RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780202|ref|YP_003064615.1| hypothetical protein CLIBASIA_00435 [Candidatus Liberibacter asiaticus str. psy62] (211 letters) >d2r4qa1 c.44.2.2 (A:171-273) Fructose-specific enzyme IIABC component FruA, middle domain {Bacillus subtilis [TaxId: 1423]} Length = 103 Score = 29.2 bits (66), Expect = 0.24 Identities = 9/27 (33%), Positives = 13/27 (48%) Query: 103 LIQALNKRGFEIAVETNGTIEPPQGID 129 L + + G EI VETNG+ + Sbjct: 22 LKEKAKELGVEIKVETNGSSGIKHKLT 48 >d2r48a1 c.44.2.2 (A:2-104) Mannose-specific enzyme IIBCA component ManP, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 103 Score = 28.9 bits (65), Expect = 0.31 Identities = 9/27 (33%), Positives = 13/27 (48%) Query: 103 LIQALNKRGFEIAVETNGTIEPPQGID 129 L +A ++ G I VET G I + Sbjct: 22 LQKAADRLGVSIKVETQGGIGVENKLT 48 >d2nn6g3 d.51.1.1 (G:195-274) Ribosomal RNA-processing protein 40, RRP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Score = 26.6 bits (59), Expect = 1.6 Identities = 11/28 (39%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Query: 96 LLQVDVPLIQALNKR-GFEIAVETNGTI 122 LL D +IQ + K EI NG I Sbjct: 15 LLAPDCEIIQEVGKLYPLEIVFGMNGRI 42 >d2dt5a1 a.4.5.38 (A:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]} Length = 74 Score = 26.1 bits (58), Expect = 2.3 Identities = 10/33 (30%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Query: 44 SAQCRFCDTDFVGIQGTKGGRYNVDQLADLIEE 76 + Q R D + G GT+G Y V L + Sbjct: 39 AFQVRK-DLSYFGSYGTRGVGYTVPVLKRELRH 70 >d2f1na1 d.151.1.1 (A:1-250) Cytolethal distending toxin subunit B {Escherichia coli [TaxId: 562]} Length = 250 Score = 25.8 bits (55), Expect = 2.6 Identities = 13/128 (10%), Positives = 29/128 (22%), Gaps = 8/128 (6%) Query: 15 GEGGHAGRVAVFCRF----SGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG---RYNV 67 GG +A+ + L D F V Sbjct: 91 ALGGRVN-LALVSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPALV 149 Query: 68 DQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIEPPQG 127 +++ + + + + +L + +R EI T + Sbjct: 150 EEVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPAAATQTSQRT 209 Query: 128 IDWICVSP 135 +D+ Sbjct: 210 LDYAVAGN 217 >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Score = 25.8 bits (56), Expect = 2.9 Identities = 12/46 (26%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Query: 56 GIQGTKG--GRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQV 99 G+ G +G GR+ + AD I +W + G+ +LQ Sbjct: 97 GLVG-RGLLGRWGPNHAADPIITRWKRDSSGNKIMHPVSGKHILQF 141 >d1a0tp_ f.4.3.2 (P:) Sucrose-specific porin {Enterobacterium (Salmonella typhimurium) [TaxId: 90371]} Length = 413 Score = 25.4 bits (55), Expect = 4.4 Identities = 16/42 (38%), Positives = 23/42 (54%) Query: 27 CRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRYNVD 68 F G LW+G+ DR + + D+D V + GT GG Y+V Sbjct: 105 GPFKGSTLWAGKRFDRDNFDIHWIDSDVVFLAGTGGGIYDVK 146 >d1gg3a2 b.55.1.5 (A:188-279) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Score = 24.8 bits (54), Expect = 5.2 Identities = 9/49 (18%), Positives = 19/49 (38%), Gaps = 7/49 (14%) Query: 164 IGFDFERFSLQPMDGPFLEENTNLAISYCFQNPK-----WRLSVQTHKF 207 I + F ++ G +E I + + + W++ V+ H F Sbjct: 44 ISYKRSSFFIKIRPGE--QEQYESTIGFKLPSYRAAKKLWKVCVEHHTF 90 >d1smya1 d.74.3.1 (A:1-49,A:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]} Length = 106 Score = 24.9 bits (54), Expect = 5.7 Identities = 11/66 (16%), Positives = 25/66 (37%), Gaps = 16/66 (24%) Query: 79 ITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIA----------------VETNGTI 122 E R +T G PL ++ + I + + F++ + T+G++ Sbjct: 23 FVLEPLERGFGVTLGNPLRRILLSSIPPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSV 82 Query: 123 EPPQGI 128 P + + Sbjct: 83 TPLEAL 88 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.322 0.142 0.450 Gapped Lambda K H 0.267 0.0709 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 838,325 Number of extensions: 39177 Number of successful extensions: 94 Number of sequences better than 10.0: 1 Number of HSP's gapped: 94 Number of HSP's successfully gapped: 10 Length of query: 211 Length of database: 2,407,596 Length adjustment: 81 Effective length of query: 130 Effective length of database: 1,295,466 Effective search space: 168410580 Effective search space used: 168410580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (23.5 bits)