RPSBLAST alignment for GI: 254780202 and conserved domain: pfam04055

>gnl|CDD|146602 pfam04055, Radical_SAM, Radical SAM superfamily. Radical SAM proteins catalyse diverse reactions, including unusual methylations, isomerisation, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation. Length = 165
 Score = 48.7 bits (116), Expect = 1e-06
 Identities = 33/123 (26%), Positives = 55/123 (44%), Gaps = 28/123 (22%)

Query: 31  GCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVL 90
           GCNL           +C +C    +  +G KG   + +++ +  +E    G       +L
Sbjct: 6   GCNL-----------RCTYCAFPSIRARG-KGRELSPEEILEEAKELARLG---VEVVIL 50

Query: 91  TGGEPLLQVDVP-----LIQALNKRGFEIAVETNGTIEPPQ--------GIDWICVSPKA 137
           TGGEPLL  D+      L++     G  I +ETNGT+   +        G+D + +S ++
Sbjct: 51  TGGEPLLLPDLVELLERLLKLEELEGIRITLETNGTLLDEELLEELKEAGLDRVSISLQS 110

Query: 138 GCD 140
           G D
Sbjct: 111 GDD 113