RPSBLAST alignment of GI: 254780202 and protein with PDBid: 3can

>3can_A Pyruvate-formate lyase-activating enzyme; structural genomics, PSI, MCSG, APC20359.1; 1.80A {Bacteroides vulgatus atcc 8482} Length = 182
 Score = 38.7 bits (89), Expect = 0.001
 Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 2/54 (3%)

Query: 89  VLTGGEPLLQVD--VPLIQALNKRGFEIAVETNGTIEPPQGIDWICVSPKAGCD 140
              GGEPLL  +  + +++   ++G   AV+T          + +        D
Sbjct: 8   TFCGGEPLLHPEFLIDILKRCGQQGIHRAVDTTLLARKETVDEVMRNCELLLID 61