGEPMLQRELPELARELVARGHEVTVETHGQRP 101

Query: 124 ----PPQGIDWICVSPKAGCDLKI--------KGGQELKLVFPQVNVSPE------NYIG 165
               PP+ I  + V      +           +   E+K V                +  
Sbjct: 102 LDALPPETIRIVDVKTPGSREEAKDLAYLDGLRPQDEVKFVVCSEPDYRWSVDVVRRHRL 161

Query: 166 FDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                    P  G        LA          RLS+Q HK I
Sbjct: 162 EGRAHLLFSPAWGEVEPR--ELARWILRDGLDARLSLQIHKVI 202


>gi|301063545|ref|ZP_07204071.1| radical SAM domain protein [delta proteobacterium NaphS2]
 gi|300442354|gb|EFK06593.1| radical SAM domain protein [delta proteobacterium NaphS2]
          Length = 215

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 53/228 (23%), Positives = 91/228 (39%), Gaps = 44/228 (19%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               + EIF ++QGE  +AG   VF R +GCNL           +C +CDT +      +
Sbjct: 1   MTLRVNEIFYSIQGESSYAGLPCVFVRLTGCNL-----------RCSYCDTRYAY---EE 46

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL-NKRGFEIAVETNG 120
           GG   ++ + + I         + R   +TGGEPL+Q   P++     + G+++ +ETNG
Sbjct: 47  GGILEINHIFEQI------APMQCRLVEITGGEPLVQEKTPILIESLLEDGYDVLLETNG 100

Query: 121 TIE-------PPQGIDWICVSPKAGCDLKIKG------GQELKLVF-PQVNVSPENYIGF 166
           + +         + +D  C S      + ++         E+K V   + +      I  
Sbjct: 101 SHDISRVDNRCVKIVDIKCPSSGMHNHMDMENLNRLSAKDEIKFVLGTREDYEYAREIVI 160

Query: 167 DFERFSL-------QPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKF 207
             +   L        P+ G    E   LA      +   RL +Q  K+
Sbjct: 161 RMKSRFLKISSVNFSPVFGQLKPE--TLAEWILEDHLPCRLHLQLQKY 206


>gi|29653453|ref|NP_819145.1| radical SAM domain-containing protein [Coxiella burnetii RSA 493]
 gi|153207177|ref|ZP_01945956.1| radical SAM domain protein [Coxiella burnetii 'MSU Goat Q177']
 gi|154707102|ref|YP_001425323.1| queuosine biosynthesis protein [Coxiella burnetii Dugway 5J108-111]
 gi|161830218|ref|YP_001596061.1| radical SAM domain-containing protein [Coxiella burnetii RSA 331]
 gi|165918380|ref|ZP_02218466.1| radical SAM domain protein [Coxiella burnetii RSA 334]
 gi|212213378|ref|YP_002304314.1| queuosine biosynthesis protein [Coxiella burnetii CbuG_Q212]
 gi|212219428|ref|YP_002306215.1| queuosine biosynthesis protein [Coxiella burnetii CbuK_Q154]
 gi|29540715|gb|AAO89659.1| queuosine biosynthesis protein [Coxiella burnetii RSA 493]
 gi|120576838|gb|EAX33462.1| radical SAM domain protein [Coxiella burnetii 'MSU Goat Q177']
 gi|154356388|gb|ABS77850.1| queuosine biosynthesis protein [Coxiella burnetii Dugway 5J108-111]
 gi|161762085|gb|ABX77727.1| radical SAM domain protein [Coxiella burnetii RSA 331]
 gi|165917886|gb|EDR36490.1| radical SAM domain protein [Coxiella burnetii RSA 334]
 gi|212011788|gb|ACJ19169.1| queuosine biosynthesis protein [Coxiella burnetii CbuG_Q212]
 gi|212013690|gb|ACJ21070.1| queuosine biosynthesis protein [Coxiella burnetii CbuK_Q154]
          Length = 213

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 52/227 (22%), Positives = 83/227 (36%), Gaps = 42/227 (18%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M    I EIF +LQGE    G   VF R +GC L           +C +CDT +    G 
Sbjct: 1   MDKLRITEIFYSLQGETKTVGLPTVFVRLTGCPL-----------RCHYCDTPYAFYGGQ 49

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETN 119
                    L + +  Q      + RY  +TGGEPL Q   +PL+Q L    + +++ET+
Sbjct: 50  S-------LLLEDVVHQ--VASYQTRYVTVTGGEPLAQPACLPLLQRLCDLNYRVSLETS 100

Query: 120 GTIE----PPQGIDWICVSPKAGCDLKIKGGQELKLVFPQV-------NVSPENYIGFDF 168
           G ++     P+ I  + V      ++        + + P         +     +     
Sbjct: 101 GALDISNVDPRVIKIVDVKTPGSKEMARNRFGNFEYLLPHDQVKFVICDRRDYEWAKDII 160

Query: 169 ERFSL--------QPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKF 207
            R+ L         P      ++   LA          R  +Q HK+
Sbjct: 161 NRYDLISRAEVLFSPSHEQLDKQ--QLADWIVEDRLSVRFQLQLHKY 205


>gi|325914192|ref|ZP_08176545.1| organic radical activating enzyme [Xanthomonas vesicatoria ATCC
           35937]
 gi|325539695|gb|EGD11338.1| organic radical activating enzyme [Xanthomonas vesicatoria ATCC
           35937]
          Length = 227

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 50/226 (22%), Positives = 83/226 (36%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIFL+LQGE   AG   VF R +GC L           +C +CDT +       G
Sbjct: 17  RLKITEIFLSLQGEAEAAGWPTVFVRLTGCPL-----------RCNYCDTAYAFH---GG 62

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGT 121
             +++D +   +           R+  +TGGEPL Q    + +Q L   GF++++ET+G 
Sbjct: 63  QWHDIDAIVAEV------ASHGVRHVCVTGGEPLAQKRCLVLLQKLCDAGFDVSLETSGA 116

Query: 122 IEPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQVNVSP------EN 162
           ++  +    +       +P +G + + +           ++K V                
Sbjct: 117 LDVSEVDTRVSRVVDIKTPASGEEQRNRWDNLALLTARDQIKFVICSRADYEWSRGIVAA 176

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +           P  G        LA          R  +Q HK +
Sbjct: 177 HALERRCTVWFSPSKGEVPPR--QLADWIVSDRLPVRFQMQLHKIL 220


>gi|118602444|ref|YP_903659.1| radical SAM domain-containing protein [Candidatus Ruthia magnifica
           str. Cm (Calyptogena magnifica)]
 gi|118567383|gb|ABL02188.1| Radical SAM domain protein [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 213

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 56/228 (24%), Positives = 90/228 (39%), Gaps = 48/228 (21%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
             +I EIF +LQGEG   G  +VF R +GC L           +C +CDT++        
Sbjct: 5   KLNINEIFYSLQGEGREVGLPSVFIRLTGCPL-----------RCTYCDTEYAF---KGN 50

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNGT 121
               +D++   I++       +  Y  +TGGEPL Q +   L+  L K  +++++ET+G+
Sbjct: 51  NLMAIDEIIKKIKQ------YDTPYICVTGGEPLAQKNCCLLLNELVKNNYQVSLETSGS 104

Query: 122 IEPPQGIDWICVSPKAGCDLKIKGGQELKL----------VFPQVNVSPENYIGFDFERF 171
           I        + VS     D+K     E +              Q+     +   FD+   
Sbjct: 105 INIQD----VNVSVSIVMDIKTPDSGEFEQNKYTNIKKLTTKDQLKFVIRSRADFDWSVA 160

Query: 172 SL-----------QPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
            L            P+ G      T LA     Q    R+ +Q HK +
Sbjct: 161 ILSQYPTAAGTLFSPVFGDITP--TQLADWILDQQLNVRMQLQLHKLL 206


>gi|294626853|ref|ZP_06705445.1| radical activating enzyme [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292598867|gb|EFF43012.1| radical activating enzyme [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
          Length = 227

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 47/226 (20%), Positives = 81/226 (35%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIFL+LQGE   AG   VF R +GC L           +C +CDT +       G
Sbjct: 17  RLKITEIFLSLQGEAEAAGWPTVFVRLTGCPL-----------RCLYCDTAYAFH---GG 62

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGT 121
             +++D +   +           R+  +TGGEPL Q    + ++ L   G+++++ET+G 
Sbjct: 63  QWHDIDAIVAEV------ASHGVRHVCVTGGEPLAQKRCLVLLEKLCDAGYDVSLETSGA 116

Query: 122 IEPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQVNVSP------EN 162
           ++       +       +P +G + + +           ++K V                
Sbjct: 117 LDVSAVDPRVSRVVDIKTPGSGEEARNRWENLPLLTARDQIKFVICSRADYEWSREIVAA 176

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +           P           LA          R  +Q HK +
Sbjct: 177 HALDRRCTVWFSPSKSEVSPR--QLADWIVADRLPVRFQMQLHKLL 220


>gi|325929354|ref|ZP_08190484.1| organic radical activating enzyme [Xanthomonas perforans 91-118]
 gi|325540266|gb|EGD11878.1| organic radical activating enzyme [Xanthomonas perforans 91-118]
          Length = 227

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 45/226 (19%), Positives = 76/226 (33%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIFL+LQGE   AG   VF R +GC L           +C +CDT +       G
Sbjct: 17  RLKITEIFLSLQGEAEAAGWPTVFVRLTGCPL-----------RCLYCDTAYAFH---GG 62

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGT 121
             +++D +   +           R+  +TGGEPL Q    + ++ L   G+++++ET+G 
Sbjct: 63  QWHDIDAIVAEV------ASHGVRHVCVTGGEPLAQKRCLVLLEKLCDAGYDVSLETSGA 116

Query: 122 IEPPQGID-------WICVSPKAGCDLKIKG------GQELKLVFPQVNVSP------EN 162
           ++                 +       + +         ++K V                
Sbjct: 117 LDVSAVDPRVSRVVDIKTPASGEEARNRWENLPLLTARDQIKFVICSRADYEWSREIVAA 176

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +           P           LA          R  +Q HK +
Sbjct: 177 HALDRRCTVWFSPSKSEVSPR--QLADWIVADRLPVRFQMQLHKLL 220


>gi|54294940|ref|YP_127355.1| hypothetical protein lpl2019 [Legionella pneumophila str. Lens]
 gi|53754772|emb|CAH16259.1| hypothetical protein lpl2019 [Legionella pneumophila str. Lens]
          Length = 217

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 49/232 (21%), Positives = 83/232 (35%), Gaps = 46/232 (19%)

Query: 1   MKL----YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVG 56
           MK       I EIF +LQGE    G + VF R +GC L           +C++CDT +  
Sbjct: 1   MKRFNEQLRITEIFHSLQGESVTVGLLTVFVRLTGCPL-----------RCQYCDTAYAF 49

Query: 57  IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIA 115
              + G    +D + + +         + ++  +TGGEPL Q   +PL+  L   G+ ++
Sbjct: 50  ---SGGEVVEIDDILNKV------ASYQCQHVCVTGGEPLAQPGCIPLLSKLCDAGYSVS 100

Query: 116 VETNGTIEPPQGIDWICVSPK-------------AGCDLKIKGGQELKLVFPQVNVSPE- 161
           +ET+G  +       + +                      +K   ++K V          
Sbjct: 101 LETSGARDIASVDQRVMIVMDLKTPDSREADKNLLSNLSFLKPTDQIKFVLCSRTDYEWA 160

Query: 162 -----NYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                 Y   +  +    P         T+LA          R  +Q HK +
Sbjct: 161 CSMLSEYQLAERVQLLFSPSWNQLNP--TDLANWIIQDKLPVRFQLQLHKIL 210


>gi|119504267|ref|ZP_01626347.1| putative radical activating enzyme [marine gamma proteobacterium
           HTCC2080]
 gi|119459775|gb|EAW40870.1| putative radical activating enzyme [marine gamma proteobacterium
           HTCC2080]
          Length = 219

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 47/226 (20%), Positives = 78/226 (34%), Gaps = 43/226 (19%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             I EIF +LQGE    G   VF R +GC L           +C +CDT++    G    
Sbjct: 9   LRITEIFHSLQGEARSVGLPTVFVRLTGCPL-----------RCVWCDTEYAFSGGK--- 54

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNGTI 122
                 +  L +              +TGGEPL Q + +PL++ L   G+E+++ET+G +
Sbjct: 55  ------ILALTQILQQIKSFSCPRVCVTGGEPLAQPESLPLLKQLCDEGYEVSLETSGAL 108

Query: 123 EPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQV-----------NVSPENYIGFDFERF 171
                   +            +  + L     ++           +    ++  F  +  
Sbjct: 109 PIADVDRRVSRVMDLKAPDSGESHRNLWDNIAELTPHDQIKFVISSRRDYDWARFKVDEL 168

Query: 172 SL---------QPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +L          P  G        LA          R  +Q HK +
Sbjct: 169 ALAGRVGDILFSPTHGELQPR--ELAEWLLQDRVPGRFQLQLHKLL 212


>gi|104783064|ref|YP_609562.1| radical activating enzyme [Pseudomonas entomophila L48]
 gi|95112051|emb|CAK16778.1| putative radical activating enzyme [Pseudomonas entomophila L48]
          Length = 215

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 50/230 (21%), Positives = 85/230 (36%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I E+F +LQGE   AG   VF R +GC L           +C++CD+ +     
Sbjct: 1   MQDTLRITEVFYSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAF--- 46

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
           + G    +D + + +         + RY  +TGGEPL Q + +PL+Q L   G+E+++ET
Sbjct: 47  SGGTVRTLDSILEQV------AGFKPRYVCVTGGEPLAQPNALPLLQRLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIK------GGQELKLVFPQVNVSPENYIG 165
           +G ++       +           +     + +         ++K V             
Sbjct: 101 SGALDIAGTDTRVSRVVDLKTPGSEESHRNRYENIELLTRNDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                           P         T+LA      N   R  +Q HK +
Sbjct: 161 LIQFNLAERAGEVLFSP--SHHQVSATDLADWIVADNLPVRFQLQLHKLL 208


>gi|312623403|ref|YP_004025016.1| Radical SAM domain-containing protein [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312203870|gb|ADQ47197.1| Radical SAM domain protein [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 225

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 57/226 (25%), Positives = 93/226 (41%), Gaps = 41/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            +++ E F++++GEG  +G  AVF RF+GCNL           +C +CDT +   +  + 
Sbjct: 13  KFNVVEKFVSIEGEGIRSGYPAVFVRFAGCNL-----------RCSWCDTKYAN-ENPEY 60

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNG- 120
              ++D L + I    I      +   LTGGEPL+Q     LI  L   GFE+ +ETNG 
Sbjct: 61  EEIDIDNLMNFITSTGI------KRVTLTGGEPLIQPYIYLLIDRLISEGFEVNIETNGS 114

Query: 121 ------TIEPPQGIDWICVSPKAGCDLKIKGGQEL--KLVFPQVNVSPENYIGFD----- 167
                   +    +D+ C S      + +     L  K V   V  + E+    +     
Sbjct: 115 VSIKHVPRDAIITMDYKCPSSGMEHRMIVNNIHLLGEKDVIKFVVATYEDLKTAERIIKT 174

Query: 168 ---FERFSLQPMDGPFLEENTNLAISYCFQNP--KWRLSVQTHKFI 208
                     P+ G          + +  +N   + R+ +Q HK I
Sbjct: 175 FKPRCNIYFSPVFGKIEPR---EIVKFVLENGLFEARVQLQLHKII 217


>gi|326573561|gb|EGE23524.1| radical SAM superfamily protein [Moraxella catarrhalis 101P30B1]
          Length = 246

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 54/232 (23%), Positives = 88/232 (37%), Gaps = 47/232 (20%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + EIF +LQGE   AG   +F R +GC L           +C +CDT +     + G 
Sbjct: 28  LKLTEIFYSLQGEALTAGLPTIFIRLTGCPL-----------RCHYCDTTYSF---SGGE 73

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNGTI 122
           R+ +D +   I +             +TGGEPL Q + + L+  L + G+E+++ET G +
Sbjct: 74  RWGLDDIMTHIAQ------YPCWRVCVTGGEPLAQPNAIALMHKLIQSGYEVSLETAGAL 127

Query: 123 EPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQV-------NVSPEN 162
                   +       SP +G   K             ++K+V           N+  ++
Sbjct: 128 SVANVPPLVSKVMDLKSPSSGEADKNLWENLAHLTLHDQIKIVIANRTDYEWAKNIITKH 187

Query: 163 YIGFDFERFSLQPMDG------PFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
            +        L PM           +  T+LA          R  +Q HK I
Sbjct: 188 ALDDKVGTIWLSPMFNIQENTSHAPKLATDLAEWILKDALPVRFGLQLHKII 239


>gi|90022171|ref|YP_527998.1| putative radical activating enzyme [Saccharophagus degradans 2-40]
 gi|89951771|gb|ABD81786.1| Radical SAM [Saccharophagus degradans 2-40]
          Length = 216

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 50/226 (22%), Positives = 86/226 (38%), Gaps = 47/226 (20%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             I EIF +LQGE    G   VF R +GC L           +C +CD+++       G 
Sbjct: 6   LRITEIFHSLQGEARTVGLPTVFVRLTGCPL-----------RCHYCDSEYAFH---GGE 51

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNGTI 122
           R + +Q+ + +           +Y  +TGGEPL Q   + L+  L   G+ +++ET+G +
Sbjct: 52  RLSFEQILEQV------AGFGAKYVCVTGGEPLAQPGCIDLLSRLCDLGYNVSLETSGAM 105

Query: 123 EPPQGIDWICV-----SPKAGCDLKI--------KGGQELKLVFPQVNVSPENYIGFDFE 169
           +  +    + +     +P +G   K         K   ++K V         ++  F  +
Sbjct: 106 DVSKVDHRVSIVLDLKTPASGEQDKNLYTNIPLLKLKDQVKFVICDRG--DYDWARFQLD 163

Query: 170 RFSL---------QPMDGPFLEENTNLAISYCFQNPKWRLSVQTHK 206
           +  L          P       +   LA          R  +Q HK
Sbjct: 164 QLQLVSKVGDVLFSPSFEQLAPK--QLAEWILDDRLPVRFQMQLHK 207


>gi|330834175|ref|YP_004408903.1| radical SAM domain-containing protein [Metallosphaera cuprina Ar-4]
 gi|329566314|gb|AEB94419.1| radical SAM domain-containing protein [Metallosphaera cuprina Ar-4]
          Length = 210

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 65/230 (28%), Positives = 99/230 (43%), Gaps = 40/230 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y I EIF ++QGEG   GR + F R +GCNL           +C +CDT    ++   
Sbjct: 1   MRYWIVEIFTSIQGEGTLIGRPSNFVRLAGCNL-----------RCVWCDTKNSWMREDG 49

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
                  ++ D++ +         ++  +TGGEPLLQ  +PL  +L  +GF +A+ETNGT
Sbjct: 50  ----EPMEIEDILSKL----STSVKWTTITGGEPLLQDILPLAVSLKNKGFRVAIETNGT 101

Query: 122 IEPPQG----IDWICVSPK---AGCDLKIKGGQEL----KLVFPQVNVSPENYIGF---- 166
           ++P       +D   VSPK   +G  LK     +     K V        +    F    
Sbjct: 102 LKPKPELRKVVDIFSVSPKLLNSGHRLKYDFSDDWATYYKFVIVNAKEDLKEVKDFVDRQ 161

Query: 167 --DFERFSLQPMDGPFLE--ENTNLAISYCFQ-NPKWRLSVQTHKFIGIR 211
             D E+  +QP DG  L+             +    +R+  Q H+ I  R
Sbjct: 162 HIDPEKVIVQP-DGNRLDYVYALRELSDAVMELGLPFRVLPQLHRIISYR 210


>gi|308273462|emb|CBX30064.1| hypothetical protein N47_D28730 [uncultured Desulfobacterium sp.]
          Length = 219

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 56/229 (24%), Positives = 86/229 (37%), Gaps = 44/229 (19%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M L  I EIF ++QGE  ++G    F R +GCNL           +C +CDT +   +G+
Sbjct: 6   MTLL-INEIFYSIQGESLYSGLPCAFIRLAGCNL-----------RCAYCDTKYAYNEGS 53

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETN 119
           +      D L   I E             +TGGEPL+Q + P+ I+ L    F + +ETN
Sbjct: 54  E---IETDHLVKKISE------FGCPLVEITGGEPLIQEETPVLIEKLLDNKFSVLLETN 104

Query: 120 G-------TIEPPQGIDWICVSPKAGCD------LKIKGGQELKLVFPQV-------NVS 159
           G            + ID  C +             ++    ++K V           ++ 
Sbjct: 105 GSLDISYIDKRCIKIIDIKCPTSGESEKNNLANINRLNQKDQIKFVIGNRVDYEFAKDIV 164

Query: 160 PENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
            +    F  E     P+      E + LA          R  +Q HK I
Sbjct: 165 KQIPKTFFRENILFSPIYNKL--ELSELARWMLKDKLTVRFHLQLHKII 211


>gi|326560168|gb|EGE10557.1| radical SAM superfamily protein [Moraxella catarrhalis 103P14B1]
 gi|326564255|gb|EGE14489.1| radical SAM superfamily protein [Moraxella catarrhalis 46P47B1]
 gi|326566195|gb|EGE16348.1| radical SAM superfamily protein [Moraxella catarrhalis 12P80B1]
 gi|326571649|gb|EGE21664.1| radical SAM superfamily protein [Moraxella catarrhalis BC7]
 gi|326573039|gb|EGE23015.1| radical SAM superfamily protein [Moraxella catarrhalis CO72]
          Length = 238

 Score =  138 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 54/232 (23%), Positives = 88/232 (37%), Gaps = 47/232 (20%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + EIF +LQGE   AG   +F R +GC L           +C +CDT +     + G 
Sbjct: 20  LKLTEIFYSLQGEALTAGLPTIFIRLTGCPL-----------RCHYCDTTYSF---SGGE 65

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNGTI 122
           R+ +D +   I +             +TGGEPL Q + + L+  L + G+E+++ET G +
Sbjct: 66  RWGLDDIMTHIAQ------YPCWRVCVTGGEPLAQPNAIALMHKLIQSGYEVSLETAGAL 119

Query: 123 EPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQV-------NVSPEN 162
                   +       SP +G   K             ++K+V           N+  ++
Sbjct: 120 SVANVPPLVSKVMDLKSPSSGEADKNLWENLAHLTLHDQIKIVIANRTDYEWAKNIITKH 179

Query: 163 YIGFDFERFSLQPMDG------PFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
            +        L PM           +  T+LA          R  +Q HK I
Sbjct: 180 ALDDKVGTIWLSPMFNIQENTSHAPKLATDLAEWILKDALPVRFGLQLHKII 231


>gi|330959274|gb|EGH59534.1| radical SAM domain-containing protein [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 215

 Score =  138 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 54/230 (23%), Positives = 85/230 (36%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I EIF +LQGE   AG   VF R +GC L           +C++CD+ +    G
Sbjct: 1   MQDTLRITEIFHSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAFSGG 49

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
                  V  L D+IE+         RY  +TGGEPL Q + +PL++ L   G+E+++ET
Sbjct: 50  ------TVQALDDIIEQ---VASYRPRYVCVTGGEPLAQPNAIPLLKRLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIKG------GQELKLVFPQVNVSPENYIG 165
           +G ++       +           K     + +         ++K V             
Sbjct: 101 SGALDISAVDPRVSRVVDLKTPGSKEVARNRYENIELLTPNDQVKFVLCSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                                   +  +LA      N   RL +Q HK +
Sbjct: 161 LIQYGLDRRAGEVLFS--ASHHELKGRDLADWIVADNLPVRLQMQLHKIL 208


>gi|198282218|ref|YP_002218539.1| Radical SAM domain-containing protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218667706|ref|YP_002424583.1| radical SAM domain protein [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198246739|gb|ACH82332.1| Radical SAM domain protein [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218519919|gb|ACK80505.1| radical SAM domain protein [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 214

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 54/226 (23%), Positives = 82/226 (36%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIF +LQGE    GR A F R +GC L           +CR+CDT +    G   
Sbjct: 4   RLRITEIFHSLQGETRSVGRPATFVRLTGCPL-----------RCRYCDTAYAFHGGEW- 51

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPL-LQVDVPLIQALNKRGFEIAVETNGT 121
                 ++ +++E+         R  V+TGGEPL     +PL+  L   G E+ +ET+G 
Sbjct: 52  -----RRIPEILEQ---VRAGGNRLVVVTGGEPLAQADVLPLMTQLCDAGHEVFLETSGA 103

Query: 122 IEPPQGIDWIC-----VSPKAGCDLKI--------KGGQELKLV------FPQVNVSPEN 162
           +        +       SP +G   +             ++K V      +         
Sbjct: 104 LSLAGVDTRVVKVLDLKSPDSGECERNLWENLPLLNPQDQIKFVLCSRADYDWAKEVLAR 163

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
               +       P  G     +  LA      +   RL +Q HK I
Sbjct: 164 EALAERCEILFSPSHGTLALRD--LAEWMLADHLPVRLQIQLHKLI 207


>gi|258646637|ref|ZP_05734106.1| putative sigma-54 dependent DNA-binding response regulator
           [Dialister invisus DSM 15470]
 gi|260404058|gb|EEW97605.1| putative sigma-54 dependent DNA-binding response regulator
           [Dialister invisus DSM 15470]
          Length = 219

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 53/231 (22%), Positives = 85/231 (36%), Gaps = 43/231 (18%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           MK  + + EIF ++ GEG   G +AVF RF+GCN            +C +CDT +   + 
Sbjct: 1   MKNKFPVAEIFDSIDGEGKRTGYMAVFVRFAGCN-----------IRCTYCDTAYALKES 49

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETN 119
                   ++L   I           +    TGGEPLL     +   L + G+EI +ETN
Sbjct: 50  DAEEFLTKEELLGRI------RSYPWKRITFTGGEPLLHPLQEICDILGEEGYEINIETN 103

Query: 120 GTIEPPQ--------GIDWICVSPKAGCDLKIKGGQEL------------KLVFPQVNVS 159
           G +             +D+ C        +++   +EL            K     +   
Sbjct: 104 GAVPLLARRSQNLFYTMDYKCTDSGMKSFMRLPNLKELTEEDVLKFVVSSKTDLEDMKEI 163

Query: 160 PENYIGFDFERFSLQPMDGPFLEENTNLAISYCF--QNPKWRLSVQTHKFI 208
              Y      +F + P+ G          + Y    +  +  + VQ HK I
Sbjct: 164 IIKYFPRGGPKFYVSPVWGKIEPR---ELVEYVRKEKLAEVCVQVQLHKII 211


>gi|84623212|ref|YP_450584.1| radical activating enzyme [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|84367152|dbj|BAE68310.1| radical activating enzyme [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 227

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 76/226 (33%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIFL+LQGE   AG   VF R +GC L           +C +CDT +       G
Sbjct: 17  RLKITEIFLSLQGEAEAAGWPTVFVRLTGCPL-----------RCVYCDTAYAFH---GG 62

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGT 121
             +++D +   +           R+  +TGGEPL Q    + +Q L   G+++++ET+G 
Sbjct: 63  EWHDIDDVLAEV------ATHGVRHVCVTGGEPLAQKRCLVLLQKLCDAGYDVSLETSGA 116

Query: 122 IEPPQGID-------WICVSPKAGCDLKIKG------GQELKLVFPQVNVSP------EN 162
           ++                 +       + +         ++K V                
Sbjct: 117 LDVSAVDPRVSRVVDIKTPASGEEARNRWENLLLLTARDQIKFVICSRADYEWSREIVAA 176

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +           P           LA          R  +Q HK +
Sbjct: 177 HALDRRCTVWFSPSKSEVGPR--QLADWIVADRLPVRFQMQLHKLL 220


>gi|254167036|ref|ZP_04873889.1| radical SAM domain protein, putative [Aciduliprofundum boonei T469]
 gi|197623892|gb|EDY36454.1| radical SAM domain protein, putative [Aciduliprofundum boonei T469]
          Length = 209

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 58/224 (25%), Positives = 97/224 (43%), Gaps = 43/224 (19%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            + EIF ++QGEG + G    F R +GCNL           +C +CDT++   +   G  
Sbjct: 2   KVNEIFTSIQGEGIYIGVSMFFVRLTGCNL-----------RCEWCDTEYAFYE---GEE 47

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDV-PLIQALNKRGFEIAVETNGTIE 123
            ++D +   +EE         ++  +TGGEPLLQ +V  LI  L ++ ++I +ETNG+I 
Sbjct: 48  MSIDSIIKKVEE------SGMKWVCITGGEPLLQEEVYKLIDILLRKDYKILLETNGSIL 101

Query: 124 PPQ---------GIDWICVSPKAGCDLKIKGGQEL------KLVFPQVNV---SPENYIG 165
             +          +D    S K    ++ +    L      K V    N    + +    
Sbjct: 102 IDKLPTEENLVISLDIKTPSSKMERAMRFENLNYLGPKDFVKFVIMDENDFEYAKKIIEK 161

Query: 166 FDFER-FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           ++ ++    QP+ G  L+    LA     +    R+  Q HK I
Sbjct: 162 YEIDKEIIFQPVGGTNLKW---LAEKVVEEKLNVRVLPQLHKII 202


>gi|218781985|ref|YP_002433303.1| radical SAM domain protein [Desulfatibacillum alkenivorans AK-01]
 gi|218763369|gb|ACL05835.1| Radical SAM domain protein [Desulfatibacillum alkenivorans AK-01]
          Length = 215

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 58/229 (25%), Positives = 88/229 (38%), Gaps = 44/229 (19%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               + EIF  +QGE  + G   VF R SGCNL           +CR+CDT +       
Sbjct: 1   MALDVCEIFYGIQGESTYQGMPCVFIRLSGCNL-----------RCRWCDTGYAY---DA 46

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVETNG 120
           G   ++ ++ +        G+       +TGGEPLLQ + P L+ A    G  + +ETNG
Sbjct: 47  GLTMSISEIME------KAGQFGCPIVEVTGGEPLLQKETPALVDAFLNIGLLVLLETNG 100

Query: 121 TIE-------PPQGIDWICVSPKA------GCDLKIKGGQELKLVF--------PQVNVS 159
           + +         + +D  C S             ++    ELK V          +  V 
Sbjct: 101 SQDIAKVDSRCIRIVDVKCPSSGMEEHNDYSNLSRMTEKDELKFVIASREDYEFARKRVR 160

Query: 160 PENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
             ++ G         P+ G    +   LA        + RL +Q HKFI
Sbjct: 161 LLDFDGCRMNAIHFSPVFGELDPK--TLAEWILQDRLEVRLHLQMHKFI 207


>gi|166712980|ref|ZP_02244187.1| radical activating enzyme [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 227

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 76/226 (33%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIFL+LQGE   AG   VF R +GC L           +C +CDT +       G
Sbjct: 17  RLKITEIFLSLQGEAEAAGWPTVFVRLTGCPL-----------RCVYCDTAYAFH---GG 62

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGT 121
             +++D +   +           R+  +TGGEPL Q    + +Q L   G+++++ET+G 
Sbjct: 63  EWHDIDDVLAEV------ATHGVRHVCVTGGEPLAQKRCLVLLQKLCDAGYDVSLETSGA 116

Query: 122 IEPPQGID-------WICVSPKAGCDLKIKG------GQELKLVFPQVNVSP------EN 162
           ++                 +       + +         ++K V                
Sbjct: 117 LDVSTVDPRVSRVVDIKTPASGEEARNRWENLPLLTARDQIKFVICSRADYEWSREIVAA 176

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +           P           LA          R  +Q HK +
Sbjct: 177 HALDRRCTVWFSPSKSEVGPR--QLADWIVADRLPVRFQMQLHKLL 220


>gi|167035186|ref|YP_001670417.1| radical SAM domain-containing protein [Pseudomonas putida GB-1]
 gi|166861674|gb|ABZ00082.1| Radical SAM domain protein [Pseudomonas putida GB-1]
          Length = 215

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 51/230 (22%), Positives = 93/230 (40%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I E+F +LQGE   AG   VF R +GC L           +C++CD+ +     
Sbjct: 1   MQDTLRITEVFYSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAF--- 46

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
           + G    +D + + +         + RY  +TGGEPL Q + +PL+Q L   G+E+++ET
Sbjct: 47  SGGTLRTLDSILEQV------AGFKPRYVCVTGGEPLAQPNALPLLQRLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIK------GGQELKLVFPQVNVSPENYIG 165
           +G ++       +           +     + +         ++K V         ++  
Sbjct: 101 SGALDITGTDTRVSRVVDLKTPGSEESHRNRYENIEQLTRNDQVKFVICSR--EDYDWAV 158

Query: 166 FDFERFSLQPMDGPFL-------EENTNLAISYCFQNPKWRLSVQTHKFI 208
               +++L    G  L        + ++LA      N   R  +Q HK +
Sbjct: 159 SKLIQYNLSERAGEVLFSPSHHQVKASDLADWIVADNLPVRFQLQLHKLL 208


>gi|225874258|ref|YP_002755717.1| radical SAM domain protein [Acidobacterium capsulatum ATCC 51196]
 gi|225791949|gb|ACO32039.1| radical SAM domain protein [Acidobacterium capsulatum ATCC 51196]
          Length = 226

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 55/236 (23%), Positives = 91/236 (38%), Gaps = 51/236 (21%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            + EI+ ++QGE   AGR  +F R +GCNL           +C +CD+++       G  
Sbjct: 2   RLIEIYKSVQGESSFAGRPCIFVRLAGCNL-----------RCSWCDSEYTFT---GGEA 47

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQ--VDVPLIQALNKRGFEIAVETNGTI 122
           ++ D++   IE          R    TGGEPLLQ    +P ++ L   G+E+ +ET+G  
Sbjct: 48  FSDDEILARIEALAPV-----RLVEFTGGEPLLQAKQLIPFMERLLAAGYELMIETSGER 102

Query: 123 EPPQGIDWI-----CVSPKAGCDLKI--------KGGQELKLVFPQ-------VNVSPEN 162
              +    +        P +G   K             E+K V                +
Sbjct: 103 PLREVPAAVHKIVDVKCPGSGEAGKFLMENLEFLTPRDEVKFVIADRADYEFAREFLRAH 162

Query: 163 YIGFDFERFSLQPMDGP--FLEENT-------NLAISYCFQN-PKWRLSVQTHKFI 208
            +     +  L P        E +T        L + +  ++    RLS+Q HK+I
Sbjct: 163 ALDRKAGQILLSPTFSKTPTPERSTSNATLDPRLLVEWMLEDGLPARLSLQIHKYI 218


>gi|326569745|gb|EGE19795.1| radical SAM superfamily protein [Moraxella catarrhalis BC8]
          Length = 238

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 54/232 (23%), Positives = 88/232 (37%), Gaps = 47/232 (20%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + EIF +LQGE   AG   +F R +GC L           +C +CDT +     + G 
Sbjct: 20  LKLTEIFYSLQGEALTAGLPTIFIRLTGCPL-----------RCHYCDTTYSF---SGGE 65

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNGTI 122
           R+ +D +   I +             +TGGEPL Q + + L+  L + G+E+++ET G +
Sbjct: 66  RWGLDDIMTHIAQ------YPCWRVCVTGGEPLAQPNAITLMHKLIQSGYEVSLETAGAL 119

Query: 123 EPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQV-------NVSPEN 162
                   +       SP +G   K             ++K+V           N+  ++
Sbjct: 120 SVANVPPLVSKVMDLKSPSSGEADKNLWENLAHLTLHDQIKIVIANRTDYEWAKNIITKH 179

Query: 163 YIGFDFERFSLQPMDG------PFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
            +        L PM           +  T+LA          R  +Q HK I
Sbjct: 180 ALDDKVGTIWLSPMFNIQENTSHAPKLATDLAEWILKDALPVRFGLQLHKII 231


>gi|218961765|ref|YP_001741540.1| Radical SAM [Candidatus Cloacamonas acidaminovorans]
 gi|167730422|emb|CAO81334.1| Radical SAM [Candidatus Cloacamonas acidaminovorans]
          Length = 209

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 60/228 (26%), Positives = 88/228 (38%), Gaps = 41/228 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
           K  ++ EIF +LQGE  ++G   +F R S CNL           +C +CDT +   +G  
Sbjct: 3   KHLNVTEIFYSLQGESAYSGYPCIFIRLSECNL-----------RCVYCDTQYAFGKGK- 50

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNG 120
                   ++ ++EE     +       +TGGEPLLQ D   L + L+K  ++I +ETNG
Sbjct: 51  -----SMAISSIMEE---VKKYPCSLTEITGGEPLLQEDVDALFEELHKSSYKILLETNG 102

Query: 121 TI--EPPQGIDWICVSPKAGCD-----------LKIKGGQELKLVFPQVN-----VSPEN 162
            I  E         V  K                 +    ELK V    N     +S   
Sbjct: 103 AISLEKVPDYVIKIVDVKTPGSGMVDAFLKDNLDYLNDKDELKFVLTDKNDYQFALSFLA 162

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGI 210
                       P+      +   LA        K +L++Q HK IGI
Sbjct: 163 QYKPKVNIIHFSPLTEVLEPK--ELAKWMLKDGIKAKLTLQLHKIIGI 208


>gi|296112585|ref|YP_003626523.1| radical SAM superfamily protein [Moraxella catarrhalis RH4]
 gi|295920279|gb|ADG60630.1| radical SAM superfamily protein [Moraxella catarrhalis RH4]
 gi|326561347|gb|EGE11705.1| radical SAM superfamily protein [Moraxella catarrhalis 7169]
 gi|326570776|gb|EGE20801.1| radical SAM superfamily protein [Moraxella catarrhalis BC1]
 gi|326577706|gb|EGE27582.1| radical SAM superfamily protein [Moraxella catarrhalis O35E]
          Length = 266

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 54/232 (23%), Positives = 88/232 (37%), Gaps = 47/232 (20%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + EIF +LQGE   AG   +F R +GC L           +C +CDT +     + G 
Sbjct: 48  LKLTEIFYSLQGEALTAGLPTIFIRLTGCPL-----------RCHYCDTTYSF---SGGE 93

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNGTI 122
           R+ +D +   I +             +TGGEPL Q + + L+  L + G+E+++ET G +
Sbjct: 94  RWGLDDIMTHIAQ------YPCWRVCVTGGEPLAQPNAIALMHKLIQSGYEVSLETAGAL 147

Query: 123 EPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQV-------NVSPEN 162
                   +       SP +G   K             ++K+V           N+  ++
Sbjct: 148 SVANVPPLVSKVMDLKSPSSGEADKNLWENLAHLTLHDQIKIVIANRTDYEWAKNIITKH 207

Query: 163 YIGFDFERFSLQPMDG------PFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
            +        L PM           +  T+LA          R  +Q HK I
Sbjct: 208 ALDDKVGTIWLSPMFNIQENTSHAPKLATDLAEWILKDALPVRFGLQLHKII 259


>gi|78048825|ref|YP_365000.1| putative radical activating enzyme [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78037255|emb|CAJ25000.1| putative radical activating enzyme [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 227

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 45/226 (19%), Positives = 76/226 (33%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIFL+LQGE   AG   VF R +GC L           +C +CDT +       G
Sbjct: 17  RLKITEIFLSLQGEAEAAGWPTVFVRLTGCPL-----------RCLYCDTAYAFH---GG 62

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGT 121
             +++D +   +           R+  +TGGEPL Q    + ++ L   G+++++ET+G 
Sbjct: 63  QWHDIDAIVAEV------ASHGVRHVCVTGGEPLAQKRCLVLLEKLCDAGYDVSLETSGA 116

Query: 122 IEPPQGID-------WICVSPKAGCDLKIKG------GQELKLVFPQVNVSP------EN 162
           ++                 +       + +         ++K V                
Sbjct: 117 LDVSAVDPRVSRVVDIKTPASGEEARNRWENLPLLTARDQIKFVICSRVDYEWSREIVAA 176

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +           P           LA          R  +Q HK +
Sbjct: 177 HTLDRRCTVWFSPSKSEVSPR--QLADWIVADRLPVRFQMQLHKLL 220


>gi|294665414|ref|ZP_06730702.1| radical activating enzyme [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292604825|gb|EFF48188.1| radical activating enzyme [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 227

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 47/226 (20%), Positives = 80/226 (35%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIFL+LQGE   AG   VF R +GC L           +C +CDT +       G
Sbjct: 17  RLKITEIFLSLQGEAEAAGWPTVFVRLTGCPL-----------RCLYCDTAYAFH---GG 62

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGT 121
             +++D +   +           R+  +TGGEPL Q    + ++ L   G+++++ET+G 
Sbjct: 63  QWHDIDAIVAEV------ASHGVRHVCVTGGEPLAQKRCLVLLEKLCDAGYDVSLETSGA 116

Query: 122 IEPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLVFPQVNVSP------EN 162
           ++       +       +P +G + +             ++K V                
Sbjct: 117 LDVSAVDPRVSRVVDIKTPGSGEEARNCWENLPLLTARDQIKFVICSRADYEWSREIVAA 176

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +           P           LA          R  +Q HK +
Sbjct: 177 HALDRRCTVWFSPSKSEVSPR--QLADWIVADRLPVRFQMQLHKLL 220


>gi|220917757|ref|YP_002493061.1| Radical SAM domain protein [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219955611|gb|ACL65995.1| Radical SAM domain protein [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 210

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 59/221 (26%), Positives = 86/221 (38%), Gaps = 41/221 (18%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            + EIF ++QGEG  AGR  VF RF+GC+L           +C +CDT +       G  
Sbjct: 2   RVTEIFFSIQGEGSRAGRPCVFVRFTGCDL-----------RCGYCDTAYAFH---GGAD 47

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVETNGTIE 123
            +   +   +           R+  LTGGEP+LQ ++P L + L  RG+E+AVET+G   
Sbjct: 48  MDRAAILAEVAR------HPARFVCLTGGEPMLQRELPDLARELLARGYEVAVETHGQRP 101

Query: 124 PP--QGIDWICVSPKAGCD----------LKIKGGQELKLVFPQVN---VSPENYIGFDF 168
                      V  K               +++   E+K V    +    S E       
Sbjct: 102 LDALPAEAIRVVDVKTPGSGEVATDLAYLDRLQPHDEVKFVVCSEDDFRWSREVVRRHAL 161

Query: 169 E---RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHK 206
           E   +    P  G     +  L           RLS+Q HK
Sbjct: 162 EGRVQVLFSPAWGQVAPRD--LVRWMLESGLDARLSLQVHK 200


>gi|71065297|ref|YP_264024.1| radical activating enzyme [Psychrobacter arcticus 273-4]
 gi|71038282|gb|AAZ18590.1| probable radical activating enzyme [Psychrobacter arcticus 273-4]
          Length = 244

 Score =  137 bits (346), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 50/238 (21%), Positives = 80/238 (33%), Gaps = 53/238 (22%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             + EIF +LQGE   +G   +F R +GC L           +C +CDT++     + G 
Sbjct: 20  LRLTEIFYSLQGEALTSGLPTIFVRLTGCPL-----------RCVYCDTEYAF---SGGE 65

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNGTI 122
           R +++ +   I           +   LTGGEPL Q + + L++ L   G+EI++ET G +
Sbjct: 66  RQSLETMMATI------ASFPCKRICLTGGEPLAQPNAIELMKRLLNDGYEISLETAGAL 119

Query: 123 -------EPPQGIDWICVSPKAGCDLKIKG------GQELKLVFPQVNVSPENYIGFDFE 169
                     + +D    S                   ++K V                 
Sbjct: 120 TVENVPPTVSKVMDLKTPSSGEVDKNLWSNLDYLTQHDQIKFVIMNRADYDWAKAKLVEY 179

Query: 170 RF-------SLQPMDGPFLEE------------NTNLAISYCFQNPKWRLSVQTHKFI 208
           +           PM     E+               LA          R  +Q HK I
Sbjct: 180 KLNELVGTVWFSPMFNVAHEDTVNDNSPEVPVLARELAEWMLADALPVRFQLQLHKII 237


>gi|331016448|gb|EGH96504.1| radical SAM domain protein [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 215

 Score =  137 bits (346), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 83/230 (36%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I EIF +LQGE   AG   VF R +GC L           +C++CD+ +    G
Sbjct: 1   MQETLRITEIFHSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAFSGG 49

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
                  +  L D+I           RY  +TGGEPL Q + +PL++ L   G+E+++ET
Sbjct: 50  ------TIQTLDDII---GQVASYRPRYVCVTGGEPLAQPNAIPLLKRLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIKGG------QELKLVFPQVNVSPENYIG 165
           +G ++       +           K     + +         ++K V             
Sbjct: 101 SGALDISAVDPRVSRVVDLKTPGSKEVARNRYENMALLTPNDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                                   +  +LA      N   RL +Q HK +
Sbjct: 161 LIQYGLDRRAGEVLFS--ASHHELKGRDLADWIVADNLPVRLQMQLHKIL 208


>gi|312128624|ref|YP_003993498.1| Radical SAM domain-containing protein [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311778643|gb|ADQ08129.1| Radical SAM domain protein [Caldicellulosiruptor hydrothermalis
           108]
          Length = 225

 Score =  137 bits (346), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 56/226 (24%), Positives = 91/226 (40%), Gaps = 41/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            +++ E F++++GEG  +G  AVF RF+GCNL           +C +CDT +   +  + 
Sbjct: 13  KFNVVEKFVSIEGEGIRSGYPAVFVRFAGCNL-----------RCSWCDTKYAN-ENPEY 60

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNG- 120
              ++D L + I    I      +   LTGGEPL+Q     LI  L   GFE+ +ETNG 
Sbjct: 61  EEIDIDNLMNFITSTGI------KRVTLTGGEPLIQPYIYLLIDRLISEGFEVNIETNGS 114

Query: 121 ------TIEPPQGIDWICVSPKAGCDLKIKG------GQELKLV---FPQVNVSPENYIG 165
                   +    +D+ C S      + +           LK V   +  +  +      
Sbjct: 115 VSIKHVPRDAIITMDYKCPSSGMEDRMIVDNIHFLGQKDVLKFVVSTYEDLKTAERIIKT 174

Query: 166 FDF-ERFSLQPMDGPFLEENTNLAISYCFQNP--KWRLSVQTHKFI 208
           F         P+ G          + +  +N     R+ +Q HK I
Sbjct: 175 FKPRCNIFFSPVFGKIEPR---EIVKFVLENGLFDARVQLQLHKII 217


>gi|170723151|ref|YP_001750839.1| radical SAM domain-containing protein [Pseudomonas putida W619]
 gi|169761154|gb|ACA74470.1| Radical SAM domain protein [Pseudomonas putida W619]
          Length = 215

 Score =  137 bits (346), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 51/230 (22%), Positives = 87/230 (37%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I E+F +LQGE   AG   VF R +GC L           +C++CD+ +     
Sbjct: 1   MQDTLRITEVFYSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAF--- 46

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
           + G   ++D + + +         + RY  +TGGEPL Q + +PL+Q L   G+E+++ET
Sbjct: 47  SGGTVRSLDSIMEQV------AGFKPRYVCVTGGEPLAQPNALPLLQRLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWIC--VSPKAGCDLKIK-----------GGQELKLVFPQVNVSPENYIG 165
           +G ++       +   V  K     +                ++K V             
Sbjct: 101 SGALDISATDIRVSRVVDLKTPGSEESHRNLYENIEHLTRNDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                           P       + ++LA      N   R  +Q HK +
Sbjct: 161 LIQYNLAERAGEVLFSP--SHHQVKASDLADWIVADNLPVRFQLQLHKLL 208


>gi|319786288|ref|YP_004145763.1| radical SAM protein [Pseudoxanthomonas suwonensis 11-1]
 gi|317464800|gb|ADV26532.1| Radical SAM domain protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 219

 Score =  137 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 50/226 (22%), Positives = 84/226 (37%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              I EIFL+LQGE   AG   VF R +GC L           +C++CDT +       G
Sbjct: 9   RLRITEIFLSLQGEANAAGWPTVFVRLTGCPL-----------RCQYCDTAYAFH---GG 54

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNGT 121
             + +D +   +           R+  +TGGEPL Q   + L++ L   G ++++ET+G 
Sbjct: 55  QWWEIDAILAEVAR------HGVRHVCVTGGEPLAQKRCLDLLRRLCDAGHDVSLETSGA 108

Query: 122 IEPPQGIDWIC--VSPKAGCDLKIKGG-----------QELKLVFP-QVNVSPENYIGFD 167
           ++       +   V  K     ++               ++K V   + +      +  +
Sbjct: 109 LDIAGVDPRVSRVVDLKTPGSAEMARNRLENIPLLTARDQVKFVLCGRADYEWARDMVAE 168

Query: 168 F-----ERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                       P  G    E  +LA          R  +Q HK +
Sbjct: 169 HGLSARCDVLFSPSKGQL--EARDLADWIVADRLPVRFQMQLHKIL 212


>gi|257452357|ref|ZP_05617656.1| radical SAM domain-containing protein [Fusobacterium sp. 3_1_5R]
 gi|257465851|ref|ZP_05630162.1| radical SAM domain-containing protein [Fusobacterium gonidiaformans
           ATCC 25563]
 gi|315917008|ref|ZP_07913248.1| radical SAM domain-containing protein [Fusobacterium gonidiaformans
           ATCC 25563]
 gi|317058900|ref|ZP_07923385.1| radical SAM domain-containing protein [Fusobacterium sp. 3_1_5R]
 gi|313684576|gb|EFS21411.1| radical SAM domain-containing protein [Fusobacterium sp. 3_1_5R]
 gi|313690883|gb|EFS27718.1| radical SAM domain-containing protein [Fusobacterium gonidiaformans
           ATCC 25563]
          Length = 222

 Score =  137 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 54/234 (23%), Positives = 90/234 (38%), Gaps = 46/234 (19%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M  Y + EIF ++ GEG  AG++A+F RF  CNL            C +CDT +   + +
Sbjct: 1   MPKYKVVEIFESINGEGKKAGQLALFIRFQYCNLN-----------CSYCDTKWANSKNS 49

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDV--PLIQALNKRGFEIAVET 118
                +++++  L +E+ I      +   LTGGEPLLQ D+   L     ++ FEI +ET
Sbjct: 50  PFTWMSLEEILSLAKEKRI------KNITLTGGEPLLQTDIRSLLEAFSKEKQFEIEIET 103

Query: 119 NGTIE-----PPQGIDWICVSPKAGCDLKIK-----------GGQELKLV------FPQV 156
           NG++        +      +  K       +               +K V        + 
Sbjct: 104 NGSVPLETFRNIENSPSFTIDYKLPESHMEEYMSLENFSSVHRNDTVKFVVSNRKDLEKA 163

Query: 157 NVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQN--PKWRLSVQTHKFI 208
               E Y           P+ G          + +  ++      + +Q HKFI
Sbjct: 164 KEIIEQYSLIGKCAVYFSPVFGKI---ALPSIVDFMKEHHLNGVNMQLQMHKFI 214


>gi|213969194|ref|ZP_03397333.1| radical SAM domain protein [Pseudomonas syringae pv. tomato T1]
 gi|301384811|ref|ZP_07233229.1| radical SAM domain protein [Pseudomonas syringae pv. tomato Max13]
 gi|302063535|ref|ZP_07255076.1| radical SAM domain protein [Pseudomonas syringae pv. tomato K40]
 gi|302130601|ref|ZP_07256591.1| radical SAM domain protein [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|213926192|gb|EEB59748.1| radical SAM domain protein [Pseudomonas syringae pv. tomato T1]
          Length = 215

 Score =  137 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 51/230 (22%), Positives = 83/230 (36%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I EIF +LQGE   AG   VF R +GC L           +C++CD+ +    G
Sbjct: 1   MQETLRITEIFHSLQGETRTAGLPTVFIRLTGCPL-----------RCQYCDSAYAFSGG 49

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
                  +  L D++           RY  +TGGEPL Q + +PL++ L   G+E+++ET
Sbjct: 50  ------TIQTLDDIV---GQVASYRPRYVCVTGGEPLAQPNAIPLLKRLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIKGG------QELKLVFPQVNVSPENYIG 165
           +G ++       +           K     + +         ++K V             
Sbjct: 101 SGALDISAVDPRVSRVVDLKTPGSKEVARNRYENMALLTPNDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                                   +  +LA      N   RL +Q HK +
Sbjct: 161 LIQYGLDRRAGEVLFS--ASHHELKGRDLADWIVADNLPVRLQMQLHKIL 208


>gi|254167785|ref|ZP_04874635.1| radical SAM domain protein [Aciduliprofundum boonei T469]
 gi|289597123|ref|YP_003483819.1| Radical SAM domain protein [Aciduliprofundum boonei T469]
 gi|197623313|gb|EDY35878.1| radical SAM domain protein [Aciduliprofundum boonei T469]
 gi|289534910|gb|ADD09257.1| Radical SAM domain protein [Aciduliprofundum boonei T469]
          Length = 209

 Score =  137 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 57/224 (25%), Positives = 96/224 (42%), Gaps = 43/224 (19%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            + E+F ++QGEG + G    F R +GCNL           +C +CDT++   +   G  
Sbjct: 2   KVNEMFTSIQGEGIYIGVPMFFVRLTGCNL-----------RCEWCDTEYAFYE---GEE 47

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDV-PLIQALNKRGFEIAVETNGTIE 123
            ++D +   +EE         ++  +TGGEPLLQ +V  LI  L ++ ++I VETNG+I 
Sbjct: 48  MSIDSIIKKVEE------SGMKWVCITGGEPLLQEEVYKLIDILLRKDYKILVETNGSIL 101

Query: 124 PPQ---------GIDWICVSPKAGCDLKIKGGQEL------KLVFPQVNV---SPENYIG 165
             +          +D    S K    ++ +    L      K V    N    + +    
Sbjct: 102 IDKLPTEENLVISLDIKTPSSKMERAMRFENLNYLGPKDFVKFVIMDENDFEYAKKIIEK 161

Query: 166 FDFER-FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           ++ ++    QP+    L+    LA     +    R+  Q HK I
Sbjct: 162 YEIDKEIIFQPVGSTNLKW---LAEKVVEEKLNVRVLPQLHKII 202


>gi|15921783|ref|NP_377452.1| hypothetical protein ST1490 [Sulfolobus tokodaii str. 7]
 gi|15622570|dbj|BAB66561.1| 212aa long conserved hypothetical protein [Sulfolobus tokodaii str.
           7]
          Length = 212

 Score =  137 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 62/231 (26%), Positives = 99/231 (42%), Gaps = 39/231 (16%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M  Y I EIF ++QGEG   G  + F R +GC+L           +C +CDT +   +  
Sbjct: 1   MVKYWISEIFTSIQGEGEVIGTPSNFIRLAGCHL-----------RCIWCDTKYAWHK-Y 48

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
            G   +++Q+ D I+++        ++  +TGGEPLLQ  +PL++AL     ++ VET+G
Sbjct: 49  DGEEMSIEQILDKIDKRI-------KFTTITGGEPLLQDILPLVEALKSLNHKVLVETSG 101

Query: 121 TIEPPQG----IDWICVSPKAGCDLKIKGGQ--------ELKLVFPQVNVSPENYIGF-- 166
           TI+P +     +D   VSPK                     K V        +  I F  
Sbjct: 102 TIKPSKKLRELVDIFSVSPKLSNSGYKFKYNFKDDNWVTYFKFVIVNPLEDIQEIIRFIR 161

Query: 167 ----DFERFSLQPMDGPFL-EENTNLAISYCFQ-NPKWRLSVQTHKFIGIR 211
               +  +  LQP        E     I    +    +R+  Q H+ +GI+
Sbjct: 162 ENNIEPSKVILQPDGRKENYTEGLRELIDIILKLGIPFRVLPQFHRIVGIQ 212


>gi|86157724|ref|YP_464509.1| radical SAM family protein [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85774235|gb|ABC81072.1| Radical SAM [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 210

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 62/223 (27%), Positives = 86/223 (38%), Gaps = 41/223 (18%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            + EIF ++QGEG  AGR  VF RF+GC+L           +C +CDT +    G    R
Sbjct: 2   RVTEIFFSIQGEGSRAGRPCVFVRFTGCDL-----------RCGYCDTAYAFHGGVDMDR 50

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVETNGTIE 123
             V                  R+  LTGGEP+LQ ++P L + L  RG+E+AVET+G   
Sbjct: 51  AAV---------LAEVARHPARFVCLTGGEPMLQRELPDLARDLVARGYEVAVETHGQRP 101

Query: 124 PP--QGIDWICVSPKAGCD----------LKIKGGQELKLVFPQVN---VSPENYIGFDF 168
                      V  K               +++   E+K V    +    S E       
Sbjct: 102 LDALPAEAIRVVDVKTPGSGEVTTDFAYLDRLQPHDEVKFVVCSEDDFRWSREVVRRHAL 161

Query: 169 E---RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           E   +    P  G     +  L           RLS+Q HK I
Sbjct: 162 EGRVQVLFSPAWGQVAPRD--LVRWMLESGLDARLSLQVHKVI 202


>gi|237800229|ref|ZP_04588690.1| radical SAM domain-containing protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|237806417|ref|ZP_04593121.1| radical SAM domain-containing protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331023086|gb|EGI03143.1| radical SAM domain-containing protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331027530|gb|EGI07585.1| radical SAM domain-containing protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 215

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 51/230 (22%), Positives = 83/230 (36%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I EIF +LQGE   AG   VF R +GC L           +C++CD+ +    G
Sbjct: 1   MQDTLRITEIFHSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAFSGG 49

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
                  +  L D++           RY  +TGGEPL Q + +PL++ L   G+E+++ET
Sbjct: 50  ------TIQTLDDIV---GQVASYRPRYVCVTGGEPLAQPNAIPLLKRLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIKGG------QELKLVFPQVNVSPENYIG 165
           +G ++       +           K     + +         ++K V             
Sbjct: 101 SGALDISAVDPRVSRVVDLKTPGSKEVSRNRYENMELLTPNDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                                   +  +LA      N   RL +Q HK +
Sbjct: 161 LIQYGLERRAGEVLFS--ASHHELKGRDLADWIVADNLPVRLQMQLHKIL 208


>gi|289626505|ref|ZP_06459459.1| radical SAM domain-containing protein [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289650951|ref|ZP_06482294.1| radical SAM domain-containing protein [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330868621|gb|EGH03330.1| radical SAM domain-containing protein [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 215

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 50/230 (21%), Positives = 84/230 (36%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I EIF +LQGE   AG   VF R +GC L           +C++CD+ +     
Sbjct: 1   MQDTLRITEIFHSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAF--- 46

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
           + G  + +D +   +           RY  +TGGEPL Q + +PL++ L   G+E+++ET
Sbjct: 47  SGGTIHTLDDIVGQVAA------YRPRYVCVTGGEPLAQPNAIPLLKRLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIK------GGQELKLVFPQVNVSPENYIG 165
           +G ++       +           K     + +         ++K V             
Sbjct: 101 SGALDISAVDPRVSRVVDLKTPGSKEVSRNRYENIELLTRNDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                                   +  +LA      N   RL +Q HK +
Sbjct: 161 LIQYGLERRAGEVLFS--ASHHELKGRDLADWIVADNLPVRLQMQLHKIL 208


>gi|330872644|gb|EGH06793.1| radical SAM domain-containing protein [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330964833|gb|EGH65093.1| radical SAM domain-containing protein [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 215

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 51/230 (22%), Positives = 83/230 (36%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I EIF +LQGE   AG   VF R +GC L           +C++CD+ +    G
Sbjct: 1   MQETLRITEIFHSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAFSGG 49

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
                  +  L D++           RY  +TGGEPL Q + +PL++ L   G+E+++ET
Sbjct: 50  ------TIQTLDDIV---GQVASYRPRYVCVTGGEPLAQPNAIPLLKRLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIKGG------QELKLVFPQVNVSPENYIG 165
           +G ++       +           K     + +         ++K V             
Sbjct: 101 SGALDISAVDPRVSRVVDLKTPGSKEVARNRYENMELLTPNDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                                   +  +LA      N   RL +Q HK +
Sbjct: 161 LIQYGLDRRAGEVLFS--ASHHELKGRDLADWIVADNLPVRLQMQLHKIL 208


>gi|28871114|ref|NP_793733.1| radical SAM domain-containing protein [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|28854364|gb|AAO57428.1| radical SAM domain protein [Pseudomonas syringae pv. tomato str.
           DC3000]
          Length = 215

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 51/230 (22%), Positives = 83/230 (36%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I EIF +LQGE   AG   VF R +GC L           +C++CD+ +    G
Sbjct: 1   MQETLRITEIFHSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAFSGG 49

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
                  +  L D++           RY  +TGGEPL Q + +PL++ L   G+E+++ET
Sbjct: 50  ------TIQTLDDIV---GQVASYRPRYVCVTGGEPLAQPNAIPLLKRLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIKGG------QELKLVFPQVNVSPENYIG 165
           +G ++       +           K     + +         ++K V             
Sbjct: 101 SGALDISAVDPRVSRVVDLKTPGSKEVARNRYENMALLTPNDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                                   +  +LA      N   RL +Q HK +
Sbjct: 161 LIQYGLDRRAGEVLFS--ASHHELKGRDLADWIVADNLPVRLQMQLHKIL 208


>gi|26987960|ref|NP_743385.1| radical SAM domain protein [Pseudomonas putida KT2440]
 gi|148546497|ref|YP_001266599.1| radical SAM domain-containing protein [Pseudomonas putida F1]
 gi|24982673|gb|AAN66849.1|AE016313_8 radical activating enzyme [Pseudomonas putida KT2440]
 gi|5514780|emb|CAB50782.1| hypothetical protein [Pseudomonas putida]
 gi|148510555|gb|ABQ77415.1| Radical SAM domain protein [Pseudomonas putida F1]
 gi|313497577|gb|ADR58943.1| Radical SAM domain protein [Pseudomonas putida BIRD-1]
          Length = 215

 Score =  136 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 49/230 (21%), Positives = 84/230 (36%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I E+F +LQGE   AG   VF R +GC L           +C++CD+ +     
Sbjct: 1   MQDTLRITEVFYSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAF--- 46

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
           + G    +D + + +         + RY  +TGGEPL Q + +PL+Q L   G+E+++ET
Sbjct: 47  SGGTVRTLDSILEQV------AGFKPRYVCVTGGEPLAQPNALPLLQRLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIK------GGQELKLVFPQVNVSPENYIG 165
           +G ++       +           +     + +         ++K V             
Sbjct: 101 SGALDIAGTDTRVSRVVDLKTPGSEESHRNRYENIEQLTRNDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                           P        +  LA      N   R  +Q HK +
Sbjct: 161 LIQYNLAERAGEVLFSPSHHQVNASD--LADWIVADNLPVRFQLQLHKLL 208


>gi|282895310|ref|ZP_06303512.1| hypothetical protein CRD_00006 [Raphidiopsis brookii D9]
 gi|281199616|gb|EFA74476.1| hypothetical protein CRD_00006 [Raphidiopsis brookii D9]
          Length = 208

 Score =  136 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 59/222 (26%), Positives = 92/222 (41%), Gaps = 33/222 (14%)

Query: 3   LYSIKEIFL-TLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
              I E F  T+QGEG   G +  F R SGC L            C +CDT +    G  
Sbjct: 7   KLPIHETFQSTVQGEGYWTGSLVDFIRLSGCPL-----------GCPWCDTGYA-DGGAN 54

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVETNG 120
             R+    + +L+ E            V++GGEP +   +P L+QAL   G ++++ET+G
Sbjct: 55  LPRFE-RTIGELLAEIK------SPRIVISGGEPFIHKHLPELVQALLGAGKQVSIETSG 107

Query: 121 -TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFER--------- 170
              +      WI +SPK   + K     +      +  +  E     DF +         
Sbjct: 108 SFWKEVSLSAWITLSPKEHINPKYPVQNQFWSRANEAKIVIETGQEIDFYQEYLSARPDL 167

Query: 171 -FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              LQP      +    +      Q P ++LS+QTHK+IG++
Sbjct: 168 YVYLQPEWNSSSKSLALILQLL-QQKPDYKLSLQTHKYIGLQ 208


>gi|71735883|ref|YP_275904.1| radical SAM domain-containing protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257487001|ref|ZP_05641042.1| radical SAM domain-containing protein [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|298488200|ref|ZP_07006236.1| Queuosine Biosynthesis QueE Radical SAM [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|71556436|gb|AAZ35647.1| radical SAM domain protein [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|298157258|gb|EFH98342.1| Queuosine Biosynthesis QueE Radical SAM [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320323043|gb|EFW79132.1| radical SAM domain-containing protein [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329685|gb|EFW85674.1| radical SAM domain-containing protein [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330877970|gb|EGH12119.1| radical SAM domain-containing protein [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330892249|gb|EGH24910.1| radical SAM domain-containing protein [Pseudomonas syringae pv.
           mori str. 301020]
 gi|330988978|gb|EGH87081.1| radical SAM domain-containing protein [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009357|gb|EGH89413.1| radical SAM domain-containing protein [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 215

 Score =  136 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 51/230 (22%), Positives = 83/230 (36%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I EIF +LQGE   AG   VF R +GC L           +C++CD+ +    G
Sbjct: 1   MQDTLRITEIFHSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAFSGG 49

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
                  +  L D++           RY  +TGGEPL Q + +PL++ L   G+E+++ET
Sbjct: 50  ------TIQTLDDIV---GQVAAYRPRYVCVTGGEPLAQPNAIPLLKRLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIK------GGQELKLVFPQVNVSPENYIG 165
           +G ++       +           K     + +         ++K V             
Sbjct: 101 SGALDISAVDPRVSRVVDLKTPGSKEVSRNRYENIELLTRNDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                                   +  +LA      N   RL +Q HK +
Sbjct: 161 LIQYGLERRAGEVLFS--ASHHELKGRDLADWIVADNLPVRLQMQLHKIL 208


>gi|325274586|ref|ZP_08140642.1| radical SAM domain-containing protein [Pseudomonas sp. TJI-51]
 gi|324100228|gb|EGB98018.1| radical SAM domain-containing protein [Pseudomonas sp. TJI-51]
          Length = 215

 Score =  136 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 51/230 (22%), Positives = 83/230 (36%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I E+F +LQGE   AG   VF R +GC L           +C++CD+ +     
Sbjct: 1   MQDTLRITEVFYSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAF--- 46

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
           + G    +D + + +           RY  +TGGEPL Q + +PL+Q L   G+E+++ET
Sbjct: 47  SGGTVRTLDSILEQV------AGFRPRYVCVTGGEPLAQPNALPLLQRLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWIC--VSPKAGCDLKIK-----------GGQELKLVFPQVNVSPENYIG 165
           +G ++       +   V  K     +                ++K V             
Sbjct: 101 SGALDIAGTDTRVSRVVDLKTPGSEESHRNLYSNIDQLTRNDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                           P        +  LA      N   R  +Q HK +
Sbjct: 161 LIQYNLAERAGEVLFSPSHHQVSASD--LADWIVADNLPVRFQLQLHKLL 208


>gi|219850957|ref|YP_002465389.1| Radical SAM domain protein [Methanosphaerula palustris E1-9c]
 gi|219545216|gb|ACL15666.1| Radical SAM domain protein [Methanosphaerula palustris E1-9c]
          Length = 202

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 57/224 (25%), Positives = 87/224 (38%), Gaps = 40/224 (17%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            I EIFL+LQGEG + G+  +F R SGCNL            C +CDT +     T G  
Sbjct: 2   KISEIFLSLQGEGVYQGKACIFIRLSGCNLS-----------CSWCDTRYA---CTLGEE 47

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGE--PLLQVDVPLIQALNKRGFEIAVETNGTI 122
              +Q+ + + E+            +TGGE        +PL++AL  RG+ + +ETNGTI
Sbjct: 48  MTTEQVLERVSEE------NCSLICITGGEPLLQQDQLLPLLKALEDRGYIVGIETNGTI 101

Query: 123 EPPQGIDWICVSPKAGCD-----------LKIKGGQELKLVFPQVNVSPENYIGFDFE-- 169
           +     ++  +     C              I+    +K V                   
Sbjct: 102 DFIASGEYASICMDVKCPSSGETSDLSLLEHIRVTDSVKFVVKDQQDCAYAESVIRDHPI 161

Query: 170 --RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
                  P+ G    E T LA     ++      +Q HK IG++
Sbjct: 162 KGTIFFSPVFGS---EYTALASFVLTRHLPVTFQMQLHKIIGVK 202


>gi|285019180|ref|YP_003376891.1| organic radical activating enzyme protein [Xanthomonas albilineans
           GPE PC73]
 gi|283474398|emb|CBA16899.1| putative organic radical activating enzyme protein [Xanthomonas
           albilineans]
          Length = 225

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 81/226 (35%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
              + EIFL+LQGE   AG   VF R +GC L           +C +CDT +       G
Sbjct: 15  RLKLTEIFLSLQGEADSAGWPTVFVRLTGCPL-----------RCSYCDTAYAFH---GG 60

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNGT 121
             +++D +   +           R+  +TGGEPL Q   + L+Q+L   G+++++ET+G 
Sbjct: 61  QWWDIDAILAEVAR------HGVRHVCVTGGEPLAQKRCLQLLQSLCDTGYDVSLETSGA 114

Query: 122 IEPPQGID-------WICVSPKAGCDLKIKG------GQELKLV------FPQVNVSPEN 162
           ++  +              +       + +         ++K V      +         
Sbjct: 115 LDIAEVDPRVSRVLDIKTPASHEAQRNRWENLTLLTARDQIKFVLCGRADYEWARALVAE 174

Query: 163 YIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
           +           P       +   LA          R  +Q HK +
Sbjct: 175 HQLQARCMVWFSP--SKSDLDARELADWIVADRLPVRFQMQLHKLL 218


>gi|289207754|ref|YP_003459820.1| radical SAM protein [Thioalkalivibrio sp. K90mix]
 gi|288943385|gb|ADC71084.1| Radical SAM domain protein [Thioalkalivibrio sp. K90mix]
          Length = 232

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 48/224 (21%), Positives = 80/224 (35%), Gaps = 42/224 (18%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            I E+F++LQGE   +G    F R +GC L           +CR+CD+ +       G  
Sbjct: 24  RITEMFVSLQGEAADSGWPTAFVRLTGCPL-----------RCRWCDSAYAF---EGGEA 69

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNGTIE 123
             +D +          G+   R+  +TGGEPL Q     L+  L   G+ +++ET+G ++
Sbjct: 70  RALDSILA------WVGQTGVRHVCVTGGEPLAQPGCRELLARLCDDGYRVSLETSGALD 123

Query: 124 PPQGIDWICVSPKAGCDLKIKGGQELKLVFP------QVNVSPENYIGFDFE-------- 169
                  + V          +  + L+          Q+     N   FD+         
Sbjct: 124 IGGLDARVTVVMDWKAPGSGEQDRNLEANIAHLAAGDQLKFVLANRADFDWACAELGRLD 183

Query: 170 -----RFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                     P+ G        LA     +    R  +Q HK +
Sbjct: 184 LAPGVEVLFSPVFGELAPR--ELADWIVAERLAVRFQLQLHKLL 225


>gi|330975318|gb|EGH75384.1| radical SAM family protein [Pseudomonas syringae pv. aptata str.
           DSM 50252]
          Length = 215

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 51/230 (22%), Positives = 82/230 (35%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I EIF +LQGE   AG   VF R +GC L           +C++CD+ +    G
Sbjct: 1   MQDTLRITEIFHSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAFSGG 49

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
                  +  L D+            RY  +TGGEPL Q + +PL++ L   G+E+++ET
Sbjct: 50  ------TIQTLDDI---LGQVASYRPRYVCVTGGEPLAQPNAIPLLKRLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIKGG------QELKLVFPQVNVSPENYIG 165
           +G ++       +           K     + +         ++K V             
Sbjct: 101 SGALDISAVDPRVSRVVDLKTPGSKEVSRNRYENMELLTANDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                                   +  +LA      N   RL +Q HK +
Sbjct: 161 LIQYGLDRRAGEVLFS--ASHHELKGRDLADWIVADNLPVRLQMQLHKIL 208


>gi|226328670|ref|ZP_03804188.1| hypothetical protein PROPEN_02565 [Proteus penneri ATCC 35198]
 gi|225203403|gb|EEG85757.1| hypothetical protein PROPEN_02565 [Proteus penneri ATCC 35198]
          Length = 152

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/153 (28%), Positives = 61/153 (39%), Gaps = 25/153 (16%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y I E+F TLQGEG   G  A+F R  GC +            C +CDT     +  +
Sbjct: 1   MQYPINEVFQTLQGEGVFTGVPALFVRLQGCPV-----------GCSWCDTKHTWEKEDE 49

Query: 62  G---------GRYNVDQLADL----IEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALN 108
                          D   +     I   +       ++ V+TGGEP L    PL + L 
Sbjct: 50  KKVLLGDIPIKTQESDTWGEASVAQILSLFQQQGYSAKHVVITGGEPCLYDLRPLTEGLE 109

Query: 109 KRGFEIAVETNGTIEP-PQGIDWICVSPKAGCD 140
           + GF   +ET+GT +       W+ +SPK G  
Sbjct: 110 QAGFACQIETSGTHDILCSEKTWVTLSPKVGMK 142


>gi|206889913|ref|YP_002249329.1| radical activating enzyme [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206741851|gb|ACI20908.1| radical activating enzyme [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 208

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 54/227 (23%), Positives = 86/227 (37%), Gaps = 42/227 (18%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            + EIF ++QGE   AG   VF R +GCNL           +C +CDT +   +   G  
Sbjct: 2   KVCEIFTSIQGESSLAGIPMVFVRLTGCNL-----------RCSYCDTKYAYYE---GEE 47

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIEP 124
            +++++ + I           +Y  +TGGEPLLQ +   +     +   + +ETNG+I  
Sbjct: 48  LSINKVLEKIH------SFPFQYVEITGGEPLLQDETYKLINELVKSHNVLIETNGSIPI 101

Query: 125 PQGIDWICV-----SPKAGCDLKI--------KGGQELKLVFPQVNVSPE-----NYIGF 166
            +    + +     +P +G   K         K   E+K V    +              
Sbjct: 102 EKVNPEVKIIMDIKTPGSGMSEKNYIENLRFLKKIDEVKFVLTNRDDYEWAKNFIKNHEI 161

Query: 167 DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI--GIR 211
                   P  G        LA          RL++Q HK+I   IR
Sbjct: 162 KANEILFSPAYGILNPA--ELAKWLINDGISVRLNLQIHKYIFGNIR 206


>gi|58581294|ref|YP_200310.1| radical activating enzyme [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|58425888|gb|AAW74925.1| radical activating enzyme [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 210

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 46/224 (20%), Positives = 76/224 (33%), Gaps = 42/224 (18%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            I EIFL+LQGE   AG   VF R +GC L           +C +CDT +       G  
Sbjct: 2   KITEIFLSLQGEAEAAGWPTVFVRLTGCPL-----------RCVYCDTAYAFH---GGEW 47

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTIE 123
           +++D +   +           R+  +TGGEPL Q    + +Q L   G+++++ET+G ++
Sbjct: 48  HDIDDVLAEV------ATHGVRHVCVTGGEPLAQKRCLVLLQKLCDAGYDVSLETSGALD 101

Query: 124 PPQGID-------WICVSPKAGCDLKIKG------GQELKLVFPQVNVSP------ENYI 164
                            +       + +         ++K V                + 
Sbjct: 102 VSAVDPRVSRVVDIKTPASGEEARNRWENLLLLTARDQIKFVICSRADYEWSREIVAAHA 161

Query: 165 GFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                     P           LA          R  +Q HK +
Sbjct: 162 LDRRCTVWFSPSKSEVGPR--QLADWIVADRLPVRFQMQLHKLL 203


>gi|330950598|gb|EGH50858.1| radical SAM family protein [Pseudomonas syringae Cit 7]
          Length = 215

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 51/230 (22%), Positives = 82/230 (35%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I EIF +LQGE   AG   VF R +GC L           +C++CD+ +    G
Sbjct: 1   MQDTLRITEIFHSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAFSGG 49

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
                  +  L D+            RY  +TGGEPL Q + +PL++ L   G+E+++ET
Sbjct: 50  ------TIQTLDDI---LGQVASYRPRYVCVTGGEPLAQPNAIPLLKRLCDSGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIKGG------QELKLVFPQVNVSPENYIG 165
           +G ++       +           K     + +         ++K V             
Sbjct: 101 SGALDISAVDPRVSRVVDLKTPGSKEVSRNRYENMELLTANDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                                   +  +LA      N   RL +Q HK +
Sbjct: 161 LIQYGLDRRAGEVLFS--ASHHELKGRDLADWIVADNLPVRLQMQLHKIL 208


>gi|325981315|ref|YP_004293717.1| Radical SAM domain-containing protein [Nitrosomonas sp. AL212]
 gi|325530834|gb|ADZ25555.1| Radical SAM domain protein [Nitrosomonas sp. AL212]
          Length = 219

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 77/227 (33%), Gaps = 42/227 (18%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
               + EIF +LQGE    G   VF R +GC L           +C +CDT +    G  
Sbjct: 8   TTLRVNEIFFSLQGETSRVGLPTVFVRLTGCPL-----------RCGYCDTAYAFTGGEN 56

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNG 120
               ++ ++ + I         +  Y  +TGGEPL Q    + + AL    + +++ET+G
Sbjct: 57  ---ISIAEILNRI------AHYKTNYITVTGGEPLAQKACLVLLTALCDAKYSVSLETSG 107

Query: 121 -------TIEPPQGIDWICVSPKAGCDLKIKG------GQELKLVFPQVNVSPENYIGFD 167
                   +   + +D              +         E+K V               
Sbjct: 108 ALDLSQVDLRVCKVMDIKTPGSGEVTKNNWENLIHLTPKDEIKFVLCDEADYQWAREIIR 167

Query: 168 FERFSL------QPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
            ++ SL       P+          LA          R+ +Q HK +
Sbjct: 168 CKQLSLLCPILFSPVYDVLNPA--TLASWILRDELPVRMQLQMHKLL 212


>gi|28198799|ref|NP_779113.1| radical activating enzyme [Xylella fastidiosa Temecula1]
 gi|182681498|ref|YP_001829658.1| radical SAM domain-containing protein [Xylella fastidiosa M23]
 gi|28056890|gb|AAO28762.1| radical activating enzyme [Xylella fastidiosa Temecula1]
 gi|182631608|gb|ACB92384.1| Radical SAM domain protein [Xylella fastidiosa M23]
 gi|307579952|gb|ADN63921.1| radical SAM domain-containing protein [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 217

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 50/225 (22%), Positives = 82/225 (36%), Gaps = 42/225 (18%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             I EIFL+LQGE    G   VF R +GC L           +C++CDT +       G 
Sbjct: 8   LKISEIFLSLQGEANSVGWPTVFVRLTGCPL-----------RCQYCDTSYAFH---GGE 53

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNGTI 122
             ++D + + +           R+  +TGGEPL Q   + L++ L   GFE+++ET+G +
Sbjct: 54  WRSIDTIVNEV------RSYGVRHVCVTGGEPLAQKRCLLLLEKLCDAGFEVSLETSGAL 107

Query: 123 EPPQGIDWIC-----VSPKAGCDLKIKGG--------QELKLV------FPQVNVSPENY 163
           +       +       +P +G   +             ++K V      +         +
Sbjct: 108 DIAAVDSRVSRVVDIKTPGSGEAHRNHWPNLTLLTPNDQIKFVLCSRVDYEWARTCVAEH 167

Query: 164 IGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                      P         T LA          R  +Q HK +
Sbjct: 168 ELERRCMVWFSPSKQDIAP--TLLADWIISDRLGVRFQLQLHKLL 210


>gi|317054935|ref|YP_004103402.1| Radical SAM domain-containing protein [Ruminococcus albus 7]
 gi|315447204|gb|ADU20768.1| Radical SAM domain protein [Ruminococcus albus 7]
          Length = 224

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 65/232 (28%), Positives = 93/232 (40%), Gaps = 40/232 (17%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M    + E F+++ GEG +AG +A+F RF+GCNL            C +CDT +      
Sbjct: 1   MGTLKLAENFVSINGEGRYAGELALFMRFAGCNLQ-----------CDWCDTKWANGADA 49

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDV-PLIQALNKRGFEIAVETN 119
                   QLA++ E+             LTGGEPLLQ D+  LI ALN RG ++ +ETN
Sbjct: 50  PFTEKTAVQLAEIAEDA--ADGYGLHRVTLTGGEPLLQKDIAELINALNDRGLDVEIETN 107

Query: 120 GTIEPPQGIDWICVSPKAGCDLK-----------------IKGGQELKLVFPQVNVSPEN 162
           G++      +   V P    D K                 +K    LK V          
Sbjct: 108 GSVPIAPVAEICRVRPVFTMDYKLPSSGMESRMCIENLSQLKESDTLKFVCASKEDLKRA 167

Query: 163 YIGFD----FERFSLQPMDGPFLEENTNLAISYCFQNP--KWRLSVQTHKFI 208
               D         L P+ G    ++    + +  +    K RL +Q HKFI
Sbjct: 168 VWVLDTYEPVCMVYLSPVFGRIEPKDM---VEFMKEKKLGKVRLQLQLHKFI 216


>gi|189219299|ref|YP_001939940.1| Organic radical activating enzyme [Methylacidiphilum infernorum V4]
 gi|189186157|gb|ACD83342.1| Organic radical activating enzyme [Methylacidiphilum infernorum V4]
          Length = 233

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 53/226 (23%), Positives = 89/226 (39%), Gaps = 46/226 (20%)

Query: 6   IKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRY 65
           + E+FL++QGE   AG    F R +GCNL           +CR+CDT +     + G   
Sbjct: 23  VNEMFLSIQGESTFAGYPCAFIRLTGCNL-----------RCRWCDTTYAF---SGGKLM 68

Query: 66  NVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNGTIEP 124
            +  + D ++        +     +TGGEPLLQ + + L+  L   G+E+ +ET+G++  
Sbjct: 69  PIRAVIDQVKA------YDVPLVEITGGEPLLQKNSLYLLTLLCDLGYEVLLETSGSLPV 122

Query: 125 PQGIDWI-------CVSPKAGCDLKIKG------GQELKLVFPQVNVSPE--------NY 163
            +    +       C S        +          ELK V                  +
Sbjct: 123 DRVDSRVHRIVDLKCPSSGQSEHNLLSNLDWLGKRDELKFVIADRKDYEWAKNKLTQGKH 182

Query: 164 IGFDFERFSLQPMDGPFLEENTNLAISYCFQ-NPKWRLSVQTHKFI 208
                +  +  P+ G   E +  L   +  +   K RL +Q HK+I
Sbjct: 183 WRDKVKAITFSPVFG---EMDPQLLSQWILEDKLKVRLGLQIHKYI 225


>gi|302187148|ref|ZP_07263821.1| radical SAM family protein [Pseudomonas syringae pv. syringae 642]
          Length = 215

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 50/230 (21%), Positives = 82/230 (35%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I EIF +LQGE   AG   VF R +GC L           +C++CD+ +    G
Sbjct: 1   MQDTLRITEIFHSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAFSGG 49

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
                  +  L D+            RY  +TGGEPL Q + +P +++L   G+E+++ET
Sbjct: 50  ------TIQTLDDI---LGQVASYRPRYVCVTGGEPLAQPNAIPFLKSLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIKGG------QELKLVFPQVNVSPENYIG 165
           +G ++       +           K     + +         ++K V             
Sbjct: 101 SGALDISAVDPRVSRVVDLKTPGSKEVSRNRYENMELLTANDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                                   +  +LA      N   RL +Q HK +
Sbjct: 161 LIQYGLDRRAGEVLFS--ASHHELKGRDLADWIVADNLPVRLQMQLHKIL 208


>gi|71275793|ref|ZP_00652077.1| Radical SAM [Xylella fastidiosa Dixon]
 gi|71900392|ref|ZP_00682525.1| Radical SAM [Xylella fastidiosa Ann-1]
 gi|170730227|ref|YP_001775660.1| radical activating enzyme [Xylella fastidiosa M12]
 gi|71163371|gb|EAO13089.1| Radical SAM [Xylella fastidiosa Dixon]
 gi|71729824|gb|EAO31922.1| Radical SAM [Xylella fastidiosa Ann-1]
 gi|167965020|gb|ACA12030.1| radical activating enzyme [Xylella fastidiosa M12]
          Length = 217

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 50/225 (22%), Positives = 83/225 (36%), Gaps = 42/225 (18%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             I EIFL+LQGE    G   VF R +GC L           +C++CDT +       G 
Sbjct: 8   LKISEIFLSLQGEANSVGWPTVFVRLTGCPL-----------RCQYCDTSYAFH---GGE 53

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNGTI 122
             ++D + + +           R+  +TGGEPL Q   + L++ L   GFE+++ET+G +
Sbjct: 54  WRSIDTIVNEV------RSYGVRHVCVTGGEPLAQKRCLLLLEKLCDAGFEVSLETSGAL 107

Query: 123 EPPQGIDWIC-----VSPKAGCDLKIKG--------GQELKLV------FPQVNVSPENY 163
           +       +       +P +G   +             ++K V      +         +
Sbjct: 108 DIAAVDSRVSRVVDIKTPGSGEAHRNHWPNLTLLTPHDQIKFVLCSRVDYEWARTCVAEH 167

Query: 164 IGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                      P         T LA        + R  +Q HK +
Sbjct: 168 ELERRCMVWFSPSKQDIAP--TVLADWIISDRLEVRFQLQLHKLL 210


>gi|163815376|ref|ZP_02206751.1| hypothetical protein COPEUT_01541 [Coprococcus eutactus ATCC 27759]
 gi|158449350|gb|EDP26345.1| hypothetical protein COPEUT_01541 [Coprococcus eutactus ATCC 27759]
          Length = 222

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 56/234 (23%), Positives = 92/234 (39%), Gaps = 46/234 (19%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M  Y + E F+++ GE   AG +AVF RF+GCNL  G           +CDT +    G 
Sbjct: 1   MSTYRVVERFISINGEAARAGELAVFIRFAGCNLNCG-----------YCDTKWANEPGV 49

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKR--GFEIAVET 118
                  D+L D +         E +   LTGGEPL+Q D+  +           + +ET
Sbjct: 50  DYQELTEDELVDYVRRT------EVKNVTLTGGEPLIQKDIDKLLLAFALEDDIRVEIET 103

Query: 119 NGTIEPPQ----------GIDWICVSPKAGCDLKIKGGQELKL-------VFPQVNVSP- 160
           NG+++  +           +D+ C S     D+ +     +         V  Q ++   
Sbjct: 104 NGSVDIAEFKALGGNVSYTLDYKCPSSGMESDMCLANYNYIDKNDSVKFVVGSQEDLEKC 163

Query: 161 ----ENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQN--PKWRLSVQTHKFI 208
                 Y   +  R  + P+ G     +    + +  +N     +L +Q HKFI
Sbjct: 164 LEIIREYALDERTRVFISPVYGSIDPAD---IVDFMIENGMNDVKLQLQLHKFI 214


>gi|262375547|ref|ZP_06068780.1| 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE
           [Acinetobacter lwoffii SH145]
 gi|262309801|gb|EEY90931.1| 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE
           [Acinetobacter lwoffii SH145]
          Length = 236

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 55/234 (23%), Positives = 86/234 (36%), Gaps = 51/234 (21%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             I EIF +LQGE   AG   VF R +GC L           +C +CDT +       G 
Sbjct: 18  LRITEIFYSLQGEANAAGLPTVFIRLTGCPL-----------RCSYCDTTYSF---EGGE 63

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVETNGTI 122
           R ++D +         T + +  Y  +TGGEPL Q + +PL+Q L   G E+++ET+G +
Sbjct: 64  RQSLDDIIQ------TTLDFKTPYVCVTGGEPLAQPNALPLMQRLADLGCEVSLETSGAL 117

Query: 123 EPPQGIDWICVSPK-------------AGCDLKIKGGQELKLVFPQVNVSPENYIGFDFE 169
           +  +    I                        +    ++K V    N     +     E
Sbjct: 118 DVSKVDPRISKVLDLKTPTSGEVARNLLSNLDHLTAHDQIKFVIC--NREDYEWSKQQLE 175

Query: 170 RFSLQ---------PMDGPFL------EENTNLAISYCFQNPKWRLSVQTHKFI 208
           ++ LQ         P                +LA      +   R  +Q HK +
Sbjct: 176 QYQLQDKVSTVWFSPAFSVEKGAVCLPPLARDLAQWILEDHLPVRFQLQLHKLL 229


>gi|330968882|gb|EGH68948.1| radical SAM family protein [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 215

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 50/230 (21%), Positives = 81/230 (35%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I EIF +LQGE   AG   VF R +GC L           +C++CD+ +    G
Sbjct: 1   MQDTLRITEIFHSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAFSGG 49

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
                  +  L D+            RY  +TGGEPL Q + + L++ L   G+E+++ET
Sbjct: 50  ------TIQTLDDI---LGQVASYRPRYVCVTGGEPLAQPNAIALLRRLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIKGG------QELKLVFPQVNVSPENYIG 165
           +G ++       +           K     + +         ++K V             
Sbjct: 101 SGALDISAVDPRVSRVVDLKTPGSKEVSRNRYENMELLTANDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                                   +  +LA      N   RL +Q HK +
Sbjct: 161 LIQYGLDRRAGEVLFS--ASHHELKGRDLADWIVADNLPVRLQMQLHKIL 208


>gi|42521688|ref|NP_967068.1| radical activating enzyme [Bdellovibrio bacteriovorus HD100]
 gi|39574218|emb|CAE77722.1| radical activating enzyme [Bdellovibrio bacteriovorus HD100]
          Length = 212

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 55/226 (24%), Positives = 86/226 (38%), Gaps = 42/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
           +  I EIF ++QGE  + G   VF R + CNL           +C +CDT +   +G   
Sbjct: 1   MLKINEIFYSIQGETTYVGCPTVFVRLTACNL-----------RCTYCDTKYSYYEGE-- 47

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGT 121
               +  L  +I E       +     +TGGEPLLQ +V   ++ L  +G+ +++ET+G+
Sbjct: 48  ----MQTLEAIIAEI---DSHKAPNVCITGGEPLLQKEVHTLMKTLCDKGYLVSLETSGS 100

Query: 122 IEPPQGIDWICV-------------SPKAGCDLKIKGGQELKLVFPQVNVSPENYI---- 164
                    + +             S             E K V         +      
Sbjct: 101 KSVEMVDPRVKIILDVKTPDSGAADSFVMENIGFSTPSTEYKFVICSEKDFEWSEEFCRQ 160

Query: 165 GFDFERFSL--QPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
              FE+F +   P  G   E    LA     +N   RL +Q HK+I
Sbjct: 161 HNLFEKFVVLYSPSYGQVSERW--LAEKILQKNSSARLQLQLHKYI 204


>gi|146304722|ref|YP_001192038.1| radical SAM domain-containing protein [Metallosphaera sedula DSM
           5348]
 gi|145702972|gb|ABP96114.1| Radical SAM domain protein [Metallosphaera sedula DSM 5348]
          Length = 210

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 67/230 (29%), Positives = 99/230 (43%), Gaps = 40/230 (17%)

Query: 2   KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
             Y I EIF ++QGEG   G+ + F R +GCNL           +C +CDT F  I+   
Sbjct: 1   MRYWIVEIFTSIQGEGLVIGKPSNFVRLAGCNL-----------RCVWCDTKFSWIREDG 49

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT 121
                   +   +EE      +  ++  +TGGEPLLQ  +PL   L   G+ +AVETNGT
Sbjct: 50  --------VPMELEEITGKLSRSVKWTTITGGEPLLQDILPLASTLKNLGYNVAVETNGT 101

Query: 122 IEPPQG----IDWICVSPK---AGCDLKIKGGQELKLVFPQVNVSPE----------NYI 164
           I+P Q     +D   VSPK   +G  L+    ++    +  V V P              
Sbjct: 102 IKPKQELRKIVDVFSVSPKLSNSGHKLRYDFSEDWATYYKFVIVEPNRDLREVKNFVEEH 161

Query: 165 GFDFERFSLQPMDGPFLE--ENTNLAISYCFQ-NPKWRLSVQTHKFIGIR 211
             D E+  +QP DG   +  +          +    +R+  Q H+ I  R
Sbjct: 162 RIDPEKVIVQP-DGNRQDYIQALKELSDAVMELGLPFRVLPQLHRIISYR 210


>gi|312792432|ref|YP_004025355.1| Radical SAM domain-containing protein [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312179572|gb|ADQ39742.1| Radical SAM domain protein [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 225

 Score =  135 bits (339), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 58/226 (25%), Positives = 91/226 (40%), Gaps = 41/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            +++ E F++++GEG  +G  AVF RF+GCNL            C +CDT++   +  K 
Sbjct: 13  KFNVVEKFVSIEGEGIRSGYPAVFVRFAGCNLS-----------CSWCDTNYA-TENPKY 60

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNG- 120
            + ++D L   I    I      +   LTGGEPL+Q     LI  L   GFE+ +ETNG 
Sbjct: 61  EQIDIDTLLSFIASTGI------KRVTLTGGEPLIQPYIYILIDRLIYEGFEVNIETNGS 114

Query: 121 ------TIEPPQGIDWICVSPKAGCDLKIKG------GQELKLV---FPQVNVSPENYIG 165
                   +    +D+ C S      + +           LK V   +  +  +      
Sbjct: 115 VSIKHVPRDAIITMDYKCPSSGMEDRMIVDNINFLGQKDVLKFVVGTYEDLKSAERIIKT 174

Query: 166 FDF-ERFSLQPMDGPFLEENTNLAISYCFQNP--KWRLSVQTHKFI 208
           F         P+ G          + +  +N     RL +Q HK I
Sbjct: 175 FKPRCNIFFSPVFGKIEPR---EIVKFLLENELFDARLQLQLHKII 217


>gi|302870906|ref|YP_003839542.1| Radical SAM domain protein [Caldicellulosiruptor obsidiansis OB47]
 gi|302573765|gb|ADL41556.1| Radical SAM domain protein [Caldicellulosiruptor obsidiansis OB47]
          Length = 224

 Score =  135 bits (339), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 58/226 (25%), Positives = 92/226 (40%), Gaps = 41/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            +++ E F++++GEG  +G  AVF RF+GCNL            C +CDT +   +  K 
Sbjct: 12  KFNVVEKFVSIEGEGIRSGYPAVFVRFAGCNLS-----------CSWCDTKYA-TENPKY 59

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNG- 120
            + ++D L + I    I      +   LTGGEPL+Q     LI  L   GFE+ +ETNG 
Sbjct: 60  EQIDIDTLLNFIASTGI------KRVTLTGGEPLIQPYIYILIDRLIYEGFEVNIETNGS 113

Query: 121 ------TIEPPQGIDWICVSPKAGCDLKIKGGQEL--KLVFPQVNVSPENYIGFD----- 167
                   +    +D+ C S      + +     L  K V   V  + E+    +     
Sbjct: 114 VSIKCVPRDAIITMDYKCPSSGMEDRMIVDNINFLGQKDVLKFVVATHEDLKSAERIIKT 173

Query: 168 ---FERFSLQPMDGPFLEENTNLAISYCFQNP--KWRLSVQTHKFI 208
                     P+ G          + +  +N     R+ +Q HK I
Sbjct: 174 FNPKCNIFFSPVFGKIEP---AEIVKFLLENGLFDARVQLQLHKII 216


>gi|288559696|ref|YP_003423182.1| 7-cyano-7-deazaguanosine biosynthesis protein QueE
           [Methanobrevibacter ruminantium M1]
 gi|288542406|gb|ADC46290.1| 7-cyano-7-deazaguanosine biosynthesis protein QueE
           [Methanobrevibacter ruminantium M1]
          Length = 202

 Score =  135 bits (339), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 59/226 (26%), Positives = 89/226 (39%), Gaps = 39/226 (17%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M    + EIF + QGEG + G  A F R  GCNL            C +CDTD    +  
Sbjct: 1   MIKIKVSEIFTSFQGEGPYIGTPATFLRLYGCNLN-----------CPWCDTDISTYE-- 47

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRG--FEIAVET 118
                +VD++ +++  Q        R  V+TGGEP L     L + + +     +I +ET
Sbjct: 48  ---ILSVDEVFEILMTQMEFNN--IRILVITGGEPTL-QMEELKRLIKEIPDEIKIQIET 101

Query: 119 NGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVF------PQVNVSPENYIGFDF---E 169
           NG+I          +SPK   +   K   +   VF       Q ++    Y+   +   +
Sbjct: 102 NGSIFEYVPEIDYVISPKEDKETVFKNYYKYDNVFFKFVICSQEDIDEVIYLKDKYNYDK 161

Query: 170 RFSLQPMDGPFLEENTNLAISYCFQN----PKWRLSVQTHKFIGIR 211
              LQ       E           +N       +LSVQTHK++  R
Sbjct: 162 TIWLQGEFSKDGEMA-----DLIRENFPHLENVKLSVQTHKYLNQR 202


>gi|78188483|ref|YP_378821.1| radical activating enzyme, putative [Chlorobium chlorochromatii
           CaD3]
 gi|78170682|gb|ABB27778.1| radical activating enzyme, putative [Chlorobium chlorochromatii
           CaD3]
          Length = 226

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 53/239 (22%), Positives = 79/239 (33%), Gaps = 63/239 (26%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             I EIF ++QGE   AG    F R +GC              C +CDT +   +G    
Sbjct: 9   LRISEIFYSIQGEAFFAGFPCAFIRLAGC-----------GHGCNYCDTSYAEEKGE--- 54

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDV-PLIQALNKRGFEIAVETNGT- 121
              +   A++I++             +TGGEPLLQ  V PL++ L  RG ++ +ET G  
Sbjct: 55  ---LMAQAEIIKQAL---SYHAPIIEITGGEPLLQPAVYPLMEELCNRGEQVLLETGGFL 108

Query: 122 -IEPPQGIDWICVSPKAGCDLKIKGGQ------------------ELKLVFPQVNVSPEN 162
            +E         +  KA      +                     E K+V          
Sbjct: 109 SVEKVDKRVHKIIDLKAPSSGVAEKNNPANIRLALEAAPEEQRRFEFKMVIANREDYEWA 168

Query: 163 YIGFDFERF-------------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
               +                 +L P         T LA          RL +Q HK++
Sbjct: 169 KTLLEEHHIAAASTVTMGTVFGALSP---------TQLAEWILHDRLPVRLQLQLHKYL 218


>gi|66044666|ref|YP_234507.1| radical SAM family protein [Pseudomonas syringae pv. syringae
           B728a]
 gi|63255373|gb|AAY36469.1| Radical SAM [Pseudomonas syringae pv. syringae B728a]
          Length = 215

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 50/230 (21%), Positives = 81/230 (35%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I EIF +LQGE   AG   VF R +GC L           +C++CD+ +    G
Sbjct: 1   MQDTLRITEIFHSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAFSGG 49

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
                  +  L D+            RY  +TGGEPL Q + + L++ L   G+E+++ET
Sbjct: 50  ------TIQTLDDI---LGQVASYRPRYVCVTGGEPLAQPNAIALLKRLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIKGG------QELKLVFPQVNVSPENYIG 165
           +G ++       +           K     + +         ++K V             
Sbjct: 101 SGALDISAVDPRVSRVVDLKTPGSKEVSRNRYENMELLTANDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                                   +  +LA      N   RL +Q HK +
Sbjct: 161 LIQYGLDRRAGEVLFS--ASHHELKGRDLADWIVADNLPVRLQMQLHKIL 208


>gi|331007035|ref|ZP_08330269.1| Queuosine Biosynthesis QueE Radical SAM [gamma proteobacterium
           IMCC1989]
 gi|330419162|gb|EGG93594.1| Queuosine Biosynthesis QueE Radical SAM [gamma proteobacterium
           IMCC1989]
          Length = 218

 Score =  134 bits (338), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 42/224 (18%), Positives = 72/224 (32%), Gaps = 43/224 (19%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             I EIF ++QGE    G+  VF R +GC L           +C +CD+++       G 
Sbjct: 8   LKITEIFFSIQGEAQTVGKPTVFVRLTGCPL-----------RCHYCDSEYAFY---GGE 53

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQAL-NKRGFEIAVETNGTI 122
           R ++D +   +            Y  +TGGEPL Q +   + A   + G ++++ET+G +
Sbjct: 54  RMSLDDIMAKVM------SYGATYVCVTGGEPLAQPEARTLLAQLCENGLQVSLETSGAL 107

Query: 123 EPPQGIDWICVSPKAGCDLKIKG-------------GQELKLVFPQVNVSPENYIGFDFE 169
                   + V          +                ++K V         +       
Sbjct: 108 AIDNIDPRVSVVMDVKTPSSGEMSRNDYDNISLLRAEDQIKFVIGDRQDYEWSLFKVSEY 167

Query: 170 RF-------SLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHK 206
                       P+          L           R  +Q HK
Sbjct: 168 NLAGSVGEVLFSPIYEQLEPS--QLVEWILADRAPVRFQMQLHK 209


>gi|330936708|gb|EGH40896.1| radical SAM family protein [Pseudomonas syringae pv. pisi str.
           1704B]
          Length = 215

 Score =  134 bits (338), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 55/229 (24%), Positives = 87/229 (37%), Gaps = 42/229 (18%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I EIF +LQGE   AG   VF R +GC L           +C++CD+ +    G
Sbjct: 1   MQDTLRITEIFHSLQGETRTAGLPTVFVRLTGCPL-----------RCQYCDSAYAFSGG 49

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
                  +  L D+            RY  +TGGEPL Q + +PL++ L   G+E+++ET
Sbjct: 50  ------TIQTLDDI---LGQVASYRPRYVCVTGGEPLAQPNAIPLLKRLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERF 171
           +G ++       +           K     + +   EL     QV     +   +D+   
Sbjct: 101 SGALDISAVDPRVSRVVDLKTPGSKEVSRNRYENM-ELLTANDQVKFVICSREDYDWAVS 159

Query: 172 SLQP------------MDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
            L                     +  +LA      N   RL +Q HK +
Sbjct: 160 KLIQYGLDRRVGEVLFSASHHELKGHDLADWIVADNLPVRLQMQLHKIL 208


>gi|330896138|gb|EGH28359.1| radical SAM family protein [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 215

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 49/230 (21%), Positives = 80/230 (34%), Gaps = 44/230 (19%)

Query: 1   MK-LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQG 59
           M+    I EIF +LQGE   AG   VF R +GC             +C++CD+ +    G
Sbjct: 1   MQDTLRITEIFHSLQGETRTAGLPTVFVRLTGCPF-----------RCQYCDSAYAFSGG 49

Query: 60  TKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD-VPLIQALNKRGFEIAVET 118
                  +  L D+            RY  +TGGEPL Q + + L++ L   G+E+++ET
Sbjct: 50  ------TIQTLDDI---LGQVASYRPRYVCVTGGEPLAQPNAIALLKRLCDAGYEVSLET 100

Query: 119 NGTIEPPQGIDWI-------CVSPKAGCDLKIKGG------QELKLVFPQVNVSPENYIG 165
           +G ++       +           K     + +         ++K V             
Sbjct: 101 SGALDISAVDPRVSRVVDLKTPGSKEVSRNRYENMELLTANDQVKFVICSREDYDWAVSK 160

Query: 166 F-------DFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                                   +  +LA      N   RL +Q HK +
Sbjct: 161 LIQYGLDRRAGEVLFSASHQEL--KGRDLADWIVADNLPVRLQMQLHKIL 208


>gi|15838492|ref|NP_299180.1| hypothetical protein XF1894 [Xylella fastidiosa 9a5c]
 gi|9106987|gb|AAF84700.1|AE004009_7 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 227

 Score =  134 bits (337), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 49/225 (21%), Positives = 76/225 (33%), Gaps = 42/225 (18%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             I EIFL+LQGE    G   VF R +GC L           +C++CDT +       G 
Sbjct: 18  LKISEIFLSLQGEANSVGWPTVFVRLTGCPL-----------RCQYCDTAYAFH---GGE 63

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNGTI 122
             ++D +   +           R+  +TGGEPL Q   + L++ L   GFE+++ET+G +
Sbjct: 64  WCSIDTIVSEV------RSYGVRHVCVTGGEPLAQKRCLLLLEKLCDAGFEVSLETSGAL 117

Query: 123 EPPQGI-------DWICVSPKAGCDLKIKG------GQELKLV------FPQVNVSPENY 163
           +            D                        ++K V      +         +
Sbjct: 118 DIAAVDLRVSRVVDIKTPGSGEAHRNHWPNLALLTPHDQIKFVLCSRADYEWARTCVAEH 177

Query: 164 IGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                      P         T LA          R  +Q HK +
Sbjct: 178 ELERRCMVWFSPSKQDIAP--TVLADWIISDRLGVRFQLQLHKLL 220


>gi|282900250|ref|ZP_06308202.1| hypothetical protein CRC_01639 [Cylindrospermopsis raciborskii
           CS-505]
 gi|281194865|gb|EFA69810.1| hypothetical protein CRC_01639 [Cylindrospermopsis raciborskii
           CS-505]
          Length = 208

 Score =  134 bits (337), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 57/222 (25%), Positives = 92/222 (41%), Gaps = 33/222 (14%)

Query: 3   LYSIKEIFL-TLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTK 61
              I E F  T+QGEG   G +  F R SGC L            C +CDT +    G  
Sbjct: 7   KLPIHETFQSTVQGEGYWTGSLVDFIRLSGCPLS-----------CPWCDTGYA-DGGAN 54

Query: 62  GGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVP-LIQALNKRGFEIAVETNG 120
             R+    + +L+ E            V++GGEP +   +P L++AL   G ++++ET+G
Sbjct: 55  LPRFE-RTIGELLAELK------SPRIVISGGEPFIHKHLPELVEALLGAGKQVSIETSG 107

Query: 121 -TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFER--------- 170
              +      WI +SPK   + K     +      +  +  E     +F +         
Sbjct: 108 SFWKEVPLSAWITLSPKEHINPKYPVQNQFWSRANEAKIVIETGQEIEFYQEQLSAHPDL 167

Query: 171 -FSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
              LQP      +    +      Q P ++LS+QTHK+IG++
Sbjct: 168 CVYLQPEWNSSSKSLDLILQLL-QQKPDYKLSLQTHKYIGLQ 208


>gi|258516745|ref|YP_003192967.1| Radical SAM domain-containing protein [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257780450|gb|ACV64344.1| Radical SAM domain protein [Desulfotomaculum acetoxidans DSM 771]
          Length = 211

 Score =  134 bits (337), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 50/222 (22%), Positives = 79/222 (35%), Gaps = 38/222 (17%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            + EIF +LQGEG  AG   VF R +GCNL           +C +CDT +      +G  
Sbjct: 2   KVNEIFYSLQGEGITAGYPTVFIRLTGCNL-----------RCLYCDTVYAY---EEGQE 47

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGT--- 121
            +V  +AD + E          Y  +TGGEPL Q     +       + + +ETNG+   
Sbjct: 48  MSVKDVADRVHE------YGAHYVCITGGEPLQQKAELKLLLSLLNRYTVTIETNGSLSL 101

Query: 122 IEPPQGIDWICVSPKAGCDLKI-----------KGGQELKLVF---PQVNVSPENYIGFD 167
            +         +  K                  +   E+K +       + +      + 
Sbjct: 102 EDLSFNYCHFAMDIKTPGSGMHLYNDFSNIEFLRSKDEIKFIIGSRTDYDFARGIIEKYK 161

Query: 168 FERFSLQPMDGPFLEENTNLAISYCFQNP-KWRLSVQTHKFI 208
             +  +      F  E   LA           R+ +Q HK+I
Sbjct: 162 LAQKVIVTFSPVFGLEPRFLAQWVLEDKLFFVRVQLQIHKYI 203


>gi|312134204|ref|YP_004001542.1| Radical SAM domain-containing protein [Caldicellulosiruptor
           owensensis OL]
 gi|311774255|gb|ADQ03742.1| Radical SAM domain protein [Caldicellulosiruptor owensensis OL]
          Length = 224

 Score =  134 bits (337), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 56/226 (24%), Positives = 87/226 (38%), Gaps = 41/226 (18%)

Query: 3   LYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKG 62
            +++ E F++++GEG  +G  AVF RF+GCNL            C +CDT +   +  K 
Sbjct: 12  KFNVVEKFVSIEGEGIRSGYPAVFVRFAGCNLS-----------CSWCDTKYA-TENPKY 59

Query: 63  GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV-DVPLIQALNKRGFEIAVETNG- 120
            + ++D L   I           +   LTGGEPL+Q     LI  L   GFE+ +ETNG 
Sbjct: 60  EQIDIDTLLSFI------ASSGIKRVTLTGGEPLIQPYIYILIDRLIYEGFEVNIETNGS 113

Query: 121 -TIEPPQGIDWICVSPKAGCDLKIKGG-----------QELKLV---FPQVNVSPENYIG 165
            +I+       I +  K                       LK V   +  +  +      
Sbjct: 114 VSIKHVPRNAIITMDYKCPSSGMEDRMIVDNIHFLGQKDVLKFVVGTYEDLKSAERIIKT 173

Query: 166 FDF-ERFSLQPMDGPFLEENTNLAISYCFQNP--KWRLSVQTHKFI 208
           F         P+ G          + +  +N     R+ +Q HK I
Sbjct: 174 FKPRCNIFFSPVFGKIEP---AEIVKFLLENGLFDARVQLQLHKII 216


>gi|268609642|ref|ZP_06143369.1| MoaA family Fe-S oxidoreductase [Ruminococcus flavefaciens FD-1]
          Length = 225

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 58/233 (24%), Positives = 90/233 (38%), Gaps = 41/233 (17%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           M  + + E F+++ GEG  AG +A+F RF+GCNL           +C +CDT +   +  
Sbjct: 1   MGTFRLAEHFVSINGEGRLAGELALFLRFTGCNL-----------RCDWCDTMWANEKDA 49

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNK-RGFEIAVETN 119
                N   LA + ++ +   E   R   LTGGEPLLQ D+P +       G  I +ETN
Sbjct: 50  PYTLMNTSSLAKIAQQAYE--EYGVRNVTLTGGEPLLQEDLPELCGRIAGLGLNIEIETN 107

Query: 120 GTIEPPQ------------GIDWICVSPKAGCDLKIKGGQELKLV---------FPQVNV 158
           G +                 +D+   S K    +     + LK              +N 
Sbjct: 108 GAVPLEPFLSDKRTGRPVITMDYKLPSSKMEKHMCTDNFRYLKYFDTLKFVCGSLADLNR 167

Query: 159 SPENYIGFD-FERFSLQPMDGPFLEENTNLAISYCFQNP--KWRLSVQTHKFI 208
           + E    +       L P+ G          + +  +      RL +Q HK I
Sbjct: 168 AAEIIEEYKPECMIYLSPVFGRIEP---AEMVEFMKERKLGNVRLQLQLHKMI 217


>gi|88604065|ref|YP_504243.1| radical SAM family protein [Methanospirillum hungatei JF-1]
 gi|88189527|gb|ABD42524.1| Radical SAM [Methanospirillum hungatei JF-1]
          Length = 234

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 57/223 (25%), Positives = 84/223 (37%), Gaps = 42/223 (18%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGR 64
            I EIF +LQGEG  +G   +F R +GCNL            C +CDT      G     
Sbjct: 34  KIAEIFTSLQGEGLTSGYPTIFIRLAGCNLS-----------CSYCDTPASRQGGMD--- 79

Query: 65  YNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDV--PLIQALNKRGFEIAVETNGTI 122
                +++++    +       Y  +TGGEPLLQ D    L + L K G  +++ETNGT+
Sbjct: 80  ---MNVSEVVAGALLQK---PHYVCITGGEPLLQKDEVAELARQLIKAGKMVSIETNGTV 133

Query: 123 EPPQGIDWICVSPKAGCD-----------LKIKGGQELKLVFPQVNVSPENYIGF----D 167
                   I +     C              +K    +K V    +              
Sbjct: 134 PFDDLPSDISICMDVKCPSSGEFSNINLLSDLKSTDSVKFVVGTDDDLQYAEKVIMSHPT 193

Query: 168 FERFSLQPMDGPFLEENTNLAISYCF-QNPKWRLSVQTHKFIG 209
                + P+ G   +       SY   +N   R+ +Q HKFIG
Sbjct: 194 KAEIFISPIYGTDYQR----IASYILSRNLPARMQLQLHKFIG 232


>gi|50085673|ref|YP_047183.1| putative radical activating enzyme [Acinetobacter sp. ADP1]
 gi|49531649|emb|CAG69361.1| putative radical activating enzyme [Acinetobacter sp. ADP1]
          Length = 245

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 46/233 (19%), Positives = 80/233 (34%), Gaps = 49/233 (21%)

Query: 4   YSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
             I EIF +LQGE   AG   VF R +GC L           +C +CDT +       G 
Sbjct: 27  LRITEIFYSLQGEANAAGLPTVFIRLTGCPL-----------RCTYCDTTYSF---EGGE 72

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPL-IQALNKRGFEIAVETNGTI 122
           R ++D++ +           +  Y  +TGGEPL Q +  + +  L+  G ++++ET+GT+
Sbjct: 73  RLSLDEIIN------TALSYKTPYICVTGGEPLAQPNCLILLSRLSDLGCQVSLETSGTL 126

Query: 123 EPPQGIDWICVSPK---------------------AGCDLKIKGGQELKLVFPQVNVSPE 161
           +  +    +                              +K         ++ +  V   
Sbjct: 127 DVSKVDPRVSKVLDLKTPTSGEEKRNLLSNLDYLTQHDQIKFVICNHEDYIWSKQQVVEY 186

Query: 162 NYIGFDFERFSLQPMDG------PFLEENTNLAISYCFQNPKWRLSVQTHKFI 208
                        P            +   +LA      +   R  +Q HK +
Sbjct: 187 QLEK-KVSTVWFSPAFAVEKGAVKLPQLARDLAQWILDDHLPVRFQLQLHKLL 238


>gi|226952147|ref|ZP_03822611.1| radical activating enzyme [Acinetobacter sp. ATCC 27244]
 gi|294651041|ref|ZP_06728380.1| radical activating enzyme [Acinetobacter haemolyticus ATCC 19194]
 gi|226837109|gb|EEH69492.1| radical activating enzyme [Acinetobacter sp. ATCC 27244]
 gi|292823054|gb|EFF81918.1| radical activating enzyme [Acinetobacter haemolyticus ATCC 19194]
          Length = 238

 Score =  133 bits (335), Expect = 2e-29,   Method: Comp